WorldWideScience

Sample records for le fluide est

  1. Le bonheur est dans les airs

    OpenAIRE

    Robène, Luc; Bodin, Dominique; Héas, Stéphane

    2010-01-01

    A partir des années 1880, en France, la dimension touristique des ascensions en ballon prend une importance croissante. En marge des pratiques strictement utilitaires de l'aérostation s’élabore un univers davantage tourné vers la communion et / ou vers le face-à-face de l'homme avec la nature en altitude. L'observation du milieu aérien, la confrontation avec la sauvagerie des éléments et le bien-être que l'environnement vierge des hauteurs est susceptible de procurer aux aéronautes constituen...

  2. Le salaire minimum n'est pas toujours le meilleur moyen d'accroître ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... De fait, cette intervention vigoureuse sur le marché du travail est une ... la mobilité des travailleurs entre le secteur structuré et le secteur non structuré, ... On peut certes se constituer rapidement du capital politique en faisant ...

  3. De quoi le genre est-il le nom ?

    OpenAIRE

    Andrieu, Bernard

    2013-01-01

    Cette note de lecture présente une courte évolution des travaux sur le genre sous l’angle du rapport au corps en démontrant comment la dénaturalisation du corps et du sexe biologique a conduit à une description culturaliste des fonctions individuelles et des rôles sociaux. Si le genre dénaturalise le corps c’est en refusant toute référence au sexe ou à la sexualité en tant qu’ils seraient des données naturelles. Depuis son apparition en 1947, sous la plume de John Money, psychologue chargé du...

  4. Recherche sur le paranormal et croyances irrationnelles: quel est le lien?

    Directory of Open Access Journals (Sweden)

    Marie-Catherine Mousseau

    2005-06-01

    Full Text Available A la fin du 19ième siècle, les phénomènes paranormaux étaient couramment étudiés et débattus par les scientifiques les plus renommés (l'astronome Camille Flammarion, les physiciens William Crook et Oliver Lodge, les prix Nobel Charles Richet, Pierre et Marie Curie, .... Les débats étaient intenses et de haut niveau. Leurs travaux étaient généralement publiés dans des journaux prestigieux. Ce champ d'étude était appelé 'métapsychique'. Aujourd'hui, les questions qu'ils avaient soulevées sont complètement ignorées par la communauté scientifique. Ses représentants prétendent que le débat est clos et le considèrent démodé et ridicule. C'est devenu une sorte de 'tabou', 'un des plus puissants interdits des temps modernes'.

  5. Le big bang n'est pas une théorie comme les autres

    CERN Document Server

    Bonnet-Bidaud, Jean-Marc; Leglu, Dominique; Reinisch, Gilbert

    2009-01-01

    Le big bang n'est pas une théorie comme les autres. Ce n'est d'ailleurs pas une théorie physique au sens propre du terme, mais un scénario cosmologique issu des équations de la relativité générale. Il est le modèle qui s'ajuste le mieux aux observations actuelles, mais à quel prix ? Il nous livre un Univers composé à 96 % de matière et d'énergie noires inconnues. C'est donc un euphémisme que de dire que le big bang semble poser autant - sinon plus - de questions qu'il n'en résout. En ce sens, le big bang apparaît davantage comme une paramétrisation de notre ignorance plutôt que comme une modélisation d'un phénomène. Pourtant, le succès du big bang et l'adhésion qu'il suscite, tant dans la sphère scientifique que dans la sphère médiatique, ne se démentent pas. Surmédiatisé, son statut dépasse celui de modèle théorique, et la simple évocation de son nom suffit pour justifier des opérations de marketing scientifique ou rejeter des cosmologies alternatives. Pour éclaircir les pr...

  6. L’interface Habitat / Habitant : quand le lieu de vie est porteur de maladie - Le cas du radon en PACA

    Directory of Open Access Journals (Sweden)

    Cissé E.

    2012-10-01

    Full Text Available Les préoccupations sont croissantes pour étudier les liens entre des conditions environnementales spécifiques et la fréquence de certaines pathologies. Nous proposons d’analyser ici le lien présupposé entre une exposition au radon et le cancer du poumon. Le radon, est un gaz radioactif d’origine naturelle (issu de la désintégration naturelle de l’uranium présent dans la croûte terrestre et plus particulièrement dans certaines formations géologiques. A partir du sol et de l’eau, le radon se diffuse dans l’air (exhalation et se trouve, par effet de confinement, à des concentrations plus élevées à l’intérieur des bâtiments qu’à l’extérieur. Les descendants solides du radon sont alors inhalés avec l’air respiré et se déposent dans le poumon. Il est établi par diverses études scientifiques que le radon a un impact non négligeable sur certains cancers, notamment du poumon (augmentation de 16 % du risque de cancer du poumon par tranche de 100 Bq/m3, et des cancers digestifs via la consommation d’eau qui s’est chargée en radon au contact du socle. Le nombre annuel de décès par cancer du poumon attribuable à l’exposition domestique au radon en France métropolitaine varie entre 1 200 à 3 575 en fonction des relations exposition-réponse utilisées. Plusieurs régions en France se caractérisent par une problématique radon reconnue et étudiée depuis longtemps (Bretagne, Massif central, Corse. Or, si le radon ne recouvre pas l’ensemble de la région PACA, certaines zones géographiques sont particulièrement concernées et méritent d’être étudiées : le Massif des Maures dans le Var, du Mercantour dans les Alpes-Maritimes et du Briançonnais dans les Hautes-Alpes. La région PACA est une des régions de France et d’Europe les plus touchées par la pollution atmosphérique principalement due à l’augmentation du trafic routier et des contributions de régions industrialisées telles que

  7. Et le pouce, où est-il, qui montrera vers le ciel? (Sonnet XXXII

    Directory of Open Access Journals (Sweden)

    Miha Pintarič

    2012-12-01

    Full Text Available Lʼarticle soumet à une brève analyse les Sonnets romains dʼAndrej Capuder, homme de politique, diplomate, professeur dʼuniversité, écrivain, traducteur et poète. Le passé et le souvenir mélancolique de lʼamour de jeunesse, lʼavenir et la rencontre prochaine avec Dieu, entre lʼun et lʼautre, tant de choses si terrestres, tantôt jugées avec sévérité, tantôt tolérées et tantôt même rendues complices.

  8. Non est hic. Le cas exemplaire de la protection du fugitif

    Directory of Open Access Journals (Sweden)

    Jean-Pierre Cavaillé

    2007-06-01

    Full Text Available Le cas dont je voudrais ici esquisser l’histoire et montrer quelques uns des enjeux, est surtout, sinon exclusivement connu, aujourd’hui encore, dans la version proposée par Benjamin Constant pour mettre en évidence une conséquence nécessaire et selon lui inacceptable de la morale kantienne. Constant en effet écrit, dans ces Réactions politiques, publiées en 1797 : Le principe moral […] que dire la vérité est un devoir, s’il était pris d’une manière absolue et isolée, rendrait toute société i...

  9. Baisse de la transmission de la douve du foie dans le nord-est de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    mortelle de cancer du foie liée à l'O. viverrini. Dans cer- taines régions, près de 85 % de la population est porteuse du parasite. Les villages du nord-est de la Thaïlande, où l'on raffole du poisson cru, ont des taux d'infection parmi les plus élevés du pays. Les personnes infectées peuvent porter le parasite adulte pendant ...

  10. Le succès est relatif — Wara Alderete | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Les groupes de défense des droits de la personne estiment maintenant que jusqu'à 30 000 personnes – dont plus de 20 % étaient des étudiants – ont pu être torturées et tuées au cours de la « sale guerre ». « Ce furent des persécutions massives. Le chaos s'est installé, se rappelle Wara. Ma sécurité était ...

  11. Le criquet du Mato Grosso : l'agriculture est-elle responsable ?

    Directory of Open Access Journals (Sweden)

    Lecoq, M.

    1995-01-01

    Full Text Available Le criquet du Mato Grosso : l'agriculture est-elle responsable ?. Investigations through bibliographical references and among the local population provided a collection of documents and evidences showing without any doubt that Rhammatocerus schistocercoides (ReHN, 1906 [Orth. Acrididae Gomphocerinae] outbreaks in Mato Grosso (Brazil are not a new event neither by nature nor by magnitude. Therefore, the present conception on the origin of those outbreaks need to be drastically revised. The previous hypotheses, implying an overrated agricultural development of concerned areas since 1980, must then be rejected.

  12. Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels

    CERN Document Server

    Gagnon, Pauline

    2015-01-01

    Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs qui en avaient prédit l'existence 48 ans auparavant ? Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va beaucoup plus loin car cette théorie ne s'applique qu'à la matière visible, celle qu'on trouve sur Terre, dans les étoiles et les galaxies, mais qui ne compte que pour 5 % du contenu de l'Univers. Le reste, soit 95 % de l'Univers, consiste en « matière sombre » et en « énergie sombre », deux entités complètement inconnues. Quelle est donc cette mystér...

  13. Déchets nucléaires : où est le problème ?

    CERN Document Server

    Sorin, Francis

    2015-01-01

    Faut-il avoir peur des déchets nucléaires ? Sont-ils vraiment, comme le pense une partie du public, ce fardeau empoisonné ingérable faisant peser une menace fatale sur nous-mêmes et sur nos descendants ? Ou sont-ils au contraire, comme l'estime la grande majorité des scientifiques, des résidus que l'on sait fort bien conditionner et mettre hors d'état de nuire ? Entre le public inquiet et les ingénieurs rassurants, comment comprendre l'immense décalage des attitudes ? Et comment, face à ces déchets laissés en héritage, faire la part des choses entre ceux qui dénoncent "un crime contre les générations futures" et ceux qui jugent "la difficulté résolue" ? Bref, "Où est le problème ?" Sans craindre de bousculer bien des idées reçues mais sans méconnaître les risques encourus, Francis Sorin éclaire ici en quelques chapitres percutants les problèmes et les solutions liés à la gestion de ces déchets en France. II s'attache particulièrement au devenir des déchets de haute activité et...

  14. Le dessalement de l’eau de mer est-il une voie d’avenir?

    Directory of Open Access Journals (Sweden)

    Jean-Noël Salomon

    2012-06-01

    Full Text Available La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source d’eau potable pour un grand nombre de pays (îles, pays à climat désertique ou subdésertique, etc.. Mais, ce coût restant encore bien supérieur à celui des autres modes d’alimentation, cette technique reste réservée à des États ayant des ressources financières et énergétiques consistantes (Moyen Orient, pays développés, ce qui limite les possibilités. L’avenir du dessalement doit également prendre en compte ses effets sur l’environnement car de plus en plus d’études en montrent les effets pervers et …coûteux. Cet article entend faire le point et attirer l’attention sur l’ensemble de cette technique qui offre une alternative intéressante au spectre de la pénurie d’eau annoncée par bien des médias dans le contexte du réchauffement climatique.

  15. Pourquoi le Grundgedanke (T. 4.0312 de Wittgenstein est si “Fondamental”?

    Directory of Open Access Journals (Sweden)

    André Leclerc

    1998-12-01

    Full Text Available La pensée fondamentale de Wittgenstein affirme que les constantes logiques ne représentent pas, ne fonctionnent pas sémantiquement comme des noms. En apparence triviale, cette pensée, nous le montrerons, à des ramifications étonnantes dans la philosophie du premier Wittgenstein, en particulier en ce qui concerne sa conception de la logique. Notre but est d'interpréter l'aphorisme en question (T. 4.0312 en montrant comment il se rapporte aux thèses et théories les plus importantes du Tractatus, et comment il permet de les faire tenir ensemble d'une façon cohérente, justifiant par là son caractère "fondamental". Nous tentons également d'apporter une réponse aux questions suivantes : les propositions complexes sont-elles encore - comme les propositions atomiques - des "images" de la réalité ? et quelle est cette "logique des faits" dont parle Wittgenstein dans l'aphorisme sous examen ?

  16. Le Prix mondial de l'alimentation est décerné à un ancien boursier ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mai 2016 ... M. Hillel est chercheur principal au Center for Climate Systems Research, qui relève de l'Earth Institute de l'Université Columbia, et travaille avec le NASA Goddard Institute for Space Studies. Il a oeuvré par le passé avec de nombreux organismes de développement international et s'était vu octroyer une ...

  17. Le fascisme, c’est du théâtre. Macchina scenica e meccanica narrativa

    Directory of Open Access Journals (Sweden)

    Emanuele Canzaniello

    2015-11-01

    Full Text Available «Le fascisme, c’est du théâtre», sostiene Jean Genet, e come tale i suoi legami con la natura e la prassi della messa in scena sono essenziali alla specificità del fenomeno. La resa spettacolare della nazionalizzazione delle masse è stata senz’altro tra i temi fondamentali della ricerca sui totalitarismi. Il mio proposito è qui quello di intarsiare alcuni nuclei consolidati della ricerca storica con le rese squisitamente letterarie di quello che fu poco più che un  decennio di immensi tableaux vivants, visioni di un nuovo ordine di massa. Un’opera d’arte collettiva, basata su una premessa  fondamentale: dare “figurabilità” ai detriti e alle rovine (rimosse? di alcuni miti delle origini propri della cultura romantica, e  consapevolmente avviare e mettere in luce un enorme processo più generale di disgregazione del logos e di tutta la civiltà europea nella sua prospettiva diremo cartesiana, geometrica e razionalista. Il mio discorso si fonda, anche se in breve, su un testo solo: la Gerbe des forces (1937 di A. de Châteaubriant, uno dei più singolari resoconti di pellegrinaggio politico verso il miraggio totalitario che si sia dato tre le due guerre mondiali. Soccorsi non secondari sono il saggio di Sontag Under the sign of Saturn (1980 e quello di Tame La Mystique du Fascisme dans l’oeuvre de Robert Brasillach (1986. According to Jean Genet: «Le fascisme, c’est du théâtre», and as such its relationship with the nature and praxis of staging are essential to the specificity of the phenomenon. The magnificent representation of mass nationalisation is beyond doubt one of the fundamental issues when investigating totalitarianisms. My aim here is to link some wellestablished nuclei of historical research to the literary outputs of what was little more than a decade of immense tableaux vivants, visions of a new mass order. A collective work of art, based on a fundamental premise: to give ‘figurality’ to the rubble

  18. La guerre contre les drogues illicites : Est-ce qu’elle est perdue ? - Has the war against drugs been lost ? - La guerra contro le droghe è persa ?

    Directory of Open Access Journals (Sweden)

    Dominick M.

    2009-08-01

    Full Text Available Le système légal du Mexique est dans un état de ruine à cause des cartels de la drogue soutenus et subventionnés par les États-Unis d'Amerique. En effet, les États-Unis sont le marché principal de la marijuana, de la cocaine et, en moindre quantité, des drogues synthétiques provénantes du Mexique. L’article met en évidence que les régions frontalières du Mexique sont pris en otage entre d’une part, les principaux producteurs mondiaux de coca et d’autre part, les principaux consommateurs (de l’Amerique du Nord et de l’Europe. Pour cela, l’avis de l’autrice et de son collaborateur est que le Mexique ne peut résoudre seul les problèmes liés au narcotrafique. The Mexican legal system is in a state of ruin because of illegal drug cartels supported, sustained and subsidized by the United States of America. It is the U.S. which is the market for marijuana, cocaine and to a lesser extent synthetic drugs trafficked through Mexico. This article evidences that especially the frontier regions of Mexico have been taken hostage between, on the one hand, the principal world producers of cocaine and, on the other hand, the principal consumers (from North America and from Europe. Accordingly, it is the view of the author and her collaborator that Mexico cannot resolve in isolation the problems involved in narco-trafficking.Il sistema legale messicano versa in uno stato disastroso a causa dei cartelli della droga sostenuti e sovvenzionati dagli Stati Uniti d’America. Infatti, gli USA rappresentano il principale mercato della marijuana, della cocaina e delle droghe sintetiche (queste ultime in misura minore provenienti dal Messico. L’articolo mette in evidenza che le regioni frontaliere del Messico sono prese in ostaggio, da una parte, dai principali produttori modiali di cocaina e, dall’altra, dai principali consumatori (che si trovano nell’America del Nord ed in Europa. Pertanto, secondo l’autrice ed il suo collaboratore

  19. Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario

    Directory of Open Access Journals (Sweden)

    Anne Grundy

    2017-01-01

    Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l

  20. Is the cooling of coils of pulsed accelerators profitable?; Le refroidissement des bobines des accelerateurs pulses est-il avantageux?

    Energy Technology Data Exchange (ETDEWEB)

    Neyret, G.; Parain, J.; Schnuriger, J. C.

    1960-05-15

    In this report, the authors recall how metal resistivity decreases at low temperatures, and give some indications about the power and price of cryogenic installations. They report the study of the cooling of coils in accelerators displaying an alternate gradient with a 15 GeV energy, with or without a magnetic circuit in iron. They establish that cooling does not result in a decrease in the cost price for an hour of operation. They also state that it is not even sure that this cooling would result in a dimension reduction while increasing the maximum achievable induction [French] On rappelle comment la resistivite des metaux diminue aux basses temperatures, et on donne des indications sur la puissance et le prix des installations cryogeniques. On etudie le refroidissement des bobines d'accelerateurs a gradient alterne d'une energie de 15 GeV, avec ou sans circuit magnetique en fer; on trouve que le refroidissement ne permet pas de diminuer le prix de revient de l'heure de fonctionnement; il n'est meme pas sur qu'il puisse permettre de reduire les dimensions en elevant l'induction maximum realisable. L'idee de refroidir les bobines sans fer jusqu'a la temperature de l'air liquide est ancienne: Jean Perrin des 1907, puis Charly Fabry en 1910 l'avaient deja proposee. Recemment, cette idee est revenue a l'actualite: en 1958, R.F. Post a suggere de l'appliquer a la production de champs intenses en vue du confinement des plasmas thermonucleaires; en 1959, N.C. Christofilos a publie un projet d'accelerateur refroidi a 80 deg. K. Nous voulons examiner l'interet de refroidir les bobines d'un accelerateur, d'une part pour augmenter l'induction maximum (dans le cas de machines sans fer) et d'autre part pour diminuer l'importance de l'alimentation electrique. Cet examen est precede de generalites sur le refroidissement des bobines, generalites qui s'appliquent d'ailleurs a tous les champs magnetiques. Les trois metaux etudies sont ceux retenus comme les meilleurs par Post: le

  1. Le succès est relatif — Wara Alderete | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... L'Argentine tarde à ratifier la Convention-cadre pour la lutte anti-tabac (CCLAT) de l'Organisation mondiale de la santé, qui impose aux gouvernements qui la ratifient de prendre de véritables mesures de lutte contre le tabagisme, dont de nouvelles lois et des mesures relatives aux prix, d'investir dans ...

  2. En Afrique, l'avenir est mobile | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 janv. 2011 ... Dans les pays industrialisés, les assistants numériques personnels (ANP) servent souvent à la gestion d'agenda, mais des chercheurs financés par le CRDI démontrent que les ANP sans fil peuvent contribuer à améliorer la prestation des soins en Afrique. « Commençons à considérer les ANP comme des ...

  3. Et le gagnant est... Brendan Baker en entrevue | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 févr. 2011 ... lancé par le CRDI dans la période menant au troisième Forum urbain mondial. ... Après avoir obtenu mon diplôme universitaire, je me suis engagé pour une affectation de longue durée avec Ingénieurs sans frontières, qui m'a envoyé au Sénégal afin de participer à un projet de transformation des noix de ...

  4. Il est temps que le Canada rende la justice accessible à tous | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    école ou qu'on exclut une personne d'un hôpital, les médias ne perdent pas de temps à exposer l'injustice. La privation de soins de santé ou de scolarisation est impensable pour la plupart des Canadiens; pourtant, l'accès à ...

  5. Le boom du raffinage en Asie du Sud-Est Refinery Boom in Southeast Asia

    Directory of Open Access Journals (Sweden)

    Gruson J. F.

    2006-11-01

    Full Text Available Le marché pétrolier connaît en Asie un développement rapide, principalement dans la zone non OCDE, qui représente aujourd'hui plus de 15 % de la consommation pétrolière mondiale. La croissance économique attendue dans ces pays devrait porter cette part à plus de 25 % d'ici 2010, soit une hausse de la demande de 5,4% par an, principalement dans le secteur des transports. Les investissements qui en découlent pour l'industrie du raffinage régionale sont très élevés (des évaluations les chiffrent à près de 140 milliards de dollars, d'autant plus que la protection de l'environnement commence à prendre une importance significative. Dès lors, le défit majeur de ces pays sera d'assurer les financements nécessaires pour augmenter la capacité de raffinage (un quasi-doublement et l'adapter au poids croissant de l'essence et des distillats moyens dans la demande. La participation d'opérateurs privés apparaît essentielle, mais dépendra fortement du redressement des marges de raffinage et de la réalité de l'ouverture des marchés pétroliers nationaux annoncée par les pouvoirs publics. The Asia demand for oil is increasing dramatically, particularly in the non OECD countries, which represent, today more than 15% of the word oil market. The expected economic growth in these areas should contribute to a rise in oil demand by about 5. 4 per year and hence to a significant increase of this share to 25% in 2010; virtually a large part of this evolution will come from the transportation sector. The proceeding investments of the regional, refining industry are very high (some evaluations come to around 140 billions of dollars, all the more the protection of the environment takes an increasing significant place. Accordingly the most important challenge to be taken up by these countries will be to mobilize long term fundings to develop and adapt the capabilities of the refineries to meet the growth of gasoline and gasoil demand. The

  6. Le détritisme carbonate profond dans le Crétacé inférieur du Sud-Est français. Ses rapports avec l'eustatisme

    OpenAIRE

    Ferry , Serge

    1987-01-01

    Mémoire HS n° 13 - Géologie Alpine : Le détritisme dans le Sud-Est de la France - Colloque Association des Géologues du Sud-est - Grenoble 11-12 décembre 1986; 10 cycles eustatiques sont définis dans le Crétacé inférieur du Sud-Est français. Sur les plates-formes carbonatées, ils correspondent aux principales séquences "klupféliennes" de comblement, pour lesquelles le moteur tectonique (à-coups de subsidence) est mis en doute. Ces cycles ne sont repérables dans les séries de bassin que si l'a...

  7. RIEN N’EST FIXE: L’EXPÉRIENCE-NIETZSCHE ET LE QUOTIDIEN ÉDUCATIONNEL

    Directory of Open Access Journals (Sweden)

    Luciano Bedin da Costa

    2011-12-01

    Full Text Available Cet article est une lecture du quotidienne éducationnel par la philosophie de riedrich Nietzsche (1844-1900 avec des concepts tels quels : expérience, nihilisme, ressentiment, mauvaise conscience, force et de la volonté de puissance. La théorie de Nietzsche est utilisé comme un outil de réflexion sur les pratiques quotidiennes vécu dans l'éducation, de rompre avec l'inertie du discours des pleurs et nihiliste. Ce que nous appelons l'expérience de Nietzsche implique un autre regard, une grande santé et une éthique pour une évasion de la cristallisation et production des différences. MOTS-CLÉS : expérience; Nietzsche, nihilisme, formation, volonté de puissance

  8. L'Inde : où est le milieu ? | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Des entrepreneurs futés, favorisés par les réformes économiques opérées au début des années 1990, ont tiré parti des nouveaux débouchés sur les ... À long terme toutefois, M. Mazumdar est d'avis qu'il s'agit d'un encouragement manifeste à privilégier l'expansion horizontale plutôt que verticale. S'il était ...

  9. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Maranúbia Pereira Barbosa Doiron

    2014-03-01

    Full Text Available : Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  10. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Vanderci de Andrade AGUILERA

    2013-12-01

    Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  11. Lele de la sphère publique en réseau pour ce qui est de favoriser ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Una Hakika : Porter à grande échelle les solutions numériques pour la gestion des conflits au Kenya et en Birmanie. L'information erronée, qu'elle soit le fruit de rumeurs ou d'une désinformation intentionnelle, peut alimenter le conflit et exercer de profondes répercussions sur la paix, la... Voir davantageUna Hakika : Porter ...

  12. le de la société civile pour ce qui est d'influencer les politiques de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    le de la société civile pour ce qui est d'influencer les politiques de santé publique en faveur des femmes autochtones du Mexique. Au Mexique, les iniquités relatives à l'accès aux services de santé et aux services connexes sont sensiblement plus marquées chez les populations autochtones, et en particulier chez les ...

  13. Stéréotyper le Féminin: entre le Doxique et l’Esthétique (Estereotipar o Feminino: entre o Dóxico e o Estético)

    OpenAIRE

    Maingueneau, Dominique; UNIVERSITÉ PARIS XII - VAL-DE-MARNE – PARIS/FRANCE

    2007-01-01

    RÉSUMÉ Cet article cherche à montrer que l’attitude masculine à l’égard des stéréotypes sur les femmes peut correspondre à deux manières de “gérer” l’énigme que représente pour l’homme la différence sexuelle: un régime doxique, celui de l’ “Homme Ordinaire”, et un régime esthétique, celui de “l’Artiste”. Le premier régime trouve à se manifester dans les proverbes, par exemple, dont la visée essentielle est de définir un ordre dans lequel le féminin se voit assigner “sa” place. Il est illustré...

  14. Pourquoi le « Disque Blanc » des Beatles est-il Blanc ?

    Directory of Open Access Journals (Sweden)

    Bernard Gensane

    2006-02-01

    Full Text Available Dans « Strawberry Fields Forever » (février 1967, John Lennon prévient, dans une perspective postmoderne, que la représentation artistique est impossible car « nothing is real ». Au même moment, Paul McCartney propose, avec « Penny Lane » (février 1967, une des plus troublantes définitions de ce qu’est la représentation artistique : « And though she feels as if she’s in a play / She is anyway ». Que se passe-t-il, en effet, lorsque l’art est sciemment accepté comme un faux-semblant à la foi...

  15. Quand (redire c’est (refaire : stratégies citationnelles dans le Paradis perdu

    Directory of Open Access Journals (Sweden)

    Gilles MATHIS

    2004-06-01

    Full Text Available “Non canimus surdis.” (Virgile : Eclogue X.8 : Je / Nous ne chantons pas pour les sourds.“Auditis? an me ludit amabilis / insania?” (Horace, Odes, III. iv. 5-6 : “L’entendez-vous ? ou suis-je le jouet d’un aimable délire ?”“Je ne dis les autres, sinon pour d’autant plus me dire” (Montaigne, Essais.I GénéralitésColloque, écriture, lecture, mêmes débats, mêmes ébats, mêmes combats. Dans tous les cas, il s’agit d’un banquet, d’un symposium, où la citation s’impose naturellement, en intruse ou...

  16. Le chantier médiéval dans le Sud-Est de la France: regard sur les techniques de construction et l’organisation du chantier à partir de quelques exemples (XIe-XIVe siècles

    Directory of Open Access Journals (Sweden)

    Esquieu, Yves

    2005-12-01

    Full Text Available The present article illustrates several aspects of the archaeological research on mediaeval construction in south-eastern France (11th-14th cent. by studies in building archaeology led by the authors in various architectural and scientific contexts. It focuses on questions such as the know-how and its transfer, changes in the architectural project, the organization of the building process and its techniques and strategies, by analyzing the masonry and structure of the edifice and, in the case of the pope’s palace in Avignon, by combined research on the architecture and the written sources.Le présent article illustre différents aspects de la recherche sur la construction du XIe au XIVe siècle dans le Sud-Est de la France à l’exemple d’études monumentales menées par ses deux auteurs dans différents contextes architecturaux et scientifiques. Il aborde les questions du savoir-faire et de sa transmission, des changements de projet, et l’organisation du chantier, à partir des indices de la lecture des élévations et, dans le cas de la construction du palais des papes d’Avignon, de l’étude conjointe des sources écrites.

  17. La bibliothèque du CERN | Pauline Gagnon présente : « Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels » | 24 mars

    CERN Multimedia

    2015-01-01

    Mardi 24 mars 2015 à 16h00 à la bibliothèque du CERN (bât. 52-1-052) * Le café sera servi à partir de 15h30 *   Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs, qui en avaient prédit l'existence 48 ans auparavant ?  Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va be...

  18. Le japonologue occidental est-il original ? Considérations sur la question et le cadre d’un travail concernant le Japon à partir de l’étude des lieux de cultes pour amoureux

    Directory of Open Access Journals (Sweden)

    Jean-Michel Butel

    2007-06-01

    Full Text Available Épais dictionnaires renseignant sur les mœurs et les coutumes japonaises, grandes compilations rassemblant sur plus d’une dizaine de volumes tout le savoir ethnologique accumulé depuis le début du siècle mais réorganisé selon une problématique au goût du jour, revues régulières relevant de grands musées, d’universités ou d’organismes régionaux, réseaux de groupes d’étude allant de la société savante locale à la puissante organisation nationale (Sieffert, 1952 : œuvres et institutions témoign...

  19. Il est beau le lavabo, il est laid le bidet

    DEFF Research Database (Denmark)

    Nølke, Henning

    1998-01-01

    Artiklen analyserer dislokering af subjektet på fransk. Der skelnes mellem tre hovedtyper: venstredislokering med og uden intonationsbrud og højre dislokering. I alle tilfælde indeholder sætningskernen principielt en pronominel kopi af subjektet. Det påvises, at de tre typer svarer til tre forske...

  20. Twitter a­-t­-il bousculé le droit parlementaire ? : Le jour où le #directAN s'est invité dans l'hémicycle

    OpenAIRE

    Chibois , Jonathan

    2014-01-01

    International audience; En février 2013, lors de l'examen à l'Assemblée nationale du projet de loi sur l'ouverture du mariage aux couples de même sexe, l'agitation est telle sur Twitter que, au quatrième jour de délibération, la séance publique dans l'hémicycle est levée pour quelques minutes. À plusieurs reprises ensuite, fréquentes sont les allusions à des échanges de tweets entre députés, jugés inappropriés, pour lesquels sera demandée, sans succès, une régulation du président de séance. L...

  1. Triatominae et Cactaceae : un risque pour la transmission de la Trypanosomose américaine dans le péridomicile (nord-est du Brésil

    Directory of Open Access Journals (Sweden)

    Emperaire L.

    2006-06-01

    Full Text Available Les observations de terrain réalisées dans le nord-est du Brésil ont montré la fréquente association, dans l’espace péridomiciliaire, entre un cactus, le Cereus jamacaru, la présence de nids dans ses branches et celle de Rhodnius neglectus et de Triatoma pseudomaculata, espèces vectrices du parasite Trypanosoma cruzi, agent de la maladie de Chagas. L’analyse des variables architecturales de cette Cactaceae montre que la présence de nids, et donc d’insectes, est inféodée aux pratiques traditionnelles de gestion de ce cactus. Cette étude souligne l’intérêt d’une approche intégrée de l’écologie des Triatominae pour l’identification des variables indicatrices de risque.

  2. Le défi de l'hygiène dans les zones urbaines pauvres (Afrique de l'Est)

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Organisation mondiale de la santé (OMS) estime que l'amélioration de ... Sustainable Technologies, Gender Integration and Supportive Policy Framework ... Le Conseil des gouverneurs félicite Jean Lebel pour son nouveau mandat au ...

  3. « Là est ma Grèce. » Le Quartier de Sagesse d’Henri Bosco Here is my Greece Allí está mi Grecia

    Directory of Open Access Journals (Sweden)

    Michèle Gorenc

    1997-05-01

    Full Text Available En juin 1927, sur la route de Naples à Lourmarin, Henri Bosco séjourne chez son ami, le peintre Pierre Deval, à La Valette-du-Var. Il n’a écrit jusque-là qu’un seul roman et souhaite maintenant trouver un style plus personnel. Sa sensibilité entre en résonance avec le beau domaine d’Orvès, propriété de son hôte. A ce contact s’élabore une écriture que l’écrivain déclinera dans ses romans ultérieurs.In June 1927, as be was travelling from Naples to Lourmarin, Henry Bosco stayed with his friend, Pierre Duval the painter, in La-Valette-du-Var. He had written only one novel so far and was now in search of a more personal style of writing. His sensitivity was struck by the beautiful Orvès property owned by his host. On the basis of this encounter, he started to elaborate a new medium which he was to exploit in his later novels.En junio de 1927, en el camino entre Nápoles y Lourmarin, Henri Bosco se hospeda en casa de su amigo, el pintor Pierre Deval, en La Valette-du-Var. Hasta entonces sólo ha escrito una novela, y desea ahora dar con un estilo más personal. Su sensibilidad se armoniza con la belle finca de Orvès, propiedad de su anfitrión. En ese contado se elabora una escritura que el escritor rechazará en sus novelas posteriores.

  4. Sédimentation et diagenèse des minéraux argileux du Jurassique supérieur-Crétacé dans le Jura méridional et le domaine subalpin (France, Sud-Est). Comparaison avec le domaine Atlantique Nord

    OpenAIRE

    Deconinck , Jean-François

    1984-01-01

    Le but de cette thèse est de décrire et d'expliquer l'évolution des assemblages argileux dans les Alpes occidentales depuis l'Oxfordien jusqu'au Crétacé supérieur, et de la comparer à celle connue dans l'Atlantique nord grâce aux forages DSDP. Etude géologique, sédimentologique et géochimique. Les assemblages argileux du Mésozolque supérieur (Malm - Crétacé) du domaine subalpin et du Jura mérldional sont étudiés par diffraction des rayons X, microscopie électronique à transmission et analyses...

  5. Deep earth fluids and huge metallogenetic belt and fatal geological disaster: 60th anniversary of Professor Du Le-tian engaging in geology

    International Nuclear Information System (INIS)

    Ou Guangxi; Tao Shizhen; Liu Yinhe

    2012-01-01

    Professor Du Le-tian has been researching for a long time on scientific relationship between deep earth fluids and hydrocarbon accumulation and metallogenesis, as well as gestation and prediction of disasters. He has contributed greatly to the development of that scientific field. From 6 to 8, July, 2012, 'Workshop on Deep Earth Fluids and Huge Metallogenetic Belt, Fatal Geological Disaster, as well as 60 th Anniversary of Professor Du Le-tian Engaging in Geology' was successfully convened in Beijing, totally with 76 delegates present who were experts, scholars or students from USA, Hong Kong, or various institutes, colleges or universities of China. In the workshop, the scientific presentations discussed were counted up to 49, on aspects of geological processes of deep earth fluids, relationship between earth degassing and hydrocarbon accumulation or metallogenesis, gestating mechanism of volcanic eruptions and strong earthquakes as well as their relations with mine gas outburst, high-temperature and high-pressure experimental earth science, etc.. (authors)

  6. Effet du biotope sur la diversité floristique et le polymorphisme phénotypique des groupements à Tamarix africana Poir. dans les zones arides de la région de Khenchela (Est Algerien

    Directory of Open Access Journals (Sweden)

    Khabtane Abdelhamid

    2012-12-01

    Full Text Available RESUME Le genre Tamarix (Tamaricaceae regroupe plus de 80 espèces, parmi eux le Tamarix africana Poir. qui représente une très grande ubiquité en Algérie, soit du point de vue climatique (humidité et sécheresse, édaphique (sols salés et calcaires; où il représente l’espèce  à caractère typique des plantes thermo xérophytes. Pour contribuer à la connaissance de cette espèce et de son comportement nous avons essayé de suivre le comportement  phytosociologique ainsi que sa variabilité morphologique (l’hauteur, le recouvrement basale, nombre des ramifications à la base.. dans trois biotopes, extrêmement différents du point de vue climatique et édaphique,  dans les zones steppiques arides de la région de Khenchela (Est Algérien et qui sont  choisis  selon un transect Nord - Sud. Les résultats révèlent que les groupements à Tamarix africana Poir. représentent une richesse floristique importante, qui se diffère d’un site à l’autre, avec un polymorphisme phénotypique adaptée aux conditions spécifiques à chacun des trois sites et qui lui permet d’être l’espèce à forme arbustive  la plus adaptée pour la réhabilitation des écosystèmes dégradés dans les zones de transitions Désert-NordMots clés Tamarix africana P. - ubiquité- thermo xérophytes-  régions arides- halophytes- polymorphisme phénotypique

  7. Numerical Investigation of an Absorption-Diffusion Cooling Machine Using C3H8/C9H20 as Binary Working Fluid Étude numérique d’une machine frigorifique à absorption-diffusion utilisant le couple C3H8/C9H20

    Directory of Open Access Journals (Sweden)

    Dardour H.

    2013-05-01

    Full Text Available This paper is concerned with the analysis and the simulation of a heat-driven absorption-diffusion cooling machine which can operate with low-grade heat sources. The simplified configuration of the heat-powered absorption-diffusion refrigerating machine considered in this study is based on the Platen-Munters single pressure refrigerators principle [Platen B.C.V. and Munters C.G. (1928 Refrigerator, US Patent 1, 685-764J. Three working fluids are used, nonane as an absorbent, propane as a refrigerant and hydrogen as the inert auxiliary gas. The designed cooling capacity of the machine is 1 kW which is suitable for a domestic use for refrigeration purposes. We restricted the maximum temperature of the driving heat supplied to the generator to 130 °C, a temperature achievable with evacuated-tube solar collectors. The simulations are carried out using a commercially available flow sheeting software with the PengRobinson equation of state as property prediction method. In this paper, we analyze the heat and mass transfer characteristics in all relevant machine components (absorber, condenser, generator and solution heat exchangers. The simulations results allow determining the values of different parameters of the systems such as the refrigerant and the solvent temperatures in various points of the machine, the liquid and the vapor flow rates and compositions. The system performances were parametrically analyzed using the flow sheeting software. Performance characteristics were determined for a wide range of operating conditions allowing investigating and evaluating the effect of various design parameters. Ce papier est consacré à l’étude et l’analyse d’une machine frigorifique à absorption-diffusion. La machine est actionnée grâce à une source de chaleur de température modérée. La configuration et le principe de fonctionnement de l’appareil obéissent au modèle de Platen Munters [Platen B.C.V. and Munters C.G. (1928 Refrigerator

  8. « Le souvenir n’est qu’une maison que l’on porte dans la voix » (Alexandre Amprimoz, Bouquet de signes

    Directory of Open Access Journals (Sweden)

    Sante A. Viselli

    2015-12-01

    Full Text Available Depuis déjà plusieurs années, nous remarquons au Canada la présence d’une littérature unique en son genre, celle des auteurs italo-canadiens. En français, en anglais ou en italien, cette littérature s’est déjà frayé un chemin sûr vers une reconnaissance incontestée au niveau national aussi bien qu’international. Des auteurs tels que Fulvio Caccia, Antonio d’Alfonso, Marco Micone, Carole David-Fioramore, Bianca Zagolin et Alexandre Amprimoz, sont à considérer parmi les lauréats italo-canadiens, porte-parole d’une génération d’érudits cosmopolites et polyglottes. L’œuvre d’Alexandre Amprimoz est, à cet égard, un exemplum des plus marquants d’une littérature multiple et plurielle.

  9. Le laboratoire, le temple et le marché

    International Development Research Centre (IDRC) Digital Library (Canada)

    De manière générale, les auteurs insistent sur le fait que c'est leur foi qui leur a .... nettement que dans de nombreux cercles, le besoin était vivement ressenti de ... Le Dr Kapur présente tout d'abord une brève discussion sur sa vision du ...... pour les soins aux enfants orphelins et aux pauvres et pour la renaissance des ...

  10. The right to energy is a social, economical and environmental emergency; Le droit a l'energie est une urgence sociale, economique et environnementale

    Energy Technology Data Exchange (ETDEWEB)

    Coulon, Pierre-Jean

    2010-09-15

    2 billion people on the planet do not have access to energy. This energy deficiency has an impact on health, infant mortality, life expectancy, education, and women's emancipation and it slows development. Following the Copenhagen summit, in a financial crisis context that heavily impacted the world economies, energy issues demand real political commitment, because solutions exist. They include awareness-building, responsibility and commitment of society, because a better accessibility for the populations can't be achieve without the beneficiaries. [French] 2 milliards d'individus n'ont pas acces a l'energie sur la planete. Impact sur la sante, sur la mortalite infantile, sur l'esperance de vie, sur l'education, sur l'emancipation des femmes a cette situation de carence energetique est un frein au developpement. Au lendemain du Sommet de Copenhague, dans un contexte de crise financiere qui a impacte lourdement l'economie mondiale, les questions energetiques necessites une reelle volonte politique, car des solutions existent. Celles-ci passent notamment par la sensibilisation, la responsabilisation et l'implication de la societe civile, car permettre une meilleure accessibilite des populations ne peut pas se faire sans les beneficiaires eux-memes.

  11. The environment overlooked? L’environnement est-il négligé? Lele des préoccupations environnementales dans les discours sur l’alimentation bio

    Directory of Open Access Journals (Sweden)

    Jesper Lassen

    2009-09-01

    Full Text Available Cet article étudie la façon dont les gens ordinaires parlent de la nourriture et en particulier dans quelle mesure, et comment, ces discussions incluent des arguments sur l’environnement et les produits bios. Contrairement à de nombreuses études qui démontrent la préoccupation du public concernant les aliments et leur production, l’étude rapportée ici montre que, dans un cadre exploratoire où des danois étaient invités à discuter d’alimentation et de production alimentaire, les arguments environnementaux jouent un rôle insignifiant. Ceci peut être expliqué d’une part par l’émergence d’un nouveau discours sociétal qui minimise l’importance des problèmes environnementaux et, d’autre part, comme l’effet d’une tendance actuelle où les individus sont de plus en plus préoccupés par leur bien-être personnel.This paper addresses the way ordinary people talk about the food they eat and in particular to what extent, and how, such discussions include arguments about the environment and organic products. In contrast with the numerous studies demonstrating public concern over food and food production, the study reported here shows that in an exploratory set-up, where Danes were invited to discuss food and food production, environmental arguments played an insignificant role. This can be explained in part by the emergence of a new societal discourse that downsizes the importance of environmental problems, and in part as an effect of an ongoing trend in which individuals increasingly are concerned about their personal well-being.

  12. Contribution méthodologique pour la connaissance du rôle des acteurs locaux dans la réalisation d’un projet de territoire : le cas du projet de la réserve naturelle de Réghaia dans la zone côtière Est de l’Algérois

    Directory of Open Access Journals (Sweden)

    Mohamed Larid

    2010-12-01

    Full Text Available Dans le domaine de la gestion territoriale, on peut constater le manque et l’insuffisance des outils d’analyse des stratégies des acteurs. Ceci est encore plus ressenti dans les sociétés du monde en développement, où les mécanismes de gestion et d’administration du territoire sont souvent dysfonctionnels. Une meilleure connaissance des relations entre les intervenants dans l’application d’un projet territorial, permet des éclairages sur le contexte de sa réalisation et des orientations suceptibles d’avantager sa réussite. Les repères sur les logiques de comportement aident à cerner les enjeux et à poser les questions clés, pour atteindre les objectifs fixés et conforter l’accomplissement des actions arrêtées. Le présent article rend compte des résultats d’une expérience de terrain, réalisée dans une zone côtière humide de la région algéroise. Il propose une contribution, sur le plan méthodologique, pour la collecte d’informations pertinentes sur le comportement et les possibilités des acteurs dans la réalisation d’un projet local, orienté vers la valorisation et la protection d’un patrimoine naturel important.In the field of territorially management, we can see the insufficiency of analysis tools on the strategies of actors. This is even more crucial in case of the developing world, where the management and territorially administration are often dysfunctional. Better knowledge of the roles of stakeholders in the implementation of a territorial project, provides insights of the context of its implementation and guidance likely to favor its success. The logical behavior help to identify issues and key questions, to achieve the objectives and ensure the completion of actions agreed. This article reports the results of a field experiment conducted in a coastal wetland in the region of Algiers. It offers a contribution, on the methodology for collecting information on the behavior and capabilities of

  13. Gestion de l'eau en milieu aride : considérations physiques et sociales pour l'identification des territoires pertinents dans le Sud-Est tunisien

    Directory of Open Access Journals (Sweden)

    Bruno Romagny

    2006-02-01

    Full Text Available La situation actuelle des ressources en eau et de leurs usages dans le Sud-Est tunisien présente des enjeux qui sont communs à de nombreuses régions du bassin méditerranéen : des ressources limitées et déjà largement exploitées pour répondre à la croissance des besoins, le recours accru aux ressources dites non conventionnelles, une situation de concurrence entre usages sectoriels, une marchandisation croissante des ressources, et des conditions climatiques contraignantes qui viennent renforcer les tensions autour de l'eau. Dans le contexte des mutations en cours, face aux risques de déficits en eau et à la nécessité d'un développement économique et social équilibré, ces caractéristiques, parmi d'autres, font de la Jeffara tunisienne un cas d'étude exemplaire des difficultés que pose la gestion intégrée de l'eau. Celle-ci doit prendre en compte les différentes sources d'approvisionnement ainsi que les différents usages associés, et donc l'identification des territoires pertinents pour cette  gestion, compte tenu des relations amont-aval naturelles et artificielles d'une part, et des cohérences institutionnelles et sociales d'autre part.The current situation of the water resources and their uses in South-Eastern Tunisia presents stakes which are common to many areas of the Mediterranean basin : limited and already largely exploited resources to address the growth of the needs, the increasing use of so-called non conventional resources, a competition between sectoral uses of water, an increasing merchandising of the resources, and constraining climatic conditions which reinforce the tensions around water. In the context of the changes in progress, facing the hazard of water deficits and with the need for a balanced economic and social development, these characteristics, among others, make Tunisian Jeffara be an exemplary case of study of the difficulties raised by the integrated water resources management. This one

  14. Le Sanskrit

    CERN Document Server

    Balbir, Nalini

    2013-01-01

    Cet ouvrage est destiné à tous ceux qui souhaitent se mettre ou se remettre à l'étude du sanskrit et ne peuvent y consacrer que quelques minutes par jour. En suivant le principe de la méthode quotidienne Assimil, vous acquerrez progressivement le vocabulaire et la grammaire de base qui sont nécessaires à la lecture des textes de la littérature sanskrite classique. Vous trouverez dans cette méthode une approche vivante de la langue et de la culture sanskrite classique à travers des textes d'abord adaptés pour le débutant puis authentiques. En quelques mois, vous manierez la langue sans efforts ni hésitation, de manière très naturelle. Les enregistrements reprennent l'intégralité des textes en sanskrit des leçons et des exercices de traduction du livre. Ils sont interprétés, à un rythme progressif, par des locuteurs natifs professionnels.

  15. Lele des chefs traditionnels au Ghana : un modèle inspirant ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Ray est également coordonnateur international du Traditional Authority ... Marketing social : le chef traditionnel acquiert une certaine expertise et ... Nadine Robitaille est rédactrice à la Division des communications du CRDI .

  16. Le corps sportif1

    OpenAIRE

    Brulé, Pierre

    2015-01-01

    Le nu et le cuit Si, pas plus que l’Auvergne, le monde grec antique n’a été le théâtre d’un quelconque « miracle », il n’a pas manqué, toutefois, de « distinctions » diverses, d’exceptions même, qui le singularisent absolument. Une, c’est la pédérastie. Quelle culture l’a autant valorisée, autant instrumentalisée, l’a autant érigée en modèle ? Nous n’en avons pas encore mesuré toutes les conséquences. La place inhabituelle que prend là et alors cette polyvalence rare de la libido masculine de...

  17. Le développement durable est-il bienvenu dans les organisations ? Cas de l’implantation d’un Système de Management Environnemental en Tunisie

    Directory of Open Access Journals (Sweden)

    Moez Ben Yedder

    2009-02-01

    Full Text Available Les entreprises sociétalement responsables sont celles qui s’inscrivent dans une logique de développement durable. Leur engagement se matérialise, notamment, par le déploiement de systèmes de gestion respectueux de l’environnement tels que les systèmes de management environnemental (SME. En plus de leur portée écologique, ces derniers ont une visée sociale puisqu’ils permettent d’améliorer les conditions de travail des opérateurs. Toutefois, leur mise en place peut être gênée par ces derniers s’ils ne retrouvent pas leurs intérêts lors de l’instauration d’un tel système. L’objectif de ce texte est d’étayer cette idée à partir de l’étude de cas d’une entreprise tunisienne où l’instauration d’un SME n’a pu aboutir en partie à cause de la résistance du personnel. Dans ce sens, nous appuierons l’idée selon laquelle les pratiques du Développement Durable et de la Responsabilité Sociale de l’Entreprise ne se greffent pas ex abrupto sur une entreprise mais nécessitent certains préalables d’ordre organisationnel pour être mis en place.Socially responsible firms are the ones which act in accordance to sustainable development logic. Their engagement is materialised by deploying environment friendly practices such as environmental management system (EMS. Those systems have also a social purpose in the way that they allow enhancing work conditions of operators. However, their setting could be embarrassed by those ones because of the change of habits that it implies for them. The purpose of this study is to shore up this idea by resorting to a case study of a Tunisian firm in which the setting of the environmental management system turned failed in part because of the resistance of the personnel. We will defend the idea that practices of sustainable development and corporate social responsibilities couldn’t be correctly adopted by firms without taking into consideration to some organizational

  18. An Examination of the Multiphase Darcy Model of Fluid Displacement in Porous Media Examen du modèle polyphasique de Darcy de déplacement de fluides en milieu poreux

    Directory of Open Access Journals (Sweden)

    Wright R. J.

    2006-11-01

    Full Text Available The multiphase Darcy model used to represent two-phase immiscible displacement flow within porous media is critically examined, and the principle assumptions and limitations discussed. We identify some of the main problems which require better understanding in order that conceptual progress in the physics of multiphase flow can keep pace with increasing computional capabilities. The implications of the one-dimensional aspect of present displacement models are explored more fully than have previous authors. This approcch to the conceptual problems of Buckley-Leverett theory enables a new explanation to be given of the shock front stabilisation phenomenon. A specific theoretical example of this problem is given, and is explained in terms of cross-flow effects between adjacent zones of the matrix. To achieve improvement of the present model a cross-flow resistance term would have to be included because, using present methods errors in relative permeability determination are expected, particularly in irregular media and when extreme viscosity ratios are involved. On examine d'une manière critique le modèle polyphasique de Darcy utilisé pour représenter le déplacement d'une phase par une autre non miscible à l'intérieur d'un milieux poreux et on discute les principales hypothèses et limitations. On identifie quelques-uns des principaux problèmes qui demandent une meilleure compréhension pour que les progrès conceptuels dans le domaine de la physique des écoulements polyphasiques puissent aller de pair avec les capacités croissantes de calcul. On explore, plus à fond que ne l'ont fait jusqu'à présent d'autres auteurs, les implications de l'aspect unidimensionnel des modèles actuels de déplacement. Cette approche des problèmes conceptuels de la théorie de Buckley-Leverett permet de donner une nouvelle explication du phénomène de stabilisation du front de choc. On donne un exemple théorique spécifique de ce problème qui est

  19. Le Mouvement Social

    OpenAIRE

    FRIDENSON, Patrick

    2003-01-01

    J'ai la faiblesse d'affirmer que parmi les revues françaises d'histoire Le Mouvement Social est la revue qui a publié le plus d'articles et de comptes rendus en matière d'histoire des femmes et du gender. Chacun peut le vérifier grâce à nos pages Web sur le site Internet du Dictionnaire créé par Jean Maitron. Elles comportent la table des matières complète de la revue depuis sa fondation en 1960. Notre rédaction est extrêmement fière de ce résultat. Mais elle reconnaît qu'il a été difficile à...

  20. Le Grand Inquisiteur : Âme et corpsQu’est-ce qu’une conversion sans adhésion de l’âme ?

    Directory of Open Access Journals (Sweden)

    Caroline Julliot

    2012-02-01

    Full Text Available Cet article vise à replacer dans le contexte philosophique et métaphysique général du romantisme la forme particulière de conversion figurée à travers le personnage du Grand Inquisiteur - en montrant en quoi elle se constitue en rupture totale avec la vérité historique.This article aims to replace in the general philosophical and metaphysical context of the romanticism the particular shape of conversion represented through the character of the Great inquisitor - by showing in what it is constituted in total break with the historical truth.

  1. GeneXpert MTB/RIF dans le dépistage de la tuberculose pulmonaire à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo: quelles leçons tirées après 10 mois d’utilisation?

    Science.gov (United States)

    Lupande, David; Kaishusha, David; Mihigo, Carine; Itongwa, Moise; Yenga, Gustave; Katchunga, Philippe

    2017-01-01

    Introduction En Afrique subsaharienne, les méthodes de diagnostic de la tuberculose sont insuffisantes et reposent essentiellement sur la microscopie. Elles constituent un réel frein pour le contrôle de la tuberculose. La présente étude voudrait évaluer les performances du GeneXpert MTB/RIF vis à vis de la microscopie classique de Ziehl-Neelsen à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo après 10 mois d’utilisation. Méthodes Les résultats de la coloration au Ziehl-Neelsen et de la biologie moléculaire sur GeneXpert MTB/RIF de 452 patients suspects de tuberculose ont été colligés. La validité d’un test par rapport à l’autre dans la détection de la tuberculose a été étudiée. Résultats Dans le groupe entier, la fréquence de la tuberculose pulmonaire était de 16.3%. La positivité était significativement plus élevée pour le GeneXpert MTB/RIF que pour le Ziehl-Neelsen dans le groupe entier (15.9% vs 9.3%, p= 0.03) et chez les séropositifs pour le VIH (52.0% vs 24.0%; p = 0.007). Cependant, la sensibilité de GeneXpert MTB/RIF comparé au Ziehl-Neelsen n’était pas maximale (95.2%). Enfin, GeneXpert MTB/RIF a détecté 20.8% de résistance à la rifampicine. Conclusion La présente étude confirme la supériorité de GeneXpert MTB/RIF sur la coloration de Ziehl-Neelsen dans la détection de la tuberculose et dans la prédiction de la multi résistance. Son utilisation systématique couplée au Ziehl-Neelsen permettrait de mieux contrôler la tuberculose en Afrique subSaharienne. PMID:29187929

  2. Le FIVB annonce le financement de cinq autres projets | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 avr. 2018 ... En partenariat avec la Fondation Bill et Melinda Gates et Affaires mondiales Canada, le CRDI est heureux d'annoncer la prochaine série de projets soutenus par le Fonds d'innovation en matière de vaccins pour le bétail (FIVB). À ce jour, 11 projets ont obtenu un financement total de 13,6 millions de CAD ...

  3. Heinberg Richard, 2008, Pétrole: la fête est finie ! Avenir des sociétés industrielles après le pic pétrolier, Éditions Demi-Lune, [2003 pour la première édition en langue anglaise

    Directory of Open Access Journals (Sweden)

    Luc Semal

    2009-05-01

    Full Text Available Il a fallu attendre cinq ans pour que soit traduit ce best-seller de Richard Heinberg consacré au pic pétrolier et à ses conséquences sociales en tous genres ! Durant ces cinq années, les ouvrages scientifiques consacrés à ce thème ont continué à proliférer dans le monde anglo-saxon et ont même largement contribué à y faire naître le mouvement des transition towns (dont l’un des principaux objectifs est de préparer les communautés locales aux pénuries pétrolières. Mais en France, pendant la ...

  4. Un nouvel habitat du Bronze final IIIb dans le Val d’Orléans et ses traces de métallurgie du fer : Bonnée, Les Terres à l’Est du Bourg (Centre, Loiret A new settlement from late Bronze IIIb in the val d’Orléans: Bonnée, Les Terres à l’Est du Bourg (lands to the east of the town (Centre, Loiret

    Directory of Open Access Journals (Sweden)

    Stéphane Joly

    2011-12-01

    Full Text Available La multiplication récente des diagnostics archéologiques autour du petit bourg actuel de Bonnée a permis la détection d’une occupation du Bronze final IIIb (circa 900-750 av. n.-e. sur environ un hectare aux Terres à l’Est du Bourg. Les limites inhérentes à ce type d’intervention réduisent l’interprétation des structures et toute approche spatiale de ce probable habitat repéré. L’étude conjointe des différents mobiliers en particulier céramique et métallurgique, mais aussi le torchis et la faune, atteste de sa culture matérielle et de son intérêt. Ces scories pourraient être parmi les plus anciennes traces en région Centre d’activité métallurgique du fer. Des activités de post-réduction sont avérées et certaines opérations de forgeage sont supposées.La découverte de cet habitat dans ce secteur du lit majeur de la Loire, apporte de nouvelles données concernant l’occupation du sol et ses problématiques évolutives dans le Val d’Orléans sur ces périodes de transition avec le Hallstatt ancien.The recent increase in the archaeological evaluations around the village of Bonnée has enabled the discovery of a final Bronze Age IIIb settlement (circa 900-750 BP on about a hectare of the Terres à l’Est du Bourg. The limits inherent in this type of work restrict the interpretation of structures and all spatial approaches to this likely dwelling. The joint study of the different furnishings, in particular ceramics and metal, but also the cob and fauna, attests to its material culture and its interest. The slag could be amongst the oldest iron metallurgy remains from the Centre region. Some activities of post-forging are proven and certain operations are guessed at. The discovery of this settlement in this sector of the major bed of the Loire, has produced new data concerning the occupation of the land and its evolutionary problems in the valley of Orleans over these periods of transition in the early

  5. Pourquoi la Commission de la santé et de la sécurité du travail du Québec n’est pas le premier recours des enseignantes et des préposées à l’aide domestique ayant des lésions professionnelles

    Directory of Open Access Journals (Sweden)

    Nancy Guberman

    2005-05-01

    Full Text Available Cet article examine les motifs de deux groupes de travailleuses pour s’adresser ou pas à la Commission de la santé et de la sécurité du travail du Québec (CSST pour des lésions perçues comme étant liées au travail. Il est basé sur des entrevues qualitatives auprès de 16 enseignantes et de 16 préposées à l’aide domestique. Pour les deux groupes, les motifs de non-recours incluent la croyance que la CSST existe essentiellement pour les accidents et les retraits préventifs des femmes enceintes, l’image de la CSST comme un organisme qui accorde difficilement des indemnisations ainsi que la difficulté perçue de prouver le lien entre le travail et le problème de santé. Pour les préposées, le manque à gagner entre les prestations et le revenu d’emploi est aussi un facteur tandis que pour les enseignantes l’accès relativement facile à une assurance salaire joue contre le recours à la CSST. De plus, pour bien comprendre les choix des répondantes, il faut tenir compte de leur rapport à leur emploi et à leur santé et de la culture de leur milieu de travail.This article examines the motives behind the decisions of two groups of workers on whether or not to submit claims to the Workers’ Compensation Board (CSST for perceived work-related accidents or illnesses. It is based on qualitative interviews with 16 teachers and 16 cleaners. For both groups, motives for not making claims include the belief that the CSST is essentially for accidents and preventive work withdrawal for pregnant women, the view that compensation is difficult to obtain from the CSST, as well as a perceived difficulty of proving a relationship between their work and their health problem. For the cleaners, the difference between the compensation and employment income is also a factor, while for teachers, the fact that they have relatively easy access to wage-replacement insurance is one reason they do not submit claims to the CSST. To better

  6. Un oiseau "sabote" le CERN

    CERN Multimedia

    Colson, Sébastien

    2009-01-01

    Un oiseau, un simple oiseau, est parvenu à bloquer à lui tout seul l'accélérateur à particules à 3,7 milliards d'euros. UNe histoire quasiment bulresque qui a toutefois impacté le fonctionnement de la machine durant près de cinq jours, puisque c'est le système de refroidissement qui a été affecté. (1 page)

  7. Lutter contre le paludisme sans DDT

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nancy Minogue

    La participation de la collectivité aux stratégies de contrôle, une surveillance ... Le contrôle de la maladie passe par une meilleure gestion de l'environnement. En vertu de ... de la santé humaine, ou écosanté, est un processus dynamique qui.

  8. 48. Le pavillon Liliane de Stewart

    OpenAIRE

    Cameron, Christina; Déom, Claudine; Valois, Nicole

    2018-01-01

    Le pavillon Liliane de Stewart Le pavillon Liliane de Stewart est situé à l’arrière du pavillon Marguerite-d’Youville, qui lui est mitoyen. Il en constitue en quelque sorte un agrandissement, mais il s’en différencie par son plus petit volume (trois étages). Les deux pavillons partagent quelques caractéristiques architecturales, dont le plan angulaire et le revêtement de brique chamois. Le pavillon Liliane de Stewart se distingue cependant par sa fenestration, surtout celle de la façade avant...

  9. Peut-on voyager dans le temps ?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    La possibilité de voyager dans le temps est régulièrement évoquée par les magazines scientifiques (et parfois même par les scientifiques). Elle est également le sujet de nombreux romans de science-fiction. Nous discuterons d’abord du sens qu’on peut donner à l’expression « voyager dans le temps », puis nous expliciterons ce que la physique contemporaine dit à ce propos.

  10. Étude et développement d'un modèle aéroélastique d'un petit véhicule de lancement spatial

    OpenAIRE

    Chan, Frédérik

    2012-01-01

    Ce mémoire présente le développement d'un modèle de couplage aéroélastique pour un petit véhicule de lancement spatial et ses résultats. Le mémoire est divisé en trois parties. La première présente d'abord les outils théoriques et numériques nécessaires pour développer un code d'interactions fluide-solide. Ces outils sont l'analyse modale, la mécanique des fluides numérique ainsi qu'un code de déformations imposées utilisant le langage UDF d'ANSYS Fluent qui est utilisé pour effectuer les ana...

  11. Le beau et le vrai

    Directory of Open Access Journals (Sweden)

    Létitia Mouze

    2006-05-01

    Full Text Available La vie des abeilles de Maeterlinck est un ouvrage à la fois scientifique et littéraire, non pas parce qu’il appartiendrait à la science par son exactitude et à la littérature par son style, mais en ce qu’il invite à penser l’unité des deux domaines. Les aspects littéraires de l’ouvrage (beauté de l’écriture, usage des images, de l’analogie, etc. ne sont pas des accessoires, mais des outils indispensables à l’élaboration d’un authentique savoir sur les abeilles, c’est-à-dire un savoir qui reconnaît la part d’inconnu et le mystère qui subsistent en dépit de toutes les explications physiques et mécaniques que l’on peut par ailleurs donner des phénomènes observés. Etre scientifique, dans cette perspective, c’est-à-dire donner à connaître, c’est donc être littéraire. Cette conception de la science repose en dernière instance sur une conception philosophique de l’univers comme un tout où toutes choses sont reliées, unies, par des relations d’analogies, ce qui fonde et justifie l’emploi d’un style symboliste.The life of bees, one of Maeterlinck’s works, is together a scientific and literary book, not because of it scientific exactness and its literary style, but for the reason it suggests the unity of both these domains. Literay’s aspects of this work (writing’s beauty, use of images, analogy, etc. are not secondary but necessary to elaborate an authentic knowledge about bees, that means a knowledge which admit the unknown part and the mistery that subsist despite all the physical and mechanical explanations we can give moreover about the observed phenomenons. Be a scientist, in this sense, that is give something to know, therefore means be literary. Finally, this conception of science consist in a philosophiacl conception of Universe as a whole where everything links together, and is united by analogical relations, that base and justify the use of a symbolist style.

  12. Tabagisme et dysfonction erectile chez les personnes vivant avec le ...

    African Journals Online (AJOL)

    La dysfonction erectile (DE) est un probleme de sante publique qui altere la qualite de vie des patients. Chez les personnes infectees par le VIH, le tabagisme en association ii d'autres facteurs pourrait accroitre le risque de survenue de ce trouble. L'objectif de cette etude est de determiner la prevalence de laDE, les ...

  13. Initiative Think tank | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ITT est le fruit d'un partenariat regroupant cinq bailleurs de fonds. Lancée en 2008, l'ITT est administrée par le Centre de Recherches pour le Développement International (CRDI), un organisme canadien.

  14. Le faussaire roman

    CERN Document Server

    D'Anna, Gianfranco

    2016-01-01

    À l'aube du XXIe siècle, le monde de la science est sur le point de vivre une révolution. Le jeune physicien allemand Albert Hendrick Thebell, des célèbres laboratoires de recherche B-Labs, à Summit, dans le New Jersey, publie, dans les plus grandes revues scientifiques internationales, une série d'articles dans lesquels il prétend avoir obtenu des résultats extraordinaires qui pourraient révolutionner les bases mêmes de la technologie. Rapidement, la communauté scientifique puis les médias saluent en lui un futur prix Nobel; on compare même son génie à celui d'Albert Einstein. Le progrès scientifique semble avoir franchi une étape décisive, susceptible d'amener un futur meilleur. Mais ces découvertes sont-elles authentiques ? Car pendant ce temps, dans les mêmeslaboratoires, des voix s'élèvent pour contester non seulement les théories de Thebell mais aussi la légitimité même de ses expériences ; certains le soupçonnent d'avoir combiné la plus grande fraude scientifique de tous l...

  15. Rapport financier trimestriel pour le trimestre qui a pris fin le 30

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sophie Comeau

    30 sept. 2011 ... politiques, de chercheurs et de collectivités de par le monde. ..... Financement : le CRDI est visé par l'Examen stratégique et ... Le Conseil des gouverneurs a amorcé la planification du recrutement du nouveau président.

  16. L'organisation territoriale en Colombie et les compétences des collectivités territoriales. Une action internationale est-elle possible depuis le contexte local?

    Directory of Open Access Journals (Sweden)

    Angel Tuirán Sarmiento

    2010-01-01

    Full Text Available Para entender con mayor claridad la forma como está construido el edificio de la organización territorial y las facultades de que gozan los entes territoriales en Colombia se hace necesario definir de antemano los conceptos de República unitaria, descentralización y autonomía. La autonomía otorgada por la descentralización a las colectividades territoriales ha traído consigo un aumento significativo en las competencias y facultades de los gobiernos locales, que están siendo confrontados a nuevas responsabilidades, viéndose en la necesidad de reforzar su capacidad de respuesta frente a las demandas y necesidades locales. Por tal motivo, las colectividades territoriales colombianas han trascendido sus fronteras en búsqueda de herramientas que posibiliten una mejor gestión de los asuntos locales; es así como las colectividades territoriales vienen interactuando en el escenario internacional con otros gobiernos locales, aprovechando la autonomía otorgada por el proceso de descentralización y las ventajas estratégicas que ofrece hoy día la globalización.

  17. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  18. L'internet nouveau est dans les "starting-blocks"

    CERN Multimedia

    Jennotte, A

    2001-01-01

    De nombreux chercheurs trouvent internet trop lent et limité. C'est pourquoi, ils travaillent sur un nouveau réseau : le Grid. Le Grid permettra de mieux partager les ressources informatiques en réseau (1 page).

  19. Entre les violences conjugales et le harcèlement moral : le stalking .

    Directory of Open Access Journals (Sweden)

    Nicolas Desurmont

    2007-09-01

    Full Text Available Ce livre de la criminologue Murielle Anteo est le premier publié en langue française sur le stalking si l’on excepte les travaux encore inédits de Virginie Léon (2004. Comme le rappelle l’auteure, le terme est emprunté à l’anglais to stalk (hanter, rôder, et désigne un comportement menaçant, initié par un individu dont l’objectif conscient ou inconscient est l’objectivation de sa victime à des fins de domination. L’agression prend différentes formes : ...

  20. Lecture actentielle dans Trop c'est trop de Protais Asseng | IKANGA ...

    African Journals Online (AJOL)

    La naissance de cet enfant lui conférait le titre de "Papa national" Bakony symbolise la recherche de bonheur sur le dos d'un humain. C'est de l'exploitation de la femme par l'homme. Mais la multipare Bissabey, son épouse, n'est pas de son avis. Cette instrumentalisation est alors la pomme de discorde entre le couple et ...

  1. Enquête sur l’association entre les habitudes alimentaires, l’anthropométrie et le cancer colorectal: Etude cas-témoins dans une population de l’Est Algérien 2016-2017 [Survey on the association between eating habits, anthropometry and colorectal cancer: Case-control study in a population of eastern Algeria 2016-2017

    Directory of Open Access Journals (Sweden)

    Samira NEGRICHI

    2017-12-01

    Full Text Available Résumé Introduction. Des facteurs comme l’obésité et l’alimentation sont impliqués dans la carcinogenèse colique. Objectif. Une étude rétrospective cas-témoins est menée afin d’évaluer l’association de ces facteurs avec le cancer colorectal (CCR dans une population de l’Est Algérien. Matériel et méthodes. L’enquête a été réalisée entre avril 2016 et août 2017, au niveau de l'Etablissement Public Hospitalier de Bekaria à Tébessa et des Centres Anti-Cancer de Batna et d’Annaba. Soixante quatre patients atteints de CCR âgés de 51±12 et 64 témoins dont l’âge moyen était de 51±17 ans ont été recrutés. Le questionnaire utilisé a permis de collecter les informations concernant l’âge, le sexe, les mesures anthropométriques, les habitudes alimentaires et la fréquence de consommation de quelques aliments. Résultats. Une association significative est notée entre l’obésité et la prévalence du CCR (37,5 % des patients vs 20,31 % des témoins, p=0,048. L’indice de masse corporelle (IMC moyen des patients était plus élevé que celui des témoins. La prévalence du cancer atteint son maximum entre 50 et 59 ans. La consommation des céréales et des œufs est retenue comme facteur protecteur du CCR (p=0,046 et 0,028. Les témoins consomment plus de pâtes que les patients (P=0,054. Conclusion. Cette étude met en évidence l’association entre le cancer colorectal, l’obésité et la consommation de certains aliments chez les patients atteints de CCR. [Abstract Introduction. Factors such obesity and diet are involved in colon carcinogenesis. Objective. A retrospective case-control study was done to evaluate the association of these factors with colorectal cancer (CRC in eastern Algeria population. Material and methods. This study was conducted between April 2016 and August 2017, at the Bekaria public hospital in Tebessa, and the Anti-Cancer Centers of Batna and Annaba. Sixty four patients with

  2. Le monde quantique

    CERN Document Server

    Aspect, A; Bensaude-Vincent, B; Castiel, A; Chevalley, C; Darrigol, O; Deligeorges, S; D'Espagnat, B; Laloë, F; Lévy-Leblond, J-M; Messiah, A; Paty, M; Vuillemin, J; Wheaton, B R

    1984-01-01

    Le monde quantique La physique quantique, après trois quarts de siècle, n'en finit pas d'être moderne. Elle est présente quotidiennement dans les laboratoires où les physiciens étudient atomes, noyaux et particules. Elle est entrée dans l'industrie où lasers, transistors et supraconducteurs lui doivent d'exister. Et elle continue à alimenter le débat philosophique sur la nature de la réalité dont elle montre la non-séparabilité fondamentale. Ses concepts de base, son développement, ses applications, ses controverses sont ici présentés par une pléiade de physiciens, d'historiens et de philosophes.

  3. Le vieillard et le chevalier

    Directory of Open Access Journals (Sweden)

    Mélanie JECKER

    2010-05-01

    Full Text Available La fin du Moyen Âge fascine. Deux facteurs principaux expliquent l’attraction qu’exerce cette période : elle apparaît d’une part comme un moment historique riche car double, phase de transition entre le Moyen Âge et la Renaissance, où se mêlent des cadres de représentation anciens et nouveaux. L’insinuation d’une pensée humaniste balbutiante s’y traduirait notamment par l’émergence de la notion d’individu, qui constitue l’un des objets de ce travail. Il faut invoquer, d’autre part, l’image macabre d’un bas Moyen Âge hanté par l’idée de la maladie et de la mort depuis l’épidémie de peste noire de 1348, obsédé par la brièveté de la vie humaine. Ces deux facettes de « l’automne du Moyen Âge » tel que l’évoque avec poésie Joan Huizinga sont-elles autre chose qu’une plaisante image d’Epinal? Cette étude cherche précisément à déterminer le degré de validité de ces deux topiques, à travers l’analyse de la représentation des âges de la vie dans un corpus bien défini, celui de la biographie chevaleresque castillane du XVe siècle. L’intérêt porté à l’individu, la conscience de la singularité impliquent en effet celle du caractère mouvant de la personne, or quel thème mieux que celui des âges permet de confirmer ou d’infirmer l’hypothèse du surgissement d’une nouvelle manière de concevoir l’homme, proprement « renaissante », en ce siècle de transition , La nature même du corpus retenu – des récits biographiques – suggère en effet une mutation dans l’appréhension de la personne, une attention prêtée à sa progressive transformation. L’étude de la représentation de la vieillesse, en particulier, révèle non seulement à quel point était alors réelle cette prétendue obsession de la déchéance physique et de la mortalité, mais aussi dans quelle mesure étaient soulignés et valorisés les changements individuels parallèles à l

  4. La Turquie face à la globalisation. Convergence d’intérêts entre les acteurs religieux particularistes : le cas du sud-est européen dans les années 1990 Turkey and Globalisation. Convergence of Interests between Particularists Religious Actors. The South-East Europe during the ’90s

    Directory of Open Access Journals (Sweden)

    Nikolaos Raptopoulos

    2011-03-01

    Full Text Available La globalisation, en favorisant l’interaction des idées et des hommes, est de ces facteurs qui sont capables de mettre en cause des systèmes sociopolitiques rigi­des. Cette contribution s’intéresse plus précisément au cas de figure du système kémaliste turc. L’islam turc, composante incontestée de l’identité nationale, est de plus en plus impliqué dans le système sociopolitique contemporain en tant qu’idéologie globalisante promue par certains acteurs. Cette situation, prévisi­ble pour la scène interne, se confirme aussi dans l’action et l’interaction des protagonistes au niveau international. En Turquie, l’islam, religion monothéiste, est devenu un véhicule d’interaction : d’une part entre l’État (laïc et nationa­liste et les acteurs sociaux islamiques ; d’autre part, entre ces mêmes acteurs et les communautés turques et musulmanes des régions de l’aire ottomane, no­tamment du sud-est de l’Europe.By fostering interaction globalization can question socio-political rigidity. This was the case with kemalist Turkey. Part and parcel of national identity, Turkish Islam is increasingly involved in the socio-political set up in the form of a global ideology. Recognizable locally, this process also carries international weight. Monotheistic Islam has acted in Turkey as a go-between : between the nationalistic, lay State and Islamic actors, between these latter and Islamic elements in regions of the former ottoman empire, notably in south-eastern Europe

  5. Le vernis des apparences

    Directory of Open Access Journals (Sweden)

    Grazia Nicosia

    2010-04-01

    Full Text Available Le but de cet article est de comprendre l’incidence sémiotique du nettoyage d’un tableau ainsi que la résultante cognitive induite sur l’observateur. Cette étude confronte l’analyse des phénomènes visuels engendrés par le jaunissement du vernis et son retrait, à des entretiens réalisés à dessein. Le retrait d’un vernis jauni change considérablement l’image. L’heure, le climat, la saison et l’activité même des personnages s’en trouvent ainsi modifié. La patine peut être perçue, soit comme un obstacle à l’exploration, soit pour ceux qui l’apprécient, comme le medium d’une relation plus intime entre l’œuvre et l’observateur.The purpose of this article is to understand the semiotic impact of the cleaning of a painting and the cognitive effects induced on the observer. This study analyses conjointly the visual phenomenon generated by yellowing varnish and its removal and controlled interviews of observers.The removal of yellowing varnish modifies considerably the perception of the picture. Daytime, climate, season and characters activities are modified. The patina may be perceived either as an obstacle to the painting exploration, or, for those who appreciate it, as a medium for a closer relationship between the painting and the observer.

  6. “La vida está fuera del tiempo”. León Tolstói entre la práctica vital y la predicación moral

    Directory of Open Access Journals (Sweden)

    Rabe, Ana María

    2010-10-01

    Full Text Available At the turn of the 20th century, Leo Tolstoy was considered an important ethical figure in Russia as well as in other cultural spheres. He was idolized as a moral example who preached life and work in the countryside in harmony with nature, charity, simplicity and denial of property; values that the aristocratic writer seemed to realize himself. At the same time, the public and ecclesiastic authorities of Russia feared the big influence emanating from the severe criticism and denunciations by which Tolstoy unveiled injustice, violence and hypocrisy of the Russian institutions. As the article shows, Tolstoyan ideas about love thas is realized here and now, denial of any recompense, nonviolent resistance, decease as a decline in everyday life and vital practice that is integrated in present played an important role in the intellectual circles of that time, e. g. in Bunin, Gorki, Heidegger, Gandhi, Nietzsche or Lukács. Tolstoy’s conception of life as pure present, as being “beyond” time and thus gaining felicity and eternity –an idea suggested by Saint Augustine–, impressed especially the young Wittgenstein. The article presents these ethical, religious and existential ideas as they appear in the Tolstoyan religio-theoretical writings and narrations while showing at the same time the contrary positions of Tolstoy’s thought and character on which they are built.

    A finales del XIX y principios del XX León Tolstói fue considerado un importante modelo ético dentro y fuera de Rusia. La gente del pueblo lo veneraba como ejemplo moral que predicaba la vida y el trabajo en el campo en concordancia con la naturaleza, el amor al prójimo, la sencillez y renuncia a la propiedad, valores que el escritor aristócrata parecía llevar él mismo a la práctica. A la vez, las autoridades estatales y eclesiásticas de Rusia temían la gran influencia que ejercían las severas críticas y acusaciones con las que el famoso novelista y

  7. Le Projet d’Ole Lando sur les Contrats

    DEFF Research Database (Denmark)

    Holle, Marie-Louise

    2017-01-01

    En 2016 le projet de recherche le plus important jusqu’à présent sur le droit nordique des contrats a pris fin et un livre, de presque 400 pages, en a marqué l’aboutissement. Le résultat du projet est un « restatement » tel qu’il existe aux États-Unis. Le Restatement porte sur les règles et les...

  8. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  9. Le LHC, un tunnel cosmique

    CERN Multimedia

    CERN. Geneva

    2009-01-01

    Et si la lumière au bout du tunnel du LHC était cosmique ? En d’autres termes, qu’est-ce que le LHC peut nous apporter dans la connaissance de l’Univers ? Car la montée en énergie des accélérateurs de particules nous permet de mieux appréhender l’univers primordial, chaud et dense. Mais dans quel sens dit-on que le LHC reproduit des conditions proches du Big bang ? Quelles informations nous apporte-t-il sur le contenu de l’Univers ? La matière noire est-elle détectable au LHC ? L’énergie noire ? Pourquoi l’antimatière accumulée au CERN est-elle si rare dans l’Univers ? Et si le CERN a bâti sa réputation sur l’exploration des forces faibles et fortes qui opèrent au sein des atomes et de leurs noyaux, est-ce que le LHC peut nous apporter des informations sur la force gravitationnelle qui gouverne l’évolution cosmique ? Depuis une trentaine d’années, notre compréhension de l’univers dans ses plus grandes dimensions et l’appréhension de son comportement aux plus peti...

  10. Le livre sur le livre traité de documentation

    CERN Document Server

    Otlet, Paul

    2015-01-01

    Paul Otlet est considéré comme le père des sciences de l'information. Ouvrage fondateur et fondamental, le Traité de documentation. Le livre sur le livre (1934) est l'aboutissement de son travail inlassable pour rassembler, classer et partager les connaissances. Otlet y propose une remarquable synthèse du savoir sur le livre et le document en même temps qu'il anticipe Internet et l'hypertexte. La réédition du Traité de documentation, 70 ans après la disparition de son auteur, coïncide avec la réouverture du Mundaneum à Mons, où le fabuleux héritage documentaire légué par Paul Otlet et Henri La Fontaine est conservé. « Ici, la table de travail n'est plus chargée d'aucun livre. À leur place se dresse un écran et à portée un téléphone. Là-bas, au loin, dans un édifice immense, sont tous les livres et tous les renseignements. De là, on fait apparaître sur l'écran la page à lire pour connaître la réponse aux questions posées par téléphone. » Préfaces de Benoît Peeters (éc...

  11. Quantitative analysis of nickel in zirconium and zircaloy; Dosage du nickel dans le zirconium et dans le zircaloy

    Energy Technology Data Exchange (ETDEWEB)

    Rastoix, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1957-07-01

    A rapid spectrophotometric has been developed for determination of 10 to 1000 ppm of Ni in zirconium and zircaloy using dimethylglyoxime. Iron, copper, tin and chromium, do not interfere at the concentration usually present in zirconium and its alloys. (author) [French] On determine colorimetriquenent 10 a 1000 ppm de Ni dans le zirconium et le zircaloy par photo colorimetrie a 440 m{mu} de la dimethylglyoxime nickelique. Le dosage est rapide. Le fer, le cuivre, l'etain, le chrome ne genent pas aux concentrations habituellement rencontrees dans le zirconium et ses alliages. (auteur)

  12. Le language des masques burkinabè

    African Journals Online (AJOL)

    hond

    2 juil. 2007 ... un faire transformateur cognitif devient un esprit qui a des fonctions hautement spirituelles, religieuses et aussi souvent esthétiques. Le langage et le discours des masques. Les masques sont un langage et un discours. Un langage est un système de communi- cation et d'expression. L'unité de base de ...

  13. Natural CO{sub 2} migrations in the South-Eastern Basin of France: implications for the CO{sub 2} storage in sedimentary formations; Contribution a la connaissance des migrations de CO{sub 2} naturel dans le Bassin du Sud-Est de la France: enseignements pour le stockage geologique du CO{sub 2} dans les reservoirs sedimentaires

    Energy Technology Data Exchange (ETDEWEB)

    Rubert, Y.

    2009-03-15

    Study of natural CO{sub 2} analogues brings key informations on the factors governing the long term stability/instability of future anthropogenic CO{sub 2} storages. The main objective of this work, through the study of cores from V.Mo.2 well crosscutting the Montmiral natural reservoir (Valence Basin, France), is to trace the deep CO{sub 2} migrations in fractures. Petrographic, geochemical and micro-thermometric studies of the V.Mo.2 cores were thus performed in order: 1) to describe the reservoir filling conditions and 2) to detect possible CO{sub 2}-leakage through the sediments overlying the reservoir. Fluid inclusions from the Paleozoic crystalline basement record the progressive unmixing of a hot homogeneous aquo-carbonic fluid. The Montmiral reservoir was therefore probably fed by a CO{sub 2}-enriched gas component at the Late Cretaceous-Paleogene. The study of the sedimentary column in V.Mo.2 well, demonstrates that the CO{sub 2} did not migrate towards the surface through the thick marly unit (Domerian-Middle Oxfordian). These marls have acted as an impermeable barrier that prevented the upward migration of fluids. Two main stages of fluid circulation have been recognized: 1) an ante- Callovian one related to the Tethysian extension 2) a tertiary stage during which the upper units underwent a karstification, with CO{sub 2} leakage related but which remained confined into the deeper parts of the Valence Basin. Since the Paleogene, the Montmiral reservoir has apparently remained stable, despite the Pyrenean and alpine orogeneses. This is mainly due to the efficient seal formed by the thick marly levels and also to the local structuration in faulted blocks which apparently acted as efficient lateral barriers. (author)

  14. Hyperloop : le droit et le devoir de douter...

    OpenAIRE

    Crozet , Yves

    2016-01-01

    National audience; C’est comme si c’était fait ! Les journaux les plus sérieux (Les Echos) nous annoncent que le premier test du prototype Hyperloop dans le désert du Nevada est un succès. Le projet futuriste d’Elon Musk se concrétise. Un véhicule terrestre de transport collectif va bientôt se déplacer à plus de 1000 km/h entre San Francisco et Los Angeles. Comme pour donner du crédit à cette information, la SNCF, via sa filiale SYSTRA va devenir partenaire du projet. Déjà les journaux de Pro...

  15. Le modèle spatial de la capitale allemande

    Directory of Open Access Journals (Sweden)

    Antoine Laporte

    2013-06-01

    Full Text Available En Allemagne, en 1999, le Chancelier fédéral et son gouvernement ont quitté Bonn pour Berlin. Ce transfert du pouvoir est accompagné de celui d’une grande partie de l’appareil d’État et de la haute administration, et des fonctions qui leur sont traditionnellement attribuées comme la presse, les lobbys ou encore la diplomatie. Le déplacement du statut de capitale effective de l’Allemagne de Bonn à Berlin est le résultat des évolutions géopolitiques d’un pays ayant recouvré son unité et sa pleine et entière souveraineté. Installer le pouvoir exécutif et législatif à Berlin était une démarche hautement symbolique, visant à normaliser la position de l’ancienne capitale de la RDA et du IIIe Reich comme véritable centre politique de l’Allemagne. Or le déplacement des institutions fédérales n’est pas qu’un acte symbolique. Il entraîne également à l’échelle intra-urbaine des dynamiques très concrètes sur le tissu urbain et participe à la mise en place de nouvelles centralités dans la ville. En effet, le statut de capitale d’État prédestine l’agglomération à la coprésence de nombreuses fonctions urbaines spécifiques plus ou moins directement liées à l’exercice ou à la symbolique du pouvoir.

  16. Le contrôle de gestion environnementale d'une entreprise

    OpenAIRE

    Marquet-Pondeville, Sophie

    2001-01-01

    Dans cette recherche, nous étudions comment s’opère le contrôle de gestion environnementale. Cette problématique est abordée dans une perspective contingente et nous proposons un modèle théorique qui met en évidence l’impact de certaines variables sur les systèmes de contrôle de la gestion environnementale. Certains liens présents dans ce modèle sont discutés à travers une étude de cas.

  17. Sexospécificités | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le développement des pays les plus pauvres. – fiche d'information « Qu'est-ce que le paludisme ? » de l'OMS.

  18. EST! best practices

    Science.gov (United States)

    2000-10-05

    This booklet presents the eighteen winners in a competition for projects that promote environmentally sustainable transportation (EST). These range from car sharing to hydrogen fueled buses to public transit promotion campaign. Each project is presen...

  19. Est-ce 'la' ou 'le'? Un apprentissage difficile

    NARCIS (Netherlands)

    van der Linden, E.; Cuniţă, A.; Florea, F.; Păunescu, M.-O.

    2011-01-01

    A study of the acquisition of nominal gender in Germanic and Romance languages by monolingual and bilingual children on the one hand and second language learners on the other shows that gender is difficult to acquire in all languages for L2 learners. In the same time, it is shown that in Romance

  20. Profil lipidique des personnes vivant avec le VIH sous antirétroviral ...

    African Journals Online (AJOL)

    Au regard des connaissances actuelles, aucune étude n'est disponible au Bénin sur le profil lipidique des personnes vivant avec le VIH. L'objectif de la présente étude est de décrire le profil lipidique des personnes vivant avec le VIH sous antirétroviral suivies au CHU-O/P de Porto-Novo. Il s'est agi d'une étude ...

  1. Kenya | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Kenya est depuis longtemps le centre économique de l'Afrique de l'Est. Cependant, malgré des progrès économiques considérables au cours de la dernière décennie, la pauvreté et des inégalités persistent. Le bureau du CRDI à Nairobi est le point central des efforts du Centre en Afrique subsaharienne et il supervise ...

  2. Le réseau GEOHealth d'Afrique orientale pour la prévention des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est mis en oeuvre dans le cadre de l'initiative Global Environmental and Occupational Health, sous la direction du Fogarty International Center des National Institutes for Health des États-Unis, en collaboration avec le Centre de recherches pour le développement international. Le volet de recherche générale est ...

  3. L’Association du personnel, le TREF, le Comité des Finances et le Conseil du CERN

    CERN Multimedia

    Staff Association

    2016-01-01

    L’Association du personnel, forte de son approche participative et consensuelle, recherche toujours le meilleur accord possible pour l’Organisation et son personnel. Pour ce faire, discussions et concertation avec la Direction, travail d’explication et de persuasion au TREF et ailleurs auprès des délégués des États membres sont nos principaux atouts. TREF (Tripartite Employment Conditions Forum), un Forum d’échanges, de discussions « L’objectif du Forum est d’améliorer le processus de prise de décision  en donnant aux personnes concernées la possibilité et le temps de comprendre pleinement la position de tous les participants. » (CERN/RTG/8) Le Forum tripartite sur les conditions d’emploi (TREF), créé par le Conseil du CERN en juin 1994, est composé de r...

  4. Le vase de Pandore

    Directory of Open Access Journals (Sweden)

    Nicola Panichi

    2000-06-01

    Full Text Available Il s’agit ici de suivre les stratégies discursives par lesquelles Érasme situe sa Lingua sous le patronage symbolique de deux mythes des plus opératoires à la Renaissance : le vase de Pandore et la tour de Babel, tous deux verrouillant le texte, l’un en guise d’incipit, l’autre d’explicit, dans un dialogue où chacun use de l’autre pour renforcer les significations et instaurer le régime sémantique du texte, tant linguistique qu’éthique. Ce sont ces jeux complexes entre différents niveaux de discours dont dépend le sens ultime de l’œuvre que cet article s’attache à saisir.Se trata de seguir aquí las estrategias discursivas mediante las cuales Erasmo sitúa su Lingua bajo el dominio simbólico de dos de los mitos más funcionales del Renacimiento: el vaso de Pandora y la torre de Babel, los cuales limitan el texto, uno a modo de íncipit, otro de excipit, en un diálogo en el que se valen el uno del otro para reforzar los significados y establecer el régimen semántico del texto, tanto lingüístico como ético. Son esos juegos complejos entre diferentes niveles de discurso, de los que depende el sentido último de la obra, que este artículo intenta captar.

  5. Publications | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L''objectif de cette étude est d''établir des relations entre les perceptions locales ... comme sujet d''une grande pertinence dans la recherche en sciences sociales. ... La recherche sur lele économique et social du secteur informel des TIC est ...

  6. Le commerce du Nord

    OpenAIRE

    Pourchasse, Pierrick; Bouëdec, Gérard Le

    2015-01-01

    Au XVIIIe siècle, la France s'approvisionne abondamment dans les pays du Nord : bois, chanvre et goudron de la Baltique, tonnellerie de Poméranie, pêche de rogue de Norvège, graines de lin de Courlande, barres de fer suédois… Sa balance commerciale est pourtant positive grâce aux sels, aux vins et surtout des nouvelles marchandises coloniales. Or, la plupart des transactions passent par l’incontournable intermédiaire hollandais. Les explications sur l’absence des Français dans le Nord sont re...

  7. Le plurilinguisme du perroquet

    Directory of Open Access Journals (Sweden)

    Manuel Mühlbacher

    2012-05-01

    Full Text Available La figure du perroquet occupe une position ambiguë face à la question de la traduction. Il est capable d’imiter des paroles en toutes les langues, mais il n’est capable d’en comprendre aucune — il ne peut que répéter des sons, c’est-à-dire des signifiants. Le traducteur semble faire le contraire quand il passe d’une langue à une autre en tâchant de transmettre une signification semblable par d’autres signes. L’article vise à discuter lele du traducteur et sa relation, éventuellement équivoque, au perroquet, en analysant la traduction allemande de Trois Contes par André Stoll et Cora van Kleffens. Un décalage au niveau sémantique peut éclairer l’interprétation du texte, par exemple en explicitant des allusions sous-jacentes, tandis que le transfert de la syntaxe française en allemand pose souvent des problèmes considérables. Comment le traducteur peut-il reproduire des structures syntaxiques qui n’existent pas en allemand, mais qui ne cessent de revenir dans le texte français ? Que faire si le texte se met à jouer au perroquet et finit par se singer lui-même ? André Stoll et Cora van Kleffens ont su trouver des stratégies pour affronter ces difficultés.The figure of the parrot holds an ambiguous position towards the question of translation. It is able to imitate all languages, but it will never understand any of them – its only skill is to mimic sounds, i.e. mere signifiers. On the contrary, the translator seems to be the antithesis of the parrot when he moves from one language to another. He endeavours to convey a similar meaning, but by different signs. The article aims at discussing the role of the translator and his or her eventually equivocal relation to the parrot by means of analysing the German translation of Trois Contes by André Stoll and Cora van Kleffens. Whereas a semantic divergence can result in a different tendency on the level of interpretation, as in the case of an underlying

  8. EST Vocabulary Instruction

    Directory of Open Access Journals (Sweden)

    Célia D.S. Bell

    2012-05-01

    Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.

  9. LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...

    African Journals Online (AJOL)

    Après chirurgie, les récidives sont fréquentes. Lele de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...

  10. Une nouvelle ouverture sur le monde pour les femmes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'appellent ailleurs dans le dédale d'étals et d'allées serrés. En plus de son travail sur le marché, Jertrudes est également secrétaire de l'association des femmes qui vendent sur ce marché. Le groupe est un endroit où elles ...

  11. Publications | Page 10 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'obésité est un facteur de risque de plusieurs maladies non transmissibles, dont les cardiopathies, l'hypertension, le diabète et le cancer. Conflit et développement dans les collines de Guwahati. Dans la ville de Guwahati, dans le nord-est de l'Inde, la croissance rapide a alimenté une explosion de développement non ...

  12. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  13. 205 Le Role de la Litterature dans le Developpement de la Nation ...

    African Journals Online (AJOL)

    Ike Odimegwu

    du plaisir en même temps qu'il le moralise. Elle fait naître dans ses lecteurs ou dans son audience des .... développement de l'esprit>>(319)Par cette définition nous comprenons que le développement signale qu'il du progrès ... qu'elle est une œuvre de l'imagination qui aide l'homme à transcender le monde physique.

  14. Le « modèle germanique » Français

    OpenAIRE

    Lefebvre , Armelle

    2009-01-01

    Resume Le concept d?Allemagne permet de reveler, selon une approche , l?ampleur des desaccords ayant preside a la definition du concept d?Etat en France. De ce dernier, l?on aborde divers emplois qu?illustrent des modeles d?Etat. Le opere ainsi dans un debat qui est le creuset de la connaissance politique moderne, avec ses apories: celles de la souverainete externe, de l?ordre interetatique, de la confederation. L?article expose alo...

  15. Plaidoyer pour le lavage de nez dans les pathologies naso ...

    African Journals Online (AJOL)

    Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

  16. Centre de recherches pour le développement international ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    André Lavoie

    Definitions. 5. Rôles et ... a) Le Centre de recherches pour le développement international (CRDI) est une société d'État canadienne à .... conduite éthique dans le cadre de ces activités afin que la confiance du public dans .... a) Les gouverneurs en déplacement pour le compte du CRDI ont droit à une indemnité de repas et ...

  17. Gestion du Centre | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Comité de gestion du Centre (CGC) est composé des membres de la haute direction du CRDI, notamment les directeurs de nos quatre bureaux régionaux et de nos principaux secteurs de programme. Le CGC travaille en collaboration avec le président afin de soutenir la recherche pour le développement, lui fournissant ...

  18. Le grand inventaire

    Directory of Open Access Journals (Sweden)

    Michel Melot

    2012-05-01

    Full Text Available Depuis quarante ans qu’il existe, l’Inventaire général des monuments et des richesses artistiques de la France n’a pas seulement progressé, couvrant près de dix mille communes, documentant plus de vingt mille dans cinq millions de pages, trois millions de photographies, et cent mille dessins. Il est devenu ce que ses fondateurs désiraient qu’il fût. Il n’est pas une liste d’objets plus ou moins singuliers qu’on aurait oubliés, mais l’observation méthodique de l’émergence dans le monde de l’ar...

  19. Le paludisme, le tsunami silencieux d'Afrique | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  20. Les porphyres luganais entre le Lac de Lugano et la Valganna

    NARCIS (Netherlands)

    Sitter, de L.U.

    1925-01-01

    Le terrain exploré est limité au Nord par une ligne droite, qui va de Ghirla en passant par Marzio à Brusimpiano. La limite Est est formée par le lago di Lugano et par la vallée de Porto Ceresio jusqu’à Pogliana. La limite Sud est plus irrégulière; elle passe au Sud de Pogliana vers le sommet de la

  1. Le regard anachronique

    Directory of Open Access Journals (Sweden)

    Jean-Paul Aubert

    2011-01-01

    Full Text Available Cet article a pour objet l’anachronisme dans le film historique. Il s’appuie sur l’étude du long métrage Goya à Bordeaux, réalisé en 1999 par le cinéaste espagnol Carlos Saura. Cette biographie filmée du peintre Francisco de Goya fait mieux que composer avec l’anachronisme inhérent à toute reconstitution historique. Il l’assume et le revendique. La mise en cause de la chronologie et l’effacement de l’Histoire prennent sens dans la perspective d’une réflexion originale sur l’Histoire de l’art conçue comme un dialogue entre les œuvres et entre les époques.Este artículo está dedicado al problema del anacronismo en las películas históricas. Se basa en el estudio de Goya en Burdeos, un largo metraje rodado en 1999 por el director de cine español Carlos Saura. Esta biografía de Goya no sólo se acomoda con el anacronismo propio de la reconstitución histórica sino que lo asume y lo reivindica. El cuestionamiento de la cronología y el desinterés por la Historia cobran un nuevo sentido en el marco de una reflexión original sobre la Historia del arte concebida como un diálogo entre las obras y entre las épocas.

  2. Le travail … c’est la santé : la santé au travail … une pratique en question Work… is health : health at work … a practice in question La salud laboral… una práctica en cuestionamiento

    Directory of Open Access Journals (Sweden)

    Paul Frimat

    2010-02-01

    Full Text Available C’est en 1946 qu’est née cette institution originale qu’est la médecine du travail. Au départ, principalement basée sur une approche essentiellement individuelle, la notion d’aptitude y occupait une place centrale au sein du système de santé. Ce système a connu des évolutions où l’approche individuelle s’est peu à peu couplée à une dimension plus collective, laissant cependant encore un système largement perfectible. Dans ces évolutions, la décision d’aptitude s’est, quant à elle, complexifiée. De nombreux rapports ont d’ailleurs été écrits ces cinq dernières années afin de mettre en débat à la fois la légitimité de pérenniser un tel concept, mais également son efficacité en ce qui a trait à la prévention des pathologies liées au travail. Une loi sera sans doute prévue fin 2009, 2010… Mais qu’en sera-t-il de la pratique, quelle réalité perdurera ? Apte/inapte ? Comment peut-on aider à la compatibilité entre droit à la santé et droit au travail ? En quoi le système français de l’aptitude et de l’inaptitude a pu offrir des garanties pour l’employeur, le salarié, la société ? Tel sera l’objet de cette intervention.It was in 1946 that this new original institution, occupational medicine, was created in France. At the beginning, based mainly on an essentially individual approach, the concept of medical ability held a central place in the health system. This system has changed and the individual approach is now paired with a more collective vision, leaving the system still largely perfectible. Among these evolutions, the medical ability decision has become increasingly complex. Numerous reports have been written in the last five years to debate the legitimacy of maintaining such a concept, as well as its efficiency as far as the prevention of work-related pathologies is concerned. A law will certainly be expected at the end of 2009/beginning of 2010. But, what about

  3. Pompe de chaleur fonctionnant avec un mélange de fluides Heat Pump Operating with a Fluid Mixture

    Directory of Open Access Journals (Sweden)

    Vidal J.

    2006-11-01

    Full Text Available Lorsqu'une pompe de chaleur échange de la chaleur avec des fluides extérieurs, dont la température évolue au cours de l'échange, il est possible d'augmenter le coefficient de performance en utilisant comme fluide de travail un mélange non-azéotropique qui se vaporise et se condense suivant une évolution de température parallèle à celle du fluide extérieur avec lequel s'effectue cet échange. L'utilisation de mélanges dans les pompes de chaleur a été étudiée, d'une part, au moyen de modèles de simulation sur ordinateur et, d'autre part, au moyen d'essais expérimentaux. Différentes applications ont été examinées à la fois dans le domaine du chauffage résidentiel et dans le domaine industriel. Whenever heat is recovered and delivered, the coefficient of performance of a heat pump can be increased by using a fluid mixture selected to have a temperature variation, during the vaporization and condensation stages, parallel to that of the outside fluid with which the heat exchange takes place. Such a solution was investigated both theoretically and experimentally. It has been shown that significant savings can be expected, ranging up to 50% of the energy consumption of conventional heat pumps in some cases. Various applications for home and industrial heating have been examined, and the economic prospects have been found to be satisfactory. Further work is needed to develop such heat pumps on a commercial basis.

  4. Le principe non bis in idem et le droit communautaire

    OpenAIRE

    Hedabou, Aziz

    2018-01-01

    Le principe non bis in idem est une garantie fondamentale qui interdit que les mêmes faits soit poursuivi et puni deux fois. Il est reconnu par tous les droits internes et “appartient aux droit universel des nations”. Dès lors, sa lettre et son esprit ne sont plus cantonnés au droit interne et ont tendance à s’internationaliser. En droit communautaire, l’étude du principe non bis in idem peut être envisagée sous trois angles différents. D’abord en droit pénal international unilatéral où chaqu...

  5. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  6. Le colonel Rol-Tanguy

    OpenAIRE

    Bourderon, Roger

    2009-01-01

    Ouvrier métallurgiste, syndicaliste et communiste, le futur colonel Rol-Tanguy, né en 1908, se passionne pour le métier des armes lors de son service militaire. Son expérience dans les Brigades internationales est décisive. Il l’enrichit dans les FTP puis comme chef régional FFI : il prépare et conduit l’insurrection parisienne avec un état-major comportant de nombreux cadres de l’armée. Compagnon de la Libération, il se distingue dans la campagne d’Allemagne et est intégré dans l’armée avec ...

  7. Le glaive de la parole

    Directory of Open Access Journals (Sweden)

    Luce Marchal-Albert

    2006-09-01

    Full Text Available Chacun sait, selon le mot de Pierre Viret, « en quelle confusion est la Chrestienté » au xvie siècle en Europe. C’est le deuxième quart du siècle qui nous intéressera ici, et en particulier l’année 1545, qui constitue une année charnière qui voit vaciller l’Église romaine, flamber et culminer la chasse aux hérétiques en même temps qu’elle voit la jeune Église réformée se renforcer et se positionner avec succès dans un champ religieux plus que chaotique. Les ouvrages polémiques réformés écrits...

  8. Le boson et le chapeau mexicain un nouveau grand récit de l'univers

    CERN Document Server

    Cohen-Tannoudji, Gilles

    2013-01-01

    Le boson ? C'est l'ultime particule élémentaire prédite par la théorie de l'infiniment petit, qui manquait encore et dont la découverte, grâce au grand collisionneur de hadrons du CERN, a été annoncée au monde entier le 4 juillet 2012. Postulée en 1964 par Robert Brout, François Englert et Peter Higgs, elle explique que le photon - particule qui transmet la force électromagnétique - n'a pas de masse, à l'encontre de celles véhiculant la force faible. Une telle dissymétrie était a priori incompatible avec la symétrie fondamentale, dite «de jauge», sur laquelle est fondé le modèle standard de la physique des particules. Le chapeau mexicain ? C'est le mécanisme grâce auquel le boson rend compte, en préservant les acquis du modèle standard, de l'origine des masses des particules élémentaires. Le boson et le chapeau mexicain se placent à la croisée - retracée par les deux auteurs en dialogue avec François Englert - des chemins de l'évolution des théories de l'astrophysique contemp...

  9. Leïomyosarcome de la prostate: Neoplasie rare

    Directory of Open Access Journals (Sweden)

    D. Basraoui

    2012-03-01

    La TDM et surtout l'IRM jouent un rôle primordial dans le bilan d'extension locale et à distance du léïomyosarcome prostatique et le seul moyen pour affirmer le diagnostic est l'histologie complétée par une étude immuno-histochimique. Leur prise en charge thérapeutique n'est pas codifiée à l'heure actuelle et leur pronostic reste très sombre.

  10. Administrateur à la paie (h/f) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le titulaire est chargé de la saisie dans les délais prescrits de données exactes dans le SIGRHP (système intégré de gestion des ressources humaines et de la ... de ses tâches liées à la paie, le titulaire est chargé des mesures de contrôle ...

  11. Le CRDI au Costa Rica

    International Development Research Centre (IDRC) Digital Library (Canada)

    région ont-elles besoin du commerce, mais elles doivent en outre acquérir de nouvelles compétences afin de pouvoir prospérer dans l'économie du savoir. La capacité d'utiliser les technologies de l'information, entre autres, est désormais une nécessité. Le CRDI subventionne la Fundación. Omar Dengo afin qu'elle puisse ...

  12. Le CRDI au Brésil

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les recherches subventionnées par le CRDI au Brésil ont permis d'éclairer les débats sur nombre de questions, dont la démocratie, la croissance économique, la santé, les services sociaux, l'innovation, la foresterie et l'eau. Pendant la dictature militaire, qui a pris fin en 1985, le CRDI s'est employé à assurer la survie de la ...

  13. la lutte contre le SIDA au Cameroun

    African Journals Online (AJOL)

    Chantel

    Pour lutter contre cette pandémie, le Cameroun s'est organisé en mettant en place, avec l'aide de ses partenaires bilatéraux et ... la dérision qui faisait du SIDA 'le syndrome inventé pour décourager les ... rapidement donner une réponse médicale à la maladie. ... histoire politique, à ses susceptibilités historiques et à.

  14. Gisèle HALIMI, La Kahina

    OpenAIRE

    ALLOUCHE-BENAYOUN, Joëlle

    2010-01-01

    Est-ce un ouvrage historique ? Est-ce un roman ? Un roman historique ? Le lecteur est désemparé dès qu’il plonge dans l’ouvrage que Gisèle Halimi a consacré à la grande héroïne judéo berbère. Si l’on comprend bien l’intérêt de l’avocate féministe – par ailleurs juive et née en Tunisie – pour cette figure féminine de résistance, la gêne s’installe au fur et à mesure de la lecture, face à l’impossibilité de l’auteur de choisir un genre littéraire et de s’y tenir. Alors que le destin légendaire ...

  15. En torno a una estética del deporte

    OpenAIRE

    Javier Olivera Betrán*

    2006-01-01

    Aunque el término estética tiene varios significados especiales, en el contexto de las ciencias sociales se emplea preferentemente para designar el conjunto de investigaciones que están relacionadas con las artes. Estética es el estudio del comportamiento y la experiencia del hombre al crear arte, al percibir y comprender el arte y al ser influido por el arte. El arte es el medio que promueve una fusión del individuo con el todo, el hombre para rebasar los límites que le impone la individuali...

  16. Effet du stress salin sur le comportement physiologique et ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2013 ... rapidement dans les feuilles à partir de 25 mmol de NaCl. Le rapport de sélectivité K+/Na+ a été plus discriminant entre les variétés : Midass a présenté le rapport de sélectivité le plus élevé et Nabeul le rapport de sélectivité le plus faible. Conclusion et application : La variété Nabeul qui est de type piment ...

  17. Le patrimoine et ses outils de gestion

    CERN Document Server

    Garcin, J

    2001-01-01

    Les principale taches de gestion du Patrimoine immobilier du CERN sont la saisie des données, leur mise à jour, l'archivage et la mise à disposition des informations. Les outils de gestion actuels : Le Système de Gestion de Base de Données Relationnelles alphanumérique ORACLE permet de gérer toutes les informations du Patrimoine, sur le réseau du CERN. Le logiciel de dessin Graphique MICROSTATION (Bentley) a été installé dans la division ST depuis fin 1991. Les plans de situation des sites, des bâtiments et locaux, des espaces confinés ont été réalisés avec ce logiciel. Les outils de demain : La mise en place du SIG (Système d'Information Graphique) STAR a été réalisée en 1993. Le transfert des plans de locaux de MICROSTATION vers STAR est en cours depuis une année environ. Le dessin de la cartographie des réseaux de canalisations Eaux Usées et Eaux Pluviales est en cours de réalisation. Le Web est l'outil de consultation de l'information par les utilisateurs.

  18. Pays en transition : pour que les sociétés se transforment, il est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Conscient du fait que les périodes de transformation risquent de provoquer le chaos, mais qu'elles sont également porteuses de rapides progrès sur le plan social et économique, le CRDI est intervenu dans quelque 25 pays ayant amorcé une transition de la guerre à la paix, de la dictature à la démocratie ou d'une ...

  19. Le déficit de filles

    International Development Research Centre (IDRC) Digital Library (Canada)

    de la population est une tendance plus récente. C. Le déficit de filles. Le déséquilibre du ratio hommes-femmes en Inde. D. R. O. I. T. S. D. E. S. F. E. M. M. E. S. E. T. P. A. R. T. IC. I. P. A. T. IO. N. C. I. T. O. Y. E. N. N. E. CENTRE DE. RECHERCHES. POUR LE. DÉVELOPPEMENT. INTERNATIONAL. CRDI : Jason Taylor ...

  20. Production of a magnetic field of 1 600 000 At/m in a non-magnetic region of volume 0.5 cubic decimeters by a coil cooled by liquid hydrogen (1963); Production d'un champ magnetique de l 600 000 At/m dans un milieu non magnetique dont le volume est 0,5 decimetre cube. Enroulement refroidi a l'hydrogene liquide (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Garin, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-07-01

    The eventual application of the technique of cryogenic coils for the production of magnetic fields for liquid hydrogen bubble chambers has led us to the study and construction of two copper coils (cooled in a bath of liquid hydrogen). Part one treats certain generalities concerning the resistivity of several pure metals at very low temperatures, the gain in power, thermal isolation and the choice of conductor and power supply. Part two describes the experimental arrangement. The last part is devoted to a description of the two coils which were constructed, and to the results obtained. (author) [French] L'application eventuelle de la technique des ''bobines cryogeniques'' aux chambres a bulles a hydrogene liquide pour la production du champ magnetique nous a conduits a l'etude et a la construction de deux bobines en cuivre (refroidies dans un bain d'hydrogene liquide). La premiere partie traite de generalites concernant la resistivite de quelques metaux purs, a tres basse temperature, le gain de puissance, l'isolement thermique et le choix du conducteur et de l'alimentation electrique. Dans la seconde partie on decrit l'installation d'essais. La derniere partie est consacree a la description des deux bobines realisees et aux resultats obtenus. (auteur)

  1. Le Baratze (ou

    Directory of Open Access Journals (Sweden)

    Jacques Blot

    1998-01-01

    Full Text Available El círculo de piedras Mendizabal 7, de 8 metros de diámetro,   presenta una corona externa constituida de grandes bloques   hincados en la tierra, y otra interna y tangente, de elementos idénticos sólo puestos en el suelo. El cajón central está compuesto de cuatro losas y una tapa. No hay depósito de huesos ni de carbón de leña ; sólo se encuentran dos herraduras, entre las cuales una completa de tipo medieval, que podrían permitir de pensar en una construcción del círculo en el periodo histórico.

  2. Promotion de la recherche sur l'entrepreneuriat en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... surtout en ce qui concerne les femmes, et de suivre leur évolution en Asie du Sud-Est. ... surveillera le déroulement du projet et veillera au contrôle de la qualité. ... including heat stress, water management, and climate-related migration.

  3. Le tournoi des ombres

    CERN Document Server

    Treille, Daniel

    2017-01-01

    Le lecteur, transporté avec le narrateur dans une région hors norme, est invité à partager sa fascination pour la beauté du lieu, à découvrir la chronique de son passé, rude et pittoresque. Il va côtoyer une galerie de personnages très attachants, mais aux destinées bousculées par l histoire, et assister à l agitation montante du présent dans un contexte d une actualité brûlante. Ce quatrième roman de Daniel Treille, mêlant hardiment les genres, du quotidien trivial au récit épique, de considérations géopolitiques à quelques avancées de la science moderne, confirme son talent à mener, d une écriture très aboutie, une histoire complexe, peuplée de héros singuliers

  4. Le Dominique Interactif

    Directory of Open Access Journals (Sweden)

    Valérie Ouellette

    2005-09-01

    Full Text Available Cet article présente le Dominique Interactif, une bande dessinée interactive et multimédia unique, servant à évaluer sept troubles de la santé mentale chez les jeunes. La version pour les six à onze ans est adaptée aux limites cognitives des enfants et comporte plusieurs avantages. Malgré quelques limites, cet instrument permet d’obtenir des informations fiables de la part de l’enfant sur sa santé mentale. La fidélité et la validité de cet outil sont meilleures que celles des autres instruments traditionnels servant à mesurer la santé mentale des enfants. En combinant les résultats de ce questionnaire avec les informations des parents, professionnels et enseignants, le Dominique Interactif permet aussi d’effectuer une évaluation complète de la santé mentale de l’enfant. Enfin, son utilisation simple et rapide facilite l’évaluation clinique des enfants par les professionnels, permet l’évaluation de programmes d’intervention et favorise l’intervention précoce (Valla et al., 2000.

  5. Le continu contre l'espace

    Science.gov (United States)

    Salanskis, Jean-Michel

    Disons pour conclure que, en tout état de cause, la façon de concevoir philosophiquement le conflit du continu et de l'espace que nous avons trouvée chez Hegel n'est pas homogène avec le style et les modalités de la pensée mathématique: 1) d'une part, le lien classique, le lien de référence entre continu et espace en mathématiques n'est pas que l'espace serait premier et privé de pensée, et le continu second, venant dissoudre l'espace en apportant la qualité, l'infini et la pensée, mais tout au contraire, il consiste en ce que l'espace est fondé sur l'abîme infinitaire du continu ; 2) d'autre part, l'éventuel divorce entre l'espace et le continu dans l'aire mathématique n'est pas celui d'une réflexivité purement conceptuelle du continu avec un positivisme géométrique, n'équivaut pas à une rupture disciplinaire ; il est plutôt le symptôme de la dérive d'une herméneutique à l'égard d'une autre, au sein d'un continent juridique commun définissant la discipline (la mathématique ensembliste), cette dérive pouvant, à la limite, induire une refonte de ce sol juridique, sans que jamais il soit question pour autant de nier l'unité des mathématiques, à comprendre ici comme l'unité ultime de responsabilité de la communauté mathématique à l'égard des trois questions Qu'est-ce que l'espace?”, “Qu'est-ce que le continu?” et “Qu'est-ce que l'infini?”.

  6. Prime note sulla tutela penale dei culti nei Paesi dell’Est Europa

    Directory of Open Access Journals (Sweden)

    Giovanni Cimbalo

    2011-05-01

    Full Text Available Testo della relazione tenuta al Convegno “La Carta e la Corte” (Ferrara, 27 ottobre 2007 destinata alla pubblicazione negli Atti. SOMMARIO: 1. Alcune considerazioni preliminari sullo status delle Confessioni religiose nei paesi dell’Est Europa - 2. I nuovi orientamenti del diritto penale nell’Est Europa - 3. Le norme statali in materia di tutela penale dei culti e del sentimento religioso. 3. Le norme penali relative ai culti e a al sentimento religioso prima del 1992 nei Paesi dell’Est Europa - 4. Tipologie e tecniche legislative di tutela penale dei culti dopo il 1992 nei Paesi dell’Est Europa - 5. Alcune sommarie considerazioni.

  7. Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Ce projet tentera de résoudre le problème en menant des recherches sur la façon dont les politiques peuvent favoriser des ...

  8. Reformulation à l’oral et dans le forum Web

    Directory of Open Access Journals (Sweden)

    Eshkol-Taravella Iris

    2016-01-01

    Full Text Available Le cadre du travail réalisé entre dans le domaine de la linguistique de corpus et du Traitement Automatique des Langues (TAL. Les recherches sont fondées sur trois corpus : deux corpus oraux (ESLO1 et ESLO2 et un corpus composé de discussions collectées sur un forum de Doctissimo. Le travail vise à détecter, analyser et comparer la reformulation introduite par trois marqueurs (c’est-à-dire, je veux dire et disons dans le discours oral et le corpus écrit dialogique du Web. L’objectif est d’étudier la raison pour laquelle le locuteur décide de modifier un segment par un autre et de repérer un lien formel entre les deux segments reformulés aux différents niveaux linguistiques (morphologique, lexical, syntaxique, etc..

  9. La construction de la matière le modèle Standard

    CERN Document Server

    Léon, Jacques

    2016-01-01

    Qu'est-ce que la matière ? Voilà une question à laquelle il pourrait sembler facile de répondre car il n'est rien de plus concret que la matière. Et pourtant, la réponse qu'en donne la physique contemporaine est pour le moins déconcertante ! Le concept-même de particules, briques élémentaires de la matière, s'est volatilisé, dissout dans des objets mathématiques abstraits et abscons pour les non-initiés. Plus nos théories sont précises et plus l'image qu'elles nous renvoient est insaisissable. En un siècle, la représentation des particules s'est métamorphosée en nuages de probabilité portés par des champs quantiques régis par des symétries confinées dans des espaces abstraits. Mais dans un même temps, nous avons réussi le tour de force d'expliquer toute cette complexité avec seulement 16 particules… et une seule théorie, véritable construction de notre conception de la matière : le modèle standard. Ce livre tente de guider le lecteur dans le dédale de la physique des particu...

  10. Comprendre l'impunité : le droit à la vérité, à la justice et à des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Comprendre l'impunité : le droit à la vérité, à la justice et à des réparations ... au nom de la souveraineté, de la sécurité, de l'ordre public et de la lutte contre le ... Le Centre de recherches pour le développement international est heureux ...

  11. Publications | Page 94 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, ... Le syndrome... Diamants de guerre — pour en finir. L'important accord international sur les diamants conclu cette année ne portera pas fruits s'il n'est pas ...

  12. Le pompage optique naturel dans le milieu astrophysique

    Science.gov (United States)

    Pecker, J.-C.

    The title of this lecture abstracts only a part of it : the importance in astrophysics of the study of non-LTE situations has become considerable, as well in the stellar atmospheres as, still more, in the study of fortuitous coincidences as a mechanism of formation of emission line nebular spectra, or of molecular interstellar « masers ». Another part of this talk underlines the role of Kastler in his time, and describes his warm personality through his public reactions in front of the nuclear armement, of the Viet-Nam and Algerian wars, of the problems of political refugees... Kastler was a great scientist ; he was also a courageous humanist. 1976 : Les accords nucléaires du Brésil : allocution d'ouverture (19 mars). Colloque sur le sujet ci-dessus. 1976 : La promotion de la culture dans le nouvel ordre économique international, allocution à l'occasion d'une table ronde sur ce thème par l'UNESCO (23-27 juin 1976) ; « Sciences et Techniques », octobre 1976. 1979 : La bête immonde (avec J.-C. Pecker), « Le Matin », 20 mars. 1979 : Appel à nos ministres (avec J.-C. Pecker), « Le Monde », 13 décembre. 1979 : Le flou, le ténébreux, l'irrationnel (avec J.-C. Pecker), « Le Monde », 14 septembre. 1980 : Education à la paix, Préface, in : Publ. UNESCO. 1981 : Le vrai danger, « Le Monde », 6 août 1981. 1982 : Nucléaire civil et militaire, « Le Monde », 1er juin 1982. 1982 : Les scientifiques face à la perspective d'holocauste nucléaire (texte inédit). Le titre de cette communication en résume seulement une partie : l'importance prise en astrophysique par l'analyse des situations hors ETL est devenue considérable, qu'il s'agisse des atmosphères stellaires, ou plus encore, des coïncidences fortuites de la formation des spectres d'émission nébulaires, ou des « masers » moléculaires interstellaires. Une autre partie de cet exposé souligne lele de Kastler dans son époque, et décrit sa personnalité généreuse à travers ses r

  13. La science, la littérature, le rituel: le vrai dire et le plus que mentir

    Directory of Open Access Journals (Sweden)

    Panagiotis Christias

    2005-03-01

    Full Text Available Le scientifique promet la vérité sans être en mesure d'accomplir sa promesse tandis que l'écrivain promet de mentir mais par son mensonge, il fait plus que mentir. Il ne dit certainement pas la vérité, car la vérité n'est pas sa préoccupation première. Voilà comment nous pouvons résumer les deux attitudes, condamnées à un antagonisme stérile par l'attitude positiviste moderne. Compte tenu donc de l'intention fondatrice de la science, de sa promesse donc originaire et fondatrice, la science doit dire la vérité et rien que la vérité. Ce qui, de l'aveu même de cette même science, est impossible. [...] La littérature se permet de reconstruire des mondes par-delà le vrai et le faux. [...] Un récit littéraire ne demande pas la consécration de la vérité, ne demande pas à être suivi parce que vrai, n'impose rien et n'attend rien. Sa vraie destinée est l'errance et sa vraie conscience est celle de sa dissémination. Celui qui renonce à la prétention de vérité renonce en même temps à la volonté de dominer. Dominer signifie créer un espace de vérité dans lequel celui qui énonce la vérité est le maître légitime de ceux qui sont dans le champ de la conception du monde dont cette vérité est la pierre angulaire.

  14. le pommier de cayor, espece emblematique du dallol bosso

    African Journals Online (AJOL)

    usage alimentaire le plus répandu est la consommation crue de la pulpe des fruits frais. Les amandes sont soit consommées crues, soit pilées et utilisées en sauce comme condiments, soit utilisées pour l'extraction traditionnelle d'huile. Le bois de ...

  15. La lutte contre le tabagisme en Afrique : Peuples, politique et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 déc. 2011 ... Le tabagisme se répand rapidement en Afrique subsaharienne sous l'impulsion d'une forte croissance économique et des tactiques publicitaires agressives des multinationales du tabac ; bien que les interventions politiques y soient bien comprises, l'économie politique du contrôle du tabagisme ne l'est ...

  16. Tanzanie | Page 9 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Salaam, le ronflement des 50 machines à coudre est aussi tenace que le vrombissement d'insectes. Les ouvriers cousent des filets bleus, verts et blancs qui ont été tissés sur les métiers de la manufacture. Ces hommes et ces femmes font partie ...

  17. Utilisation des modules ATM pour le projet FP420

    CERN Document Server

    Renaglia, T

    2006-01-01

    Le but de cette note est de résumer les premières caractéristiques de l'intégration de 2 modules ATM pour le projet FP420 (voir note technique EDMS n° 743628) ainsi que la liste des problèmes découverts à ce jour sur l

  18. Livres | Page 18 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  19. Etude sur le Latin dus codex Bobiensis (k) des evangiles

    NARCIS (Netherlands)

    Hoogterp, Pieter Willem

    1930-01-01

    Le manuscrit dus texte, dont nous allons entreprendre l'étude, se trouve à la Biblioteca Nazionale de Turin (G VII 15). Il est universellement connu sous le nom de Codex Bobiensis (k d'après Tischendorf) et contient des parties de l'évangile selon S. Matthieu (I, 1-III, 10; IV, 2-XIV, 17; XV, 20-36)

  20. La grille, le World Wide Web du futur

    CERN Multimedia

    2001-01-01

    De nombreux chercheurs trouvent internet trop lent et limité. C'est pourquoi, ils travaillent sur un nouveau réseau : le Grid. Le Grid permettra de mieux partager les ressources informatiques en réseau (1 page).

  1. Publications | Page 175 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualitatifs.

  2. Georges et le big bang

    CERN Document Server

    Hawking, Lucy; Parsons, Gary

    2011-01-01

    Georges et Annie, sa meilleure amie, sont sur le point d'assister à l'une des plus importantes expériences scientifiques de tous les temps : explorer les premiers instants de l'Univers, le Big Bang ! Grâce à Cosmos, leur super ordinateur, et au Grand Collisionneur de hadrons créé par Éric, le père d'Annie, ils vont enfin pouvoir répondre à cette question essentielle : pourquoi existons nous ? Mais Georges et Annie découvrent qu'un complot diabolique se trame. Pire, c'est toute la recherche scientifique qui est en péril ! Entraîné dans d'incroyables aventures, Georges ira jusqu'aux confins de la galaxie pour sauver ses amis...Une plongée passionnante au coeur du Big Bang. Les toutes dernières théories de Stephen Hawking et des plus grands scientifiques actuels.

  3. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  4. Un incidentalome surrenalien inhabituel: le ganglioneurome

    African Journals Online (AJOL)

    S. Attafi

    Résumé. Le ganglioneurome est une tumeur neurogène bénigne, rare, qui se développe à partir des cellules gan- glionnaires sympathiques. Elle se localise essentiellement dans la région rétropéritonéale. La localisation surrénalienne est rare. Nous rapportons un cas de ganglioneurome surrénalien chez une femme ...

  5. Adoption d'innovations agricoles par le truchement de services ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'agriculture est le fer de lance de nombreuses économies en développement, mais la capacité des petits agriculteurs privés de ressources à adopter des innovations agricoles est freinée par le manque d'accès à des services financiers adéquats. Des experts internationaux estiment qu'il existe un manque à gagner ...

  6. Vers une plus grande collaboration régionale — le CRDI appuie le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Richard Fuchs croit que les gens qui veulent comprendre comment le monde évolue devraient jeter un coup d'oeil à la vague de transformations qui déferle sur ... Bien qu'ils aient souvent de la difficulté à se démarquer face à la véritable dynamo économique qu'est la Chine, des pays tels que le Laos, ...

  7. Lele de l'énergie dans le développement rural | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 oct. 2010 ... L'énergie est sans aucun doute l'un des principaux moteurs du ... de ses recherches sur l'énergie, l'environnement et le développement rural. ... Durban, Mumbai et Rio illustrent la croissance rapide et la transformation qui a ...

  8. Le modèle judiciaire libéral mis à l’épreuve : la surveillance des juges sous le Directoire

    OpenAIRE

    Berger, Emmanuel

    2007-01-01

    La justice du Directoire est principalement identifiée aux différentes violations infligées par le gouvernement afin de contrôler le pouvoir judiciaire et durcir la répression criminelle. Cette représentation est, en réalité, partiale. L’auteur tente de le prouver à travers l’analyse d’un aspect essentiel du système judiciaire directorial : la surveillance des juges. L’étude des normes et des pratiques montre que le mode de surveillance établi par le code des délits et des peines respecte la ...

  9. LE LIEN ENTRE FINANCE ET ECONOMIE ISLAMIQUES VIA LE MODELE PRINCIPIEL "ZR"

    OpenAIRE

    BELABES, ABDERRAZAK

    2010-01-01

    A l'heure où certains évoquent l'intégration de la finance islamique à la finance globale, et d'autres rattachent la finance islamique à des thèmes en vogue telles que la finance éthique, la finance participative ou la finance socialement responsable, le présent papier explore le lien entre finance et économie islamiques à partir du modèle principiel "ZR", c’est-à-dire "Zakât" et "Ribâ". Ce modèle montre que les principes invariants de Zakât et Ribâ jouent un rôle central dans l’établissement...

  10. Lele du pharmacien dans la fécondation in vitro

    OpenAIRE

    Hannoun , Odélia

    2017-01-01

    La procréation médicalement assistée regroupe plusieurs techniques venant en aide aux couples ayant des difficultés à concevoir. Environ 15% des couples en age de procréer consultent pour une difficulté à concevoir. Ce véritable problème de société nous incite à réfléchir sur le role que tient le pharmacien en tant que professionnel de santé dans le parcours de fécondation in vitro. Le pharmacien développe une relation étroite avec les patients au comptoir. Il est la pour expliquer le traitem...

  11. La spermiation chez le brochet.

    Directory of Open Access Journals (Sweden)

    DE MONTALEMBERT G.

    1980-01-01

    Full Text Available L'évolution quantitative et qualitative de la production de sperme au cours de la période de spermiation a été étudiée chez des brochets maintenus en captivité dans un étang de 400 m2. Le sperme est prélevé toutes les semaines à partir du début de février, et pendant près de 2 mois. La quantité de sperme recueillie est très faible et présente de fortes variations individuelles ; elle augmente progressivement jusqu'à la 5me semaine et décroit ensuite. La quantité moyenne de sperme récoltée par mâle est de l'ordre de 0,7 ml/semaine et varie considérablement d'un mâle à l'autre (0.07 à 1,5 ml. La concentration du sperme en spermatozoïdes varie entre 18 et 25 milliards par ml ( X = 21,5 109 + 2,11. La quantité de spermatozoïdes récoltée par semaine est de 28,5 106 + 26,4/kg de poids corporel. La qualité du sperme appréciée par l'intensité et la durée de motilité suit une évolution similaire à celle de la quantité de sperme récoltée avec des valeurs maximales à 4 semaines et minimales en début et fin de période de prélèvement. Les premières ovulations détectées sur des femelles stockées dans les mêmes conditions que les mâles ont été observées à la 6me semaine de prélèvements alors que les performances de spermiation avaient déjà fortement déclinées. Il est vraisemblable que les conditions expérimentales particulièrement traumatisantes pour les mâles ont affecté prématurément la spermiation, amplifiant ainsi le décalage fréquemment observé entre les périodes de spermiation et d'ovulation.

  12. Quand la musique donne le ton

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2017-01-01

    Le lycée Sainte-Anne de Copenhague est un établissement réputé pour les résultats de ses élèves et pour être le foyer d’une intense tradition chorale et musicologique. L’article interroge les parcours de 32 élèves d’une même classe, tous reçus au baccalauréat 2014 avec une option musique et mathé...... de comprendre cette coexistence entre musique et éducation, la relation entre « individu » et « communauté » est examinée et la notion de « culture » désigne le point d’articulation qui peut rendre compte de la dynamique pédagogique en question....

  13. Le Peer to Peer: Vers un Nouveau Modèle de Civilization

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu'il s'agit d'une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d'un nouvel imaginaire social, et possède le potentiel de devenir le pilier d'un nouveau mode d'économie politique, voire d'un nouveau type de civilisation. Pour cela, nous allons d'abord définir le P2P, décrire en bref ces manifestations, et le différencier d'autres modalités d'échange intersubjectif tel que le marché, la hiérarchie, l'économie du don.Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n'est ni géré par un mode hiérarchique ou par l'état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun.Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l'échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding.En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants.

  14. Con la testa fra le nuvole

    Directory of Open Access Journals (Sweden)

    André Greboge

    2015-06-01

    Full Text Available Partitura de Con la testa fra le nuvole, composta em 2015 para piano e harpa de pedais. Este memorial apresenta as notas sobre a obra e a organização do processo composicional, baseada em um insight composicional a partir da ideia de complexidade apresentada por James Tenney em Meta Meta-hodos (1988.

  15. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  16. AcEST: DK947961 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria

  17. AcEST: DK949890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le

  18. Savoir gérer le mal

    Directory of Open Access Journals (Sweden)

    Michel Maffesoli

    2015-09-01

    Full Text Available Le sens commun, conservatoire immémorial de la sagesse humaine « sait », de savoir incorporé, que le mal, l’ombre, la mort, la douleur sont des caractéristiques essentielles de l’existence en son entièreté. Dès lors les créatures quelles qu’elles soient, sont des manifestations de la vie et, dès lors, méritent une attitude « compassionnelle », fraternelle, parce qu’ensemble elles constituent le flux vital. C’est ainsi que l’on peut comprendre l’utilité sociale de ces divers « mondes intermédiaires » que sont les croyances, religieuses ou philosophiques, au « double », au « daimon », aux esprits et autres figures tutélaires ou effrayantes. Elles aident à vivre, au jour le jour, la souffrance en la communalisant.

  19. galaxieEST: addressing EST identity through automated phylogenetic analysis.

    Science.gov (United States)

    Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M

    2004-07-05

    Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and

  20. Le tourisme alpin

    Directory of Open Access Journals (Sweden)

    Andrea Macchiavelli

    2009-06-01

    Full Text Available La forte croissance qu’ont connue les pays alpins dans les dernières décennies a surtout été fondée sur l’offre des activités du ski, avec comme conséquence, un massif développement immobilier, la multiplication d’infrastructures et l’extension des domaines. Aujourd’hui, le marché du ski semble arriver à saturation, la Convention alpine a mis un frein à la poursuite du développement des domaines skiables et on observe donc avec intérêt la diversification de l’offre soutenue par l’innovation. Après avoir rappelé les facteurs de changement en cours les plus significatifs dans le tourisme montagnard, l’article présente une grille interprétative de l’évolution des destinations touristiques alpines, identifiant les phases qui ont caractérisé son développement. Puis il propose une réflexion sur certaines conditions qui peuvent favoriser l’innovation dans le tourisme alpin, ainsi que sur les contradictions qui les accompagnent souvent. Dans la plupart des cas l’innovation est le résultat d’un processus qui a été lancé et qui s’est développé au sein de la communauté alpine, souvent favorisé et soutenu par des institutions nationales et internationales, et grâce auquel les difficultés structurelles qui ont déjà été abordées précédemment ont pu être surmontées avec succès.The spectacular increase in tourism in the Alps in recent decades has been founded mainly on the boom in skiing, resulting in both strong real estate development and an increasing array of infrastructures and ski runs. Today the ski market seems to have virtually reached saturation point and the winter sports sector needs to diversify its offer through innovation. After a review of the main factors of change in mountain tourism, the paper presents a grid for interpreting the life cycle of alpine destinations, identifying the phases that characterize their evolution. The conditions that may favour innovation in alpine

  1. : tous les projets | Page 112 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le programme de recherche Croissance de l'économie et débouchés économiques des femmes (CEDEF) est une initiative de collaboration entre le CRDI, le Department for International Development du Royaume-Uni et la Fondation William et Flora Hewlett. Région: South Asia, North of Sahara, South of Sahara, United ...

  2. Le modèle fédéral dans le sport français, un principe fondateur dépassé ?

    Directory of Open Access Journals (Sweden)

    Béatrice Barbusse

    2009-06-01

    Full Text Available Dans le sport français, le fédéralisme s’est installé comme une évidence institutionnelle dès la fin du 19e siècle et le début du 20e siècle dans un pays qui pourtant ne se pense pas fédéral. En outre, si son apparition est liée à l’émergence du sport comme nouvelle pratique sociale à côté d’autres pratiques physiques plus traditionnelles, il s’est rapidement imposé comme la pierre angulaire de l’ordre sportif français. Près d’un siècle plus tard, son monopole institutionnel est bousculé voire «concurrencé». Ces constats d’ensemble nous amènent à nous interroger sur les raisons pour lesquelles le sport a épousé le modèle fédéral dans un pays non fédéral, mais aussi sur ses limites actuelles. Est-il encore le modèle approprié aux circonstances contemporaines ? A-t-il toujours sa place dans le système de gouvernance du sport ? Ou bien, a contrario, reste-t-il le dernier rempart légitime face aux excès du sport contemporain (dopage, violence, corruptions, déficits… ? À partir d’une approche socio-historique, il s’est agi dans cet article de reconstruire le fil de la généalogie du fédéralisme sportif tout en s’interrogeant sur ses perspectives. Au delà de la question du fédéralisme, c’est bien celle de la gouvernance du sport contemporain qui est posée.

  3. Le survivant sans le syndrome Schreber

    Directory of Open Access Journals (Sweden)

    Richard Figuier

    2006-09-01

    Full Text Available On a pensé la catastrophe, mais a-t-on suffisamment pensé la survivance et la figure du survivant ? Ce n'est pas un hasard si celle-ci est au centre de Masse et puissance, oeuvre dans laquelle Canetti interroge la « mauvaise » survivance responsable de la poursuite de la logique de guerre. Mais où trouver la « bonne » ? Revenir de la catastrophe ne suffit pas pour être un « survivant authentique », selon l'expression de Kafka. Il faut avoir dépassé, avec Primo Levi et Robert Antelme, l'opposition de la vie comme croissance continue et de la mort comme son horrible contraire, par le don, dans la pauvreté solidaire, de cette vie retrouvée.Hemos reflexionado acerca de la catástrofe, pero ¿hemos meditado lo suficiente sobre la supervivencia y el superviviente? No es una coincidencia si el superviviente es el tema principal de Masse et puissance, obra en la cual Canetti analiza la «mala» supervivencia responsable de la persistencia de la lógica de guerra ¿Dónde sin embargo podemos encontrar la «buena» supervivencia? Superar la catástrofe no es suficiente para ser un «auténtico superviviente», según Kafka. Es fundamental ir más allá, con Primo Levi y Robert Antelme, de la oposición entre la vida, como crecimiento continuo, y la muerte, como su espantoso contrario, mediante la donación de forma solidaria de esta vida reencontrada.Disaster is the theme of many studies, but what about survival and of the figure of the survivor? This issue is central in Mass and power, work in which Canetti questions the “bad” survival, responsible for the continuation of the logic of war. But is there any “good” survival? Coming back from the catastrophe is not enough to be an “authentic survivor”, according to Kafka’s expression. To achieve this, it is necessary to have exceeded, with PrimoLevi and Robert Antelme, the opposition of life as a continuous growth and of death as its horrible opposite, by the gift, in a

  4. Le tennis dans le monde: état et prospective

    Directory of Open Access Journals (Sweden)

    Pierre DUMOLARD

    1989-06-01

    Full Text Available Le tennis est peu ou prou pratiqué dans tous les pays du monde, mais avec de considérables variations d'intensité. Actuellement, ses points d'ancrage se situent dans les pays développés occidentaux et dans l'ancienne sphère d'influence britannique. En tenant compte de l'évolution démographique et économique possible des nations, des projections de pénétration de ce sport sont établies pour l'horizon 2000.

  5. La lipogenèse chez le lapin. Importance pour le contrôle de la teneur en lipides de la viande

    OpenAIRE

    Gondret, Florence

    1999-01-01

    La teneur en lipides d’un tissu est la résultante de plusieurs flux métaboliques (dépôt, synthèse, utilisation). Cet article présente les principales caractéristiques de la synthèse des lipides chez le lapin, dans le muscle comparativement aux tissus adipeux visibles et au foie. Le potentiel de synthèse de novo exprimé par le muscle augmente avec l’âge de l’animal, en parallèle à l’accumulation des triglycérides dans les adipocytes intramusculaires. L’activité des enzymes qui fournissent le N...

  6. Rutebeuf entre le temps de l'église et le temps du marchand

    Directory of Open Access Journals (Sweden)

    Miha Pintarič

    1994-12-01

    Full Text Available La poésie de Rutebeuf, comme l' observe M. Zink, est une poésie religieuse, vu que l préoccupation du salut y est omnipresénte. Elle est religieuse à une époque qui donne de nouveaux contenus aux anciennes valeurs, ouvrant de nouvelles voies qui peuvent mener au salut spirituel qui reste le but suprême de la vie humaine. Une idée des plus importantes, en ce qui concerne ce changement, c'est l'idée de travail.

  7. 149 Résumé Notre article se propose d'analyser le travail des ...

    African Journals Online (AJOL)

    8 juil. 2008 ... ... la dynamique de l'économie informelle, c'est le rapport à la loi qui est décisif… » ... qui très souvent, pour ne pas dire systématiquement, attire le con- sensus chez ceux qui .... des secteurs modernes…» (A.Invernizzi.

  8. Le limus rédempteur de Andrej Tarkovski

    Directory of Open Access Journals (Sweden)

    Paolo Mottana

    2015-04-01

    Full Text Available Le cinéma de Tarkovski est riche de présences symboliques. L'essai rend, à travers le contact prolongé et fidèle aux différentes oeuvres du metteur en scène russe, la constellation de ses éléments archetipiques et de ses figures les plus significatives. Le dialogue terre-eau, le travail du feu, la récurrence de l'arbre, du bois, de l'enfance, le flux lent du temps, la phenomenologie poétique de la maison. Dans le cinéma de Tarkovski on se perd, son oeuvre, un vrai opus magnus alchimique, est un voyage dans la survivance d'un halètement mystique profondément incarné dans la matière terrestre. Son parcours circulaire, de l'arbre brûlé d'Ivan à ce qui renaît à la fin du Sacrifice miraculeusement, c'est une cheville fondamentale pour pouvoir expérimenter la puissance de l'imagination créatrice quand encore elle est l' expression d'une sensibilité inspirée à l'âme du monde".

  9. Le vide univers du tout et du rien

    CERN Document Server

    Diner, Simon

    1997-01-01

    Pourquoi l'Univers plutôt que le vide ? Le temps et l'espace existent-ils en l'absence de l'Univers ? Que reste-t-il quand tout est enlevé ? Pourquoi quelque chose plutôt que rien ? Depuis des siècles, ces interrogations mobilisent philosophes et physiciens. Mais aujourd'hui, le vide n'est pas le rien. Il serait même l'acteur central de l'histoire de la matière et de l'Univers, le partenaire privilégié de la physique. Vide et matière ne sont plus deux manifestations séparées de la nature, mais deux aspects d'une même réalité. Le vide est l'état de base dont la matière émerge, sans couper son cordon ombilical Le vide comme Univers du rien cède la place au vide comme Univers du tout. Que le vide puisse être conçu par les physiciens comme réservoir potentiel d'univers, voici qui ne devrait laisser personne indifférent. Ce livre ouvre un débat et nous convie à une réflexion surprenante.

  10. Le voyageur et le touriste

    Directory of Open Access Journals (Sweden)

    André Rauch

    2011-06-01

    Full Text Available Les guides qui paraissent dans la première moitié du XIXe siècle, en langue allemande, anglaise et française, ont introduit des usages. Ils ont défini une manière de voyager, arrêté les itinéraires et indiqué les sites ou les lieux qu’il convenait de visiter. Lorsque paraissent les guides pour automobilistes au début du XXe siècle, la route permet d’autres formes de vagabondage, dont la gastronomie est un exemple illustratif. Dans les années soixante-dix, les nouveaux guides ont suscité d’autres curiosités, ils ont aussi indiqué au touriste les budgets qui leur permettraient de s’orienter dans la consommation touristique.Guides published during the first half of 19th century, in German, English and French languages have introduced some customs. They have defined a way of travelling, made up the routes and indicated the places and settings one has to visit. When guides for motorists are published at the beginning of the 20th century, the road allows other forms of wandering, among which gastronomy is an illustrative example. During the seventies, the new guides aroused other curiosities, they also indicated to the tourists the budgets that would allow them to find their way inside tourist consuming.

  11. AcEST: BP915632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 31 2.6 sp|P03186|TEGU_EBV Large tegument protein OS=Epstein-Barr virus ... 30 3.3 sp|Q9E7N7|VP4A_LNYV Phosphoprotein OS=Lettuce...E7N7|VP4A_LNYV Phosphoprotein OS=Lettuce necrotic yellows virus GN=P PE=2 SV=1 Le

  12. AcEST: DK962367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 2e-06 tr|O81529|O81529_MESCR Metallothion...DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Le

  13. AcEST: DK950504 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9|NETR_PONPY Neurotrypsin OS=Pongo pygmaeus GN=PRSS12 PE... 25 3.5 sp|A1VRP1|T23O_POLNA Tryptophan 2,3-dioxy...in OS=Pongo pygmaeus GN=PRSS12 PE=3 SV=1 Length = 877 Score = 25.4 bits (54), Expect(2) = 3.5 Identities = 1...+LE+ +R+ Sbjct: 444 DQNLSQCKDEAHLSANNLEDAHRK 467 >sp|Q5G269|NETR_PONPY Neurotryps

  14. AcEST: DK956784 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tolB OS=Rhizobium leguminosarum bv.... 38 0.042 sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (s...PDGARVSFES 309 >sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (strain Mtu5) GN=tolB PE=3 SV=1 Le

  15. Économie | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Colour. #2C81B5. Le G8 (Allemagne, Angleterre, Canada, États-Unis, France, Italie, Japon, Russie et Union européenne) est aujourd'hui le principal vecteur politique de la mondialisation. Il est également la force politique qui soutient le plus fermement les institutions multilatérales façonnant la gouvernance économique ...

  16. Les enjeux du modèle standard

    CERN Document Server

    CERN. Geneva

    2008-01-01

    Toute la matière visible dans l'Univers est décrite par le « Modèle Standard ». Selon cette théorie, la matière est constituée d'atomes, qui contiennent des électrons orbitant autour de noyaux, dont les composants fondamentaux sont les quarks. Quatre forces fondamentales agissent entre ces particules élémentaires : les forces électromagnétique est gravitationnelle, et les interactions nucléaires forte et faible. La description fournie par le Modèle Standard de ces particules et de leurs interactions est en parfait accord avec les expériences. Néanmoins, des questions fondamentales restent sans réponse jusqu'à maintenant : d'où vient la masse des particules ? Pourquoi y a-t-il tant de types de particules ? Existe-t-il une théorie unifiée de toutes les interactions ? Quelle est la nature de la matière cachée prédite par les astrophysiciens ? Le LHC au CERN donnera des éléments de réponse à ces questions au-delà du Modèle Standard.

  17. Le CRDI en Colombie

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie la recherche en Colombie dans des domaines tels ... Le CRDI a soutenu des activités de longue haleine qui ont eu pour ... Des travaux subventionnés par le CRDI ont aidé une fondation à intégrer Internet à son programme ...

  18. Le fictif et le réel dans L’Empereur et l’assassin de Chen Kaige

    OpenAIRE

    Giafferri, Xiaomin

    2008-01-01

    Comme tout texte historique littéraire refait l’Histoire en la manipulant, le récit filmique est doublement mensongère du fait de sa double représentation : le décor et les acteurs représentent une situation qui est la fiction, et le film lui-même représente sous forme d’images juxtaposées cette première représentation. Sans vouloir faire la part du réel et de l’imaginaire, le présent travail tente de montrer comment, dans le film L’empereur et l’assassin de Chen Kaige, l’illusion de l’authen...

  19. Processus de construction de la confiance et configuration de contrôle de gestion

    OpenAIRE

    Wafa Khlif

    2000-01-01

    International audience; L'enrichissement de la compréhension du contrôle de gestion par une dimension plus “humaine” a conduit naturellement à l'émergence de concepts “qualitatifs”. La confiance fait partie de ces concepts ignorés dans un contexte instrumental. L'objectif de cette recherche est d'analyser le processus de construction de la confiance relativement aux éléments de contrôle de gestion. En premier lieu, ce travail discute le lien entre le contrôle de gestion et la confiance dans l...

  20. Construire les stratégies avec le Balanced Scorecard:vers une approche interactive du modèle de Kaplan et Norton

    OpenAIRE

    Gérald Naro; Denis Travaillé

    2010-01-01

    (VF)L’objectif de cet article est de confronter le Balanced Scorecard avec le modèle des leviers de contrôle de Simons (1995) et de discuter de son rôle dans les différentes phases du processus stratégique. Nous privilégions une représentation du BSC comme outil de contrôle interactif. Notre recherche est fondée sur une méthodologie longitudinale de type recherche action à partir de l’étude de deux cas. Les résultats montrent que le BSC crée un processus de construction collective favorisant ...

  1. Lele des associations  dans la médiation en archéologie

    OpenAIRE

    Sence, Christophe

    2014-01-01

    Le milieu associatif est connu en France pour son dynamisme et sa réactivité. Il en va de même en archéologie, notamment dans le domaine de la médiation. Si le public ignore bien souvent qu’une association se cache derrière le lieu qu’il vient de visiter, nombreux sont les sites archéologiques, toutes périodes confondues, dont la mise en valeur est entièrement assumée par une telle structure. Dans ce cadre, tout est envisageable, de la simple ouverture pendant les Journées européennes du patr...

  2. Le theatre d'Afrique noire francophone: un art tourne vers le ...

    African Journals Online (AJOL)

    Cette étude a pour objectif de porter un regard analytique sur le théâtre d'Afrique noire francophone, depuis les années d'indépendances jusqu'à nos jours, afin de mettre en relief sa contribution au développement du continent. Il est à remarquer, en effet, que ce théâtre, dans son cheminement, est essentiellement un ...

  3. Le citoyen rieur

    Directory of Open Access Journals (Sweden)

    Anna Rycman

    2009-11-01

    Full Text Available Dans la Pologne d’aujourd’hui, l’évolution des modèles d’engagement civique et politique s’opère plus particulièrement auprès des jeunes générations. Parmi les expériences nouvelles de participation politique, les nouvelles technologies de l’information et de la communication offrent des opportunités radicales de reconfigurer l’espace public. La jeunesse polonaise investit en masse le Web. Dans le flux de paroles affranchies circulant et dialoguant dans le cyberespace, nous nous intéressons ici au développement d’un discours qui emprunte au registre de la dérision et de la satire politiques. Une multitude de sites critiques, de nature apparemment contestataire, des sites d’opposition fondés sur le genre satirique, ont émergé comme réponse apportée à la situation politique. Cet espace public électronique représente une forme moderne de « folklore politique », contribuant au processus de socialisation des jeunes citoyens polonais.The laughing citizen. A modern form of civic commitment in democratic Poland?In present day Poland, the evolution of civic and political commitment models is above all the affaire of the younger generations. Among the current opportunities for political participation, the new information and communication technologies offer radical opportunities to reconfigure the public arena. Polish youth are flocking to the Web. Amongst the flux of frank points of views circulating and dialoguing in cyberspace, our interest here is the development of a discourse inspired by political and satirical derision. A multitude of critical, apparently anti-establishment, sites and general opposition sites using the satirical style have emerged as a response to the political situation. This public electronic space represents a modern form of « political folklore », contributing to the socialising processes of young polish citizens.El ciudadano que rie. ¿Nueva forma del compromiso cívico en la

  4. Le devenir actif du corps affectif

    Directory of Open Access Journals (Sweden)

    Pascal Séverac

    2005-09-01

    Full Text Available Le but de cet article est de saisir ce que signifie, pour le corps, être actif. À partir de la proposition 49 de la partie IV de l’Éthique, on propose de distinguer deux manières d’appréhender le corps – soit comme corps organique, soit comme corps affectif -, et l’on montre que la question éthique du devenir actif s’adresse à la dimension affective du corps. Il faut penser le devenir actif du corps affectif comme augmentation de son aptitude non seulement à affecter, mais aussi à être affecté. En effet, être affecté pour le corps n’est pas identique à pâtir : au contraire, plus est grande l’ouverture sensible d’un corps aux autres corps, plus est grande son activité éthique.The aim of this paper is to understand how the body can be active. With the proposition 49 of the fourth part of Ethics, two ways of conceiving of the body are distinguished : like an organic body or like an affective body. The ethics question of becoming active is about the affective body. This becoming active must be understood as increasing of the ability to affect, as well as to be affected. To be affected is different from to be passive. On the contrary, the more the body is able to be affected, the more he becomes active.

  5. Mesure GPS sur le circuit du LIER à Lyon

    OpenAIRE

    GIRARD, PL; MARAIS, J

    2006-01-01

    Depuis quelques années le guidage immatériel pour les autobus est à l'ordre du jour et la localisation est une des contraintes à son développement. Pour subvenir à ces besoins la solution GPS est envisagée. Cette technologie en devenir comporte énormément d'avantage notamment en terme coût et de maintenance. L'expérimentation faite à Lyon met en évidence les performances maximales pouvant être obtenu en utilisant le GPS. RAPPORT DE CONTRAT

  6. Le cosmos et le lotus confessions d'un astrophysicien

    CERN Document Server

    Trinh, Xuan Thuan

    2011-01-01

    Que nous dit vraiment la science sur la nature de l'univers, sur son origine et son avenir ? Par quel mystère le langage mathématique, pure création de l'esprit humain, se révèle-t-il aussi performant pour nous décrire les phénomènes physiques, de l'infiniment petit à l'infiniment grand ? S'il existe un ordre du monde, ce que nous en disent la physique quantique et la théorie de la relativité est-il compatible avec ce qu'enseigne le bouddhisme ? Et que peut-on en conclure concernant notre propre vie ? A ces questions passionnantes et à beaucoup d'autres, le célèbre astrophysicien Trinh Xuan Thuan répond ici d'une façon personnelle, en s'appuyant sur son expérience. Son itinéraire l'a placé d'emblée à la confluence de trois cultures : issu d'une famille de lettrés vietnamiens imprégnée de traditions bouddhiste et confucéenne, il a reçu une éducation à la française puis une formation scientifique à l'américaine. Une telle richesse de points de vue lui permet d'apporter, non pas de...

  7. Charabias et magiciens dans le théâtre des xiie-xiiie siècles

    OpenAIRE

    Revol, Thierry

    2014-01-01

    S’intéressant à l’imaginaire médiéval, Jacques Le Goff a mis en valeur trois domaines dans lesquels se manifeste le merveilleux. Le mirabilis correspond au merveilleux pré-chrétien, le magicus au surnaturel maléfique et satanique, et enfin le miraculosus au surnaturel chrétien. Dans la logique chrétienne, le dernier tend à repousser les deux autres dans le domaine de la superstition, ce qui, paradoxalement, légitime leur existence, puisque celle-ci n’est pas niée. Miraculosus et magicus appar...

  8. Le modèle standard de la physique des particules de l'électron au boson de Higgs

    CERN Document Server

    Samueli, Jean-Jacques

    2013-01-01

    Le modèle standard de la physique des particules est une théorie qui décrit les constituants élémentaires de la matière et les interactions qui existent entre eux. Le présent ouvrage est un exposé du développement historique de ce modèle qui suppose que toute la matière est composée de quarks et de leptons, particules ponctuelles de spin 1?2. On dénombre trois générations de quarks et autant de leptons. Les interactions faible, forte et électromagnétique sont, pour leur part, décrites par des théories de jauge dont la médiation est effectuée par des quanta de jauge de spin 1. Ces médiateurs sont les ? , W + , W ? , Z ainsi que huit gluons. La gravitation est par ailleurs analysée dans l'ouvrage dans sa formulation classique et relativiste. Enfin le mécanisme dit de Englert-Brout-Higgs prévoit des particules de spin zéro, correspondant à un champ scalaire qui est supposé donner une masse aux quarks, leptons et aux bosons vecteurs intermédiaires W + , W ? , Z . Nous décrivons ce m�...

  9. Le don gratuit. Le cas d'un établissement public

    OpenAIRE

    Barel , Yvan; Frémeaux , Sandrine

    2008-01-01

    Disponible en ligne : http://www.annales.org/gc/2008/gc94/barel.pdf; La logique de la réciprocité est le cadre d'analyse dominant de la relation de travail. La logique du don/contredon s'inscrit dans ce même cadre de référence, en postulant qu'aucune relation d'échange ne peut survivre à une situation d'asymétrie trop forte (MAUSS, 1924). Mais elle ajoute une idée nouvelle en mettant en exergue le " tabou du calcul " (BOURDIEU, 1980) : le désir de contredon n'est pas toujours manifesté, ni mê...

  10. AcEST: BP920221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nition sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens Align le...ficant alignments: (bits) Value sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associ... 42 5e-05..... 29 6.3 sp|Q91820|STK6_XENLA Serine/threonine-protein kinase 6 OS=Xenopu... 29 8.2 >sp|Q9Y4A5|TRRAP_HUMAN Transformation

  11. Le combat contre le tabagisme à l'échelle mondiale | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... ... en effet d'adopter la toute première convention mondiale à porter sur un enjeu de la santé. ... Elle a désormais force de loi dans plus de 40 pays, dont le Canada. ... ce taux est passé de 1 % il y a dix ans à 5 % aujourd'hui.

  12. Le corpus lexicographique dans les langues à tradition orale: le cas ...

    African Journals Online (AJOL)

    rbr

    langues à tradition orale: les informateurs et la représentativité du corpus. Cette dernière, qui doit ..... les techniques, les instruments, la pêche par les hommes, la pêche par .... cet outil indispensable qu'est le dictionnaire. Je pense que ces ...

  13. Luther contre le protocole de Kyoto ou le retour des « indulgences ».

    Directory of Open Access Journals (Sweden)

    Bernard Jouve

    2005-05-01

    Full Text Available Le 16 février 2005 a marqué la mise en œuvre du Protocole de Kyoto. En fait, depuis l’annonce par la Russie, le 25 octobre 2004, de sa décision de ratifier ce protocole, l’affaire était entendue. Menacé depuis le refus des États-Unis, l’un des plus grands pollueurs de la planète, de ne pas le ratifier pour des raisons purement économiques alors que ce pays produit à lui seul 40 % des gaz à effet de serre ( ges , l’accord survenu à Kyoto en 1997 est enfin entériné et ...

  14. Intelligence artificielle et agents collectifs : le modèle EUROSIM

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    2007-07-01

    Full Text Available EUROSIM est un modèle multi-agents conçu pour simuler l’évolution à moyen terme du système des villes européennes. Les agents sont des entités collectives, les grandes villes caractérisées par leur taille et leur fonction dans le système des villes, et dont les interactions (échanges modulés par des relations de proximité ou de réseau déterminent la dynamique relative, tandis que la croissance d’ensemble dépend de l’innovation. Des outils d’analyse multiscalaire ont été développés afin d’interpréter les sorties du modèle et faciliter le calibrage.

  15. Le corps dans l’espace architectural. Le Corbusier, Claude Parent et Henri Gaudin

    Directory of Open Access Journals (Sweden)

    Julie Cattant

    2016-12-01

    Full Text Available Le premier geste de l’espace architectural est d’accueillir nos corps humains. En leur offrant un espacement à habiter, il leur permet de s’abriter, de se mouvoir et de se rencontrer. L’homme et l’architecture s’affectent l’un l’autre. Nombreux sont les architectes qui interrogent cette coexistence car, renouveler la pensée de l’espace nécessite de reconsidérer le corps humain. L’étude des relations entre le corps et l’espace chez trois architectes français sera l’occasion d’évoquer les écarts et les convergences entre l’homme et l’architecture. L’œuvre de Le Corbusier, protagoniste du mouvement moderne, maintient ainsi une distance entre un corps machinisé et un espace idéal. Marquée par un mode de pensée dualiste, l’architecture de Le Corbusier annonce toutefois son propre dépassement, dépassement que Claude Parent et Henri Gaudin opèreront par la suite à leur manière, le premier en introduisant l’oblique et la déstabilisation du corps, le second en transgressant la limite de l’espace et du corps pour envisager leur porosité réciproque. Finalement, c’est la manière dont l’homme appréhende l’espace avec son corps qui est questionnée par ces trois architectes, de la prégnance du visuel à son évincement.

  16. Le surpoids, l'obésité et le contrôle glycémique chez les diabétiques ...

    African Journals Online (AJOL)

    utilisation et du stockage des sucres apportés par l'alimentation, sa prise en charge est ... l'organisation mondiale de santé (OMS), Le contrôle glycémique a été effectué par l'analyse sanguine de l'Hémoglobine glycosylée et de la Glycémie à jeun.

  17. Comment ameliorer la selection et le traitement des messages verbaux? (How to Improve the Selection and Processing of Verbal Messages)

    National Research Council Canada - National Science Library

    Rivenez, Marie; Darwin, Chris; Guillaume, Anne

    2005-01-01

    L'objectif de cette recherche est d'ameliorer la selection des messages verbaux. Nous cherchons a determiner les facteurs influencant le traitement d'un message verbal lorsque l'attention est portee sur un autre message...

  18. AcEST: DK948090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available erase A OS=Aspergillus tubingen... 50 1e-05 sp|P0C1S9|DGLB_RAT Sn1-specific diacy...|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces ce... 50 8e-06 sp|O42815|FAEA_ASPTU Feruloyl est

  19. Sur le volume élémentaire représentatif de la loi de perte de charge d'Ergun On the Representative Elementary Volume of the Ergun's Law

    Directory of Open Access Journals (Sweden)

    Herrmann H. J.

    2006-12-01

    Full Text Available Diverses expressions permettent de calculer la perte de charge occasionnée par le passage d'un fluide visqueux incompressible en écoulement à travers un milieu granulaire. Ces lois ont toutes une origine phénoménologique et sont obtenues à partir d'expériences réalisées à une échelle macroscopique. L'une d'entre elles, la loi d'Ergun, est couramment utilisée sous une forme locale dans des modèles de couplage fluide-solide pour réaliser le transfert de quantité de mouvement entre les deux phases sans réelle justification. Dans cet article, la simulation numérique directe des équations de Navier-Stokes est utilisée pour calculer les pertes de charge de fluide visqueux incompressible en écoulement à travers un milieu granulaire. Des simulations effectuées pour différents volumes de matériau granulaire permettent de retrouver la loi de perte de charge d'Ergun, de définir un volume élémentaire représentatif et de prouver le caractère local de cette loi. Several expressions can be used to predict the pressure drop caused by a viscous incompressible fluid flow through a granular media. These laws are empiricals and are obtained at macroscopic scale. One of these, Ergun's law, is currently used in a local form to modelling the momentum transfer between fluid and solid. There is not a real justification. In these study, the direct simulation of Navier-Stokes Equation is used to calculate pressure drop caused by viscous incompressible fluid flow through a granular media. Some simulations realised for different volume of granular media allow to find a representative elementary volume and prove the local character of the Ergun's law.

  20. Comment fonctionne l’Univers ? Ce que le LHC peut nous apprendre

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    L'Univers en son enfance était une "soupe" de particules, de plus en plus chaudes (de plus haute énergie) à mesure qu'on remonte vers sa naissance, le "big bang". C'est ainsi que les observations à des énergies de plus en plus élevées nous permettent, par exemple, de nous approcher de plus près de la prime jeunesse de l'Univers et, donc, de mieux le comprendre. L'étude du macro- et du micro-cosme sont une science unique dans laquelle, de façon surprenante, ce que nous comprenons le moins bien est le vide, qui ne semble pas l'être: il existe une différence fondamentale entre le vide et le néant. Le LHC pourrait nous permettre de voir les vibrations de la "substance" du vide, qu'on appelle les particules 'de Higgs'.

  1. Lele de l'IL6 dans le cancer du foie lié à l'hépatopathie métabolique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le cancer du foie est souvent mortel. Il n'existe que très peu d'options de traitement, et il s'agit de l'un des cancers dont l'incidence augmente dans le monde entier. L'obésité ou les maladies métaboliques (comme le diabète et la stéatose hépatique) constituent des facteurs de risque du cancer du foie qui sont mal compris.

  2. Le mal et ses complots imaginaires

    OpenAIRE

    Frankfurter, David

    2012-01-01

    Les récits d’abus rituels sataniques que les médias ont largement diffusés, aux États-Unis et au Royaume-Uni, entre le début des années 1980 et la fin des années 1990, soutenaient le parallèle avec les allégations avancées, durant l’Antiquité et au début des Temps modernes, contre les chrétiens, les hérétiques, les juifs ou les sorcières. Quelle est la nature de ces parallèles ? Cet article examine plusieurs types de modèles convoqués lors de diverses occurrences historiques des peurs panique...

  3. Le harcèlement organisationnel des relations sous emprise

    CERN Document Server

    Guhel, Cécile

    2014-01-01

    Le lien entre harcèlement et emprise professionnelle est bien réel. Il est aussi puissant que destructeur. L'aide extérieure est importante mais la prise de conscience du sujet et sa mise à distance sont primordiales pour le retour à Soi. Un facteur de risque organisationnel est un facteur qui relève de l'organisation et qui comporte le risque ou la probabilité qu'un tel comportement abusif voie le jour et qu'il ait des effets négatifs. Un tel facteur peut également contribuer à la persistance ou à l'aggravation du comportement. En abordant la relation d'emprise sous l'éclairage de différentes théories psychologiques, cela vous permettra d'observer les mécanismes intrapsychiques conscients et inconscients qui sous-tendent les comportements de l'instigateur de la relation d'emprise d'une part, et de sa victime d'autre part. Enfin, à travers trois témoignages, de salariées en poste, vous découvrirez combien la parole sur le travail est importante dans la prise de conscience du processus de de...

  4. Le château et la ville : Angers (XIIIe-XVIe s.

    Directory of Open Access Journals (Sweden)

    François Comte

    2010-02-01

    Full Text Available Le château d'Angers est établi sur un point haut de la ville qui domine la Maine et en contrôle le passage. C'est encore l'un des repères les plus visibles lorsqu'on aborde la ville. Les représentations ont toujours privilégié ce stéréotype d'Angers. Mais cette image est bien postérieure à la construction du château au XIIIe s., qui intervient à une période de rivalité entre le duc de Bretagne et le roi de France. En 1227, la garde de plusieurs villes d'Anjou est confiée au duc Pierre Maucler...

  5. Evolution de la perméabilité d'agrégats de sels sous contrainte liée à des circulations de fluides : dissolution, colmatage, déformation

    OpenAIRE

    Chen , Tao

    1994-01-01

    Le but de ce travail est d'étudier l'évolution de la perméabilité d'agrégats de sels sous contrainte lorsque les fluides circulant dans ces agrégats peuvent réagir avec le solide par des dissolutions et/ou des colmatages. Des essais de circulation de divers fluides à travers des échantillons de briques de sels sous contrainte ont permis de suivre l'évolution de la composition des fluides en cours d'essai. L'évolution des matériaux a été aussi caractérisée en cours d'essai (mesure de vitesse a...

  6. La concurrence des experts. Ou qui a le droit de dire ce qu’est la “traite des blanches” dans l’Allemagne de Weimar Competition Among Experts. Or who has the Right to say what Constitutes “White Slavery” in Weimar Germany

    Directory of Open Access Journals (Sweden)

    Benoît Majerus

    2011-03-01

    Full Text Available A travers une polémique qui éclate en 1929 dans le milieu associatif et social juif de la république de Weimar, cet article s’intéresse à la problématique de la constitution de l’expertise. A l’époque, différents acteurs s’opposent, chacun prétendant avoir la légitimité de “dire la vérité” à propos de la traite des blan­ches en Allemagne. Le “champ de la connaissance”, composé d’auteurs issus des sciences humaines comme Max Kreutzberger, s’oppose au “champ de l’ex­périence”, composé de personnes qui travaillent dans des associations juives et qui essayent d’établir un lien entre traite, prostitution et combat moral. Cette po­lémique constitue un cas d’étude révélateur des tensions qui naissent lors de la construction d’un savoir social sur la prostitution dans l’entre-deux-guerres.Through a polemic which broke out in 1929 in the Jewish associative and social medium of the Weimar Republic, this article looks into the problematic of establishing expertise. At the time, various contending actors each claimed to have legitimacy, “to know the truth” about white slavery in Germany. The “field of savants”, composed of authors issuing from the human sciences - like Max Kreutzberger, were opposed by the “the experimental field”, composed of people working in Jewish associations that tried to establish a bond between slavery, prostitution and moral combat. This polemic is a revealing case study of the tensions which arose in the development of social knowledge on prostitution in the inter-war period.

  7. AcEST: DK954060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954060 CL412Contig1 Show DK954060 Clone id TST39A01NGRL0019_G24 Library TST39 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G24. 5' end sequence. Accession DK95406...s Res. 25:3389-3402. Query= DK954060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_G24, 5' (626 le...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954060|Adiantum ca...TST39A01NGRL0019_G24 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G2

  8. Mel Gibson contre le boulevard Raspail

    Directory of Open Access Journals (Sweden)

    Boris Jeanne

    2007-03-01

    Full Text Available Que peuvent faire les historiens et les anthropologues spécialistes de l’Amérique face à la puissance médiatique et commerciale d’Apocalypto, le dernier film de Mel Gibson, produit par Buena Vista (c'est-à-dire Disney et ayant déjà engrangé plus de 50 millions de dollars de recette avant même sa sortie en France ? Le cinéma est un art du présent, et quelle que soit l’exactitude de la reconstitution historique qu’il prétend parfois présenter, il demeure un puissant vecteur d’analyse de la soc...

  9. Le stéréotype dans le roman policier

    Directory of Open Access Journals (Sweden)

    Marion François

    2009-12-01

    Full Text Available Le roman policier offre à l’étude du stéréotype une grande variété de redondances, lexicales et structurelles, qui permettent d’éclairer le concept même de genre, en fait issu du constat de stéréotypie. Il est également manifeste que contrairement aux idées reçues, les clichés font du texte policier un texte littéraire, parce qu’ils naissent d’images associées, distinctes de la réalité, qui révèlent d’ailleurs le cheminement même de l’écriture. Par ailleurs ces images jouent un rôle fondamental dans le plaisir du lecteur, comme dans les contes de fées de notre enfance. Les clichés ouvrent la porte des fantasmes : le stéréotype rejoignant l’archétype, les clichés policiers réactivent de nombreux mythes, le texte évoquant l’Autre Scène. Le constat de stéréotypie provoque l’écriture, en particulier parodique, et stimule le renouvellement et l’essaimage des clichés dans toutes sortes de textes, qui bénéficieront de la présence du déjà-lu, laquelle donne au lecteur une assise pour affronter l’inconnu et une expérience pour apprécier la nouveauté.

  10. Le travesti dans le théâtre du xixe siècle : une distribution à contre-genre ?

    OpenAIRE

    Khoury, Camille

    2018-01-01

    Quelques-unes des actrices les plus célèbres du xixe siècle ont laissé à la postérité le souvenir de leurs rôles travestis. C’est notamment le cas de Virginie Déjazet – au point que le déjazet est rapidement devenu synonyme de rôle travesti – ou encore de Sarah Bernhardt. Le travesti est alors un spectacle commun sur les scènes académiques françaises – tandis que certains rôles sont écrits pour être joués en travesti, de grandes actrices s’emparent de rôles masculins pour confronter leur géni...

  11. 1. Le Soleil, une étoile dans notre Galaxie

    OpenAIRE

    Vial, Jean-Claude

    2017-01-01

    Par une belle nuit sans Lune (et sans nuages), levons les yeux vers le ciel. L’œil est immédiatement attiré par le cortège d’étoiles brillantes qui a donné son nom à la Voie lactée. Il s’agit en fait d’une galaxie de près de 200 milliards d’étoiles qui abrite notre Soleil et ses planètes, c’est notre galaxie, « la » Galaxie, comme une île dans le vaste cosmos. La Galaxie : ses 150 à 200 milliards d’étoiles sont réparties selon des bras spiraux autour d’un noyau central et pour la plupart conf...

  12. Chapitre 2. Le texte dérivé

    OpenAIRE

    2017-01-01

    Les analyses précédentes indiquent qu’il est difficile de séparer une poétique de l’écriture ou de la réécriture, procès toujours prospectif, de celle du texte. En effet, le texte est aussi le résultat d’une activité poétique. Mais les conceptions de la notion de texte ne sont pas des plus univoques. Appliquées à la réécriture filmique des textes littéraires, elles le sont encore moins. Comment en serait-il autrement ? Le film lui-même, considéré comme production sémiotique, ne semble pas pou...

  13. Le style modal de la science-fiction

    Directory of Open Access Journals (Sweden)

    Emmanuel Boisset

    2013-04-01

    Full Text Available La faiblesse de style dont souffrirait la science-fiction est en fait le signe que la science y est davantage discours du possible que description du réel. Un « style modal » va suspendre la valeur de vérité, et le style de la possibilité va décontextualiser les métaphores disponibles. En science-fiction, le processus métaphorique génère et structure la diégèse. Un exemple chez Iain M. Banks montre un dialogue quasi incompréhensible mettre à l’épreuve la signification comme possibilité. Les métaphores figées sont revitalisées par la décontextualisation de la fiction, dont le texte peut exploiter l’impertinence.

  14. Le dualisme Chipaya

    Directory of Open Access Journals (Sweden)

    1974-01-01

    Full Text Available L’auteur, partant des observations de Métraux sur Chipaya, apporte des idées neuves sur les ayllu constituant le village, basées sur une enquête approfondie et un plan détaillé du village : deux divisions principales apparaissent, celles-ci se divisant a leur tour en quatre ayllu. La chute brutale de la démographie depuis la seconde moitié du XVIe siècle a fait disparaître les 4 ayllu originels mais l’examen des archives permet d’observer un très vigoureux redressement démographique à partir des derniers 150 ans. Ce redressement démographique semble précipiter un nouvel éclatement de la communauté chipaya. El autor partiendo de las observaciones de Métraux sobre Chipaya, aporta sobre los ayllu que constituían el pueblo, basadas en una encuesta profunda y un plano detallado del pueblo: aparecen dos divisiones principales, dividiéndose éstas a su vez en cuatro ayllu. La caída brutal de la demografía desde la segunda mitad del siglo XVI ha hecho desaparecer los 4 ayllu primitivos pero el examen de los archivos permite observar un resurgimiento vigoroso a partir de los últimos 150 años. Este resurgimiento demográfico parece precipitar una nueva explosión de la comunidad chipaya.

  15. Crime Mapping , ou le réductionnisme bien intentionné.

    Directory of Open Access Journals (Sweden)

    Boris Beaude

    2009-05-01

    Full Text Available En 2008, le British Crime Survey fit remarquer que le risque d’être victime d’un crime est au plus bas depuis le lancement de son étude systématique en 1981. Il précisa à cette occasion que cette tendance est observable dans l’ensemble des pays développés. En Angleterre, la criminalité aurait baissé de 39% depuis 1997, dont 40% pour les crimes violents et 55% pour les cambriolages. 2 Ce constat questionne le traitement médiatique et politique de la criminalité qui, ...

  16. Le Service Accueil et Contrôle d'Accès

    CERN Document Server

    Ducastel, C

    1999-01-01

    L'utilisateur qui vient au CERN pour la première fois, est accueilli généralement par les membres du service 'Accueil et Contrôle d'Accès'. Cet utilisateur sera tout d'abord orienté vers un des postes d'hôtesses d'accueil en charge de l'enregistrement et de la délivrance de cartes CERN. Les informations seront saisies et immédiatement disponibles et transmises, via le système AMS, aux équipements de contrôle d'accès et à la Centrale de Surveillance des accès, chargée de la supervision de tout le dispositif de contrôle d'accès au domaine. Ces contrôles aux entrées et accueil des visiteurs individuels sont complétés par des missions de surveillance à l'intérieur du Domaine pour les agents, et par des travaux de gestions de dossiers administratifs (service enregistrement) pour les hôtesses. Un contrat commun assure une uniformité de formation des agents et hôtesses. Ce contrat est assorti d'une clause de Bonus Malus afin de tendre vers une optimisation des performances.

  17. LE SECTEUR INFORMEL EN ALGERIE : APPROCHES, ACTEURS ...

    African Journals Online (AJOL)

    Résumé. Le secteur informel en Algérie est peu étudié de manière directe et .... très diverses que Bernard (1980,1988) a classées en 3 catégories plus ou moins .... sont amenés en raison de l'ambiguïté de la loi et de sa faible appli- cation à ...

  18. LE DÉVELOPPEMENT DÉMOCRATIQUE

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il en est ainsi parce que les normes et les idéaux qui stimulent la recherche scientifique sont également au coeur de la ... les fondements de toute saine démocratie. De même, certaines des recherches appliquées qu'appuie le CRDI peuvent con- .... criminalité et de la violence. En outre, une fois choisi leur propre mode de.

  19. Focus : Le torrent de Faucon (Ubaye

    Directory of Open Access Journals (Sweden)

    Frédéric Liébault, Christophe Peteuil et Alexandre Remaître

    2010-09-01

    Full Text Available Le torrent du Faucon, dans la vallée de l'Ubaye, est connu pour ses nombreux phénomènes torrentiels. Les auteurs nous présentent ici l’étude du bilan sédimentaire du torrent du Faucon à travers l’exemple de la lave torrentielle du 5 août 2003.

  20. Le mélanome malin de la fosse nasale

    Science.gov (United States)

    Rekik, Wafa; Goucha, Aida; Hamdane, Mohamed Moncef; Debbabi, Boutheina; EL May, Ahmed; Gammoudi, Amor

    2012-01-01

    Le mélanome muqueux primitif de la fosse nasale est une tumeur maligne très agressive, rare, constituant 1% de l’ensemble des mélanomes. Sa symptomatologie est non spécifique et son diagnostic est anatomo-pathologique, appuyé par l’immunohistochimie. Son traitement est essentiellement chirurgical basé sur une résection large de la tumeur. Le pronostic est défavorable, caractérisé par des récidives et des métastases fréquentes et un taux de survie bas. Nous rapportons dans ce travail un nouveau cas de mélanome malin primitif de la fosse nasale, tout en précisant les caractéristiques de cette tumeur. PMID:23024827

  1. Afrique subsaharienne | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... d'approvisionnement en eau surchargés sont de plus en plus éprouvés par la croissance galopante des zones urbaines sans compter l'érosion des sols, le rétrécissement des forêts, la désertification et la dégradation des zones humides. Qui plus est, l'épidémie de VIH fait le plus de dégâts en Afrique subsaharienne.

  2. Livres | Page 28 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... la recherche sur des questions essentielles de développement international. ... aux milieux de la coopération au service du développement dans le monde, mais aussi ... Dix ans de réforme : Politique scientifique et technologique en Chine ... Le droit au logement est un droit fondamental de la personne réaffirmé en juin ...

  3. Publications | Page 50 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La prochaine flambée épidémique : se préparer à l'imprévisible. Les maladies infectieuses ignorent les frontières, que ce soit le virus Ebola qui se propage de la Guinée au Liberia, la rougeole qui s'est déclarée dans la vallée du Fraser et dont le virus a été introduit au Canada par.

  4. Publications | Page 56 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cap sur l'Ouest : les Prairies canadiennes, élément essentiel de la lutte contre la faim dans le monde. Il y a plus de vingt ans, Charlie Mayer, exploitant d'un ranch dans le sud du Manitoba et également ministre fédéral de l'Agriculture, est rentré au Canada troublé par ce qu'il avait entendu.

  5. Livres | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Directeur(s) : Gary McMahon et Felix Remy. Maison(s) d'édition : Banque mondiale, CRDI. ISBN: Épuisé. Couverture du livre Des États remaniés : Mondialisation, souveraineté et gouvernance. Des États remaniés : Mondialisation, souveraineté et gouvernance. Le trouble est évident. On le pressent aux échecs quotidiens ...

  6. Publications | Page 51 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... Aux fins de l'élaboration de sa prochaine stratégie quinquennale, le CRDI a organisé... Agents de changement : la philanthropie dans certains pays d'Asie du Sud-Est.

  7. Publications | Page 222 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transport et réduction de la pauvreté : étude de cas sur la contribution du secteur des transports à la réalisation des Objectifs du Millénaire pour le Développement (Burkina Faso) (restricted access). Le Burkina Faso, comme la plupart des pays en développement, est confronté à des problèmes liés à l''aggravation de la ...

  8. Résultats ichthyologiques des voyages scientifiques de Monsieur le Professeur Dr. A. W. Nieuwenhuis dans le centre de Bornéo (1898 et 1900)

    NARCIS (Netherlands)

    Popta, C.M.L.

    1905-01-01

    Dans quelques genres de Cyprinidae, c.-à-d. le Dangila, l’ Osteochilus et le Crossochilus famille des Cyprininae, qui appartiennent à la sousle nombre des écailles de la ligne latérale est plus petit dans les espèces spéciales que dans les espèces anciennes. Le Tylognathus a augmenté ce nombre de 2

  9. Physique ou leçons sur les principes généraux de la nature I

    CERN Document Server

    Aristote

    2015-01-01

    Extrait : ""Or il n'en est pas dans la nature de plus certain ni de plus évident que le mouvement sous toutes ses formes ; et voilà comment la Physique d'Aristote n'est au fond qu'une théorie du mouvement. C'est une étude sur le principe le plus général et le plus important de la nature ; car sans ce principe, ainsi qu'Aristote l'a dit bien des fois, la nature n'existe pas ; elle s'identifie en quelque sorte avec lui.""

  10. Le massacre de la mariée

    Directory of Open Access Journals (Sweden)

    Bastiaan van der Velden

    2016-06-01

    Full Text Available Le Massacre des innocents a été pour Marcel Duchamp l’une de ses sources en composant Le Grand Verre. Ce ‘massacre’ est dans ce cas plus précisément une attraction foraine. D’autre part l’infanticide à Bethlehem constitue un sujet maintes fois représenté par différents peintres. Pour Alfred Jarry, auteur littéraire et de théâtre qui a plus particulièrement inspiré Duchamp, le tableau Le Massacre des innocents de Breughel l’Ancien était une pièce clé qui lui permettait de démontrer pourquoi il rejetait l’art historisant en peinture et dans le théâtre.

  11. Le Bon, Gustave

    DEFF Research Database (Denmark)

    Borch, Christian

    2017-01-01

    Gustave Le Bon (1841–1931) was a French physician and crowd psychologist who published extensively on themes such as crowds, war, race, revolution, socialism, and war. His work on crowd psychology in particular was highly influential, including beyond scholarly circles. Le Bon argued that crowds...

  12. Le développement de projets en Bolivie

    OpenAIRE

    Maes, Sandrine; Maes, Jeremy; Rey, Jean-Charles

    2007-01-01

    Ce mémoire traite des projets, de leur développement. Qu’est-ce qu’un projet ? Comment est-il créé ? Le développement de projet est un domaine complexe. Au fil des pages, nous présentons une définition du projet, ainsi que deux manières différentes de le conduire. Ce mémoire parle également de la Bolivie. Nous y découvrirons une autre culture, une autre manière de penser, d’agir, de vivre. Dans ce travail, nous tentons de mettre en évidence comment le développement de projet s’insère da...

  13. Le genre, variable centrale de la violence sociale ?

    OpenAIRE

    Ayral , Sylvie; Raibaud , Yves

    2010-01-01

    Le but de cet article n'est pas de savoir si le genre est une variable centrale de la violence sociale mais comment cette hypothèse (qui induit la possibilité d'un changement social) est réfutée et quelles connaissances sont mobilisées à cet effet. Il s'agit d'identifier les modèles récurrents mis en œuvre par les « membres » (par exemple la communauté scientifique des sciences humaines et sociales) lorsqu'ils.elles examinent le sens de ces modèles par l'observation de « ce que les gens font ...

  14. Aiutare le vittime della mafia a ribellarsi

    Directory of Open Access Journals (Sweden)

    Roberto Riccardi

    2007-09-01

    Full Text Available Nino Miceli is a Sicilian man, owner of a small business: at the beginning of 1990s he is concessionnaire of cars in Gela, an quite big town in Sicily. He works hard and soon he starts to earn a lot. Business is very good, and customers are satisfied and everything seems to go on successfully. But the mafia keeps an eye on him and, at a certain point, he was asked to pay them what in Italy is called “pizzo”. Nino Miceli does not want to pay it, he does not want to surrender to the mafia coercion. However, at the beginning he pays the “pizzo” but then he starts to record the conversation he has with those men (the “mafiosi”, in order to prove and demonstrate the crime. He also looks for protection at the local station of Carabinieri; finally, he decides to report the extortion but, from that time on, he starts to experience more and more serious threats.Helped by an officer of Carabinieri, he becomes a witness of justice and, for that reason, he must change his identity. He leaves Sicily along with his family and move into a different region of Italy, far from his town, where nobody knows him. In 2007 he decides to write a book of memories, titled “Io, il fu Nino Miceli” (in English it could sound like “I was Nino Miceli”. This article tells his story, speaking also about the role played by the Arma of Carabinieri in supporting victims of racket and usury.Nino Miceli est un entrepreneur sicilien originaire de Realmonte, une ville en province d'Agrigento. Au début des années 90, il est proprietaire du garage Lancia à Gela. Il s'engage beaucoup dans son travail et les résultats ne tardent pas à arriver. La clientèle augmente, les affaires vont bon train, mais c'est justement quand l'entreprise est en train de prospérer que la mafia lui demande des comptes. Il doit payer le pot-de-vin comme tous les commerçants du quartier. Nino Miceli n'est pas d'accord avec cela. Au début il subit, mais il commence bientôt

  15. Le paludisme, le tsunami silencieux d'Afrique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  16. Lele de paysans mieux informés au Bénin | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 déc. 2010 ... Le défi : faire face au chaos climatique. Au Bénin, le secteur agricole constitue environ 36 % du PIB et représente près de 88 % des recettes d'exportation, en plus de satisfaire à la demande locale. Cependant, ce secteur est menacé. Loin d'être la seule cause du sous-développement, les bouleversements ...

  17. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le mariage forcé viole les principes de liberté personnelle et d'autonomie individuelle. Il est considéré comme une violation des droits de la personne aux termes du droit international en matière de droits de la personne. Ce projet produira des données probantes qui aideront à combattre le mariage forcé en Inde ...

  18. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2008-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  19. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2009-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  20. Publications | Page 163 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En Afrique cependant, plus particulièrement pour les femmes vivant en milieu rural, l'accès à l'information est limité. Les nouvelles technologies de l'information et des... Le laboratoire, le temple et le marché : Réflexions à la croisée de la science, de la religion et du développement. Il s'agit là d'un ouvrage fascinant et très ...

  1. Rapports annuels | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapports annuels. Le CRDI publie un rapport annuel dans lequel il présente ses états financiers et ses résultats. Ce rapport met en outre en évidence des chercheurs bénéficiaires de subventions du CRDI et en décrit les projets et les réalisations clés. C'est le principal outil par lequel le Centre rend compte de ses activités ...

  2. Le langage des couleurs dans les films de Zhang Yimou

    OpenAIRE

    Xiaomin Giafferri

    2009-01-01

    Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le so...

  3. Un développement urbain durable et socialement inclusif est-il possible dans le contexte de fragmentation socio-spatiale des métropoles des pays émergents? Réflexions à partir des cas de Recife (Brésil et de Chennai (Inde

    Directory of Open Access Journals (Sweden)

    Carrière Jean-Paul

    2016-12-01

    Full Text Available Dans un contexte globalisé, le développement de villes socialement durables et inclusives implique de nombreux défis contradictoires. L’analyse comparée des cas de Chennai, en Inde, et de Recife, au Brésil, montre qu’au-delà des spécificités de ces métropoles, nous retrouvons des processus de fragmentation socio-spatiale comparables et un réel décalage entre un discours sur l’insertion sociale et des pratiques urbanistiques orientées par la quête d’attractivité, qui se soldent par l’accentuation des inégalités. Ces contradictions renvoient à des conflits entre planification stratégique, jeu des forces des marchés immobilier et foncier, et attentes des populations. L’analyse de ces contradictions invite à repenser l’articulation de la dialectique local/global et à s’interroger sur l’effectivité du « droit à la ville » dans les sociétés de pays émergents. La comparaison développée dans cet article s’appuie sur des recherches menées à Recife dans un premier temps au début de la décennie en cours, puis plus récemment à Chennai.

  4. A Fully Analytical Solution of the Wellbore Stability Problem under Undrained Conditions Using a Linearised Cam-Clay Model Solution analytique au problème de stabilité de puits en conditions non drainées utilisant un modèle de Cam-Clay linéarisé

    Directory of Open Access Journals (Sweden)

    Charlez P. A.

    2006-12-01

    Full Text Available This paper presents a linearised version of the Cam-Clay model fully integrated in the scope of the general theory of poroplasticity. The constitutive law which is developed in the scope of the effective plastic stress concept, only contains two plastic parameters (hardening modulus and slope of the critical state line. To be validated, the model is integrated over homogeneous stress paths (hydrostatic, drained triaxial and undrained triaxal then compared with experimental data issued from conventional laboratory triaxial tests. In the second part, a simplified version of the model is applied to the wellbore boundary problem (vertical well in an axisymmetric horizontal stress field and under undrained conditions. Given the linearity of the constitutive law and the a priori knowledge of the shape of the plastic region, the solution (stress, strain and pore pressure is fully analytical. The solution shows that for an overconsolidated material (overconsolidation degree less than 2 the hoop stress is strongly relaxed in the plastic zone. The higher the compressibility of the saturating fluid, the larger the relaxation of the hoop stress. In terms of stability, the more compressible the fluid saturating the porous medium is, the more stable the well will be. Finally the larger the overconsolidation ratio is, the less stable the well will be. Cet article présente une version linéarisée du modèle de Cam-Clay intégré dans le cadre général de la théorie de la poroplasticité isotherme. La loi de comportement développée à partir du concept des contraintes effectives plastiques ne contient que deux paramètres plastiques (module d'écrouissage et pente de la droite critique. Le modèle est validé sur des chemins de contrainte homogènes (hydrostatique, triaxial drainé et triaxial non drainé et comparé à des essais expérimentaux obtenus à partir d'essais conventionnels de laboratoire. Ensuite, une version simplifiée du modèle est

  5. Les pôles de compétitivité : le recours au modèle des clusters ?

    Directory of Open Access Journals (Sweden)

    Jean Bouinot

    2007-03-01

    Full Text Available Introduction : définition d’un cluster En novembre 2004, le gouvernement a lancé un appel d’offre pour structurer des pôles de compétitivité que les praticiens français n’hésitent pas à qualifier de cluster, littéralement un rassemblement du type « bouquet de fleurs ». Pour une définition théorique on peut s’appuyer sur une comparaison avec le modèle du district industriel italien (MDII. Le district est spécialisé dans un produit donné (chaussures de sport à Montebelluna, le leader mondial e...

  6. Le projet de station touristique

    OpenAIRE

    Vlès, Vincent

    1996-01-01

    Cet ouvrage traite du savoir-faire du technicien, de l'ingénieur, du directeur d'office de tourisme qui façonne, depuis maintenant près de trois décennies, le territoire local de la production touristique : la station. Il analyse les stratégies, les mises en œuvre, les pratiques de l'aménagement et du développement touristique. Il propose une construction du projet de station, méthode qui est l'aboutissement d'expériences de terrain. Il présente un guide des interventions. Il décrit des modes...

  7. Le Squatteur, le Gentrifieur et le Promoteur. Une leçon de la géographie

    Directory of Open Access Journals (Sweden)

    Laurent Matthey

    2005-03-01

    Full Text Available Posées sur mon bureau : deux photos. Je les regarde. Silencieusement, je les décris et les commente. La première a été prise en novembre 1997. Angle rue Jean-Violette, rue Prévost-Martin, à Genève. On y voit un immeuble, ancien, des échafaudages. Entre cet immeuble et celui qui lui fait face, on a tendu des fanions verts, bleus, orange. Son rez-de-chaussée a été repeint dans une teinte un peu brique. La seconde date d’avril 2005. C’est le même immeuble, presque dix ans plus tard, rénové. Jaun...

  8. Le médicament générique au Maroc: le point de vue du ...

    African Journals Online (AJOL)

    Introduction: Le médicament générique est souvent une origine de préjugés négatifs et de méfiance chez les professionnels de santé et les patients. Ceci pourrait être dû à plusieurs facteurs entre autre le manque des connaissances du patient sur ces médicaments. Le but de notre étude était d'évaluer l'information du ...

  9. Faire la chose « la plus sensée » pour le Canada et pour le monde ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 déc. 2014 ... Je faisais partie de la délégation qui a accompagné dernièrement le gouverneur général du Canada, Son Excellence le très honorable David Johnston, et Son Excellence Sharon Johnston au ... Il avait ensuite a déclaré que ce que le CRDI a fait au Chili, c'est qu'il a permis aux idées de continuer de vivre.

  10. Lele des chefs traditionnels au Ghana : un modèle inspirant ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Avec ses partenaires du Sud, avec aussi le soutien du Centre de recherches pour le développement international ( CRDI ), organisme canadien, Ray a étudié lele des chefs traditionnels au Ghana dans la lutte contre le VIH et le sida. Les collectivités politiques antérieures au colonialisme sont une ...

  11. diversité botanique dans le sud du parc national de taï, côte d

    African Journals Online (AJOL)

    AKA Boko Mathieu

    Contrôle du convertisseur monophasé par réseau de neurones ... pour Tc=T1. Le contrôle de cette puissance n'est donc possible que pour des puissances moyennes comprises entre ces deux valeurs limites. 2-2. Modélisation interne ..... performances de la commande numérique non linéaire utilisée en présentant le cas ...

  12. Accessibilité aux emplois en France : lele de la distance à la ville

    Directory of Open Access Journals (Sweden)

    Mohamed Hilal

    2004-12-01

    Full Text Available L'objet de cet article est de modéliser les niveaux d’accessibilité potentielle aux emplois des communes françaises selon lele de la distance à la ville. Pour ce faire, nous présentons, tout d’abord, un modèle d’accessibilité et la méthode mise en œuvre pour calculer de façon systématique, à partir des données du réseau routier, une matrice des plus courts chemins, mesurés en temps, entre les communes françaises. Ensuite, dans la deuxième partie, ces distances sont intégrées dans le modèle d’accessibilité retenu afin de mesurer la disponibilité potentielle aux emplois selon la distance au pôle urbain le plus proche et selon les principales catégories d’espace du zonage en aires urbaines et de son complément rural. Enfin, la mesure d’accessibilité potentielle est comparée à plusieurs mesures d’accessibilité empirique.

  13. Sous type rare du cancer de prostate: Le carcinome sarcomatoide

    African Journals Online (AJOL)

    A. Qarro

    est essentiellement chirurgical qui peut aller de la simple résection de la prostate jusqu'à l'exentération pelvienne associée ou non à la chimiothérapie ou à la radiothérapie. Le pronostic est très mauvais avec 20% de risque de décès la première année qui suit le diagnostic. Nous rapportons une observation d'un patient.

  14. La communication de recrutement dans le milieu hospitalier

    OpenAIRE

    Medina, Pablo

    2011-01-01

    Le développement de la communication institutionnelle et du marketing au sein des institutions hospitalières est très influencé par les changements qui ont lieu dans le milieu sanitaire. La communication de recrutement est l’une des activités les plus stratégiques dans ce cadre, non seulement parce qu’elle répond à des objectifs organisationnels très précis, mais aussi parce qu’elle contribue au développement du champ de la communication institutionnelle dans les hôpitaux. Mais, pour y réussi...

  15. Enseignement Basé sur les Compétences : Manuel d'Application dans le Domaine des Sciences Agronomiques a L'Université d'Abomey-Calavi

    NARCIS (Netherlands)

    Koutinhouin, B.; Hupkes, M.; Gooijer, de G.; Aho, N.; Windmeijer, P.N.

    2011-01-01

    Le présent manuel est produit dans le cadre du Projet d’Appui au Renforcement des Programmes de Formation et de Recherche en Agriculture à la Faculté des Sciences Agronomiques et à l’Ecole Polytechnique d’Abomey-Calavi, financé par le Gouvernement du Royaume des Pays-Bas (Projet NPT/BEN/146). Il est

  16. Le corps poétique ou la poétique du corps

    Directory of Open Access Journals (Sweden)

    Yvonne Goga

    2007-05-01

    Full Text Available Les réflexions sur la poésie de Valéry sont illustrées dans deux volumes : Album de vers anciens et Charmes. Parmi les images les plus représentatives est celle du corps de la femme. Par l’analyse des images sur le corps de la femme, le but de notre étude est celui de souligner l’un des principes de la poétique de Valéry : la relation entre le monde extérieur, le corps et l’esprit, pour créer le poème et le poète.

  17. Trimming and clustering sugarcane ESTs

    Directory of Open Access Journals (Sweden)

    Guilherme P. Telles

    2001-12-01

    Full Text Available The original clustering procedure adopted in the Sugarcane Expressed Sequence Tag project (SUCEST had many problems, for instance too many clusters, the presence of ribosomal sequences, etc. We therefore redesigned the clustering procedure entirely, including a much more careful initial trimming of the reads. In this paper the new trimming and clustering strategies are described in detail and we give the new official figures for the project, 237,954 expressed sequence tags and 43,141 clusters.O método de clustering adotado no Projeto SUCEST (Sugarcane EST Project tinha vários problemas (muitos clusters, presença de seqüências de ribossomo etc. Nós assumimos a tarefa de reprojetar todo o processo de clustering, propondo uma "limpeza" inicial mais cuidadosa das seqüências. Neste artigo as estratégias de limpeza das seqüências e de clustering são descritas em detalhe, incluindo os números oficiais do projeto (237,954 ESTs e 43,141 clusters.

  18. Bases mécanistiques des effets d'un insecticide agrovétérinaire, le fipronil,et/ou de ses métabolites sur la fonction thyroîdienne chez le rat

    OpenAIRE

    Roques, Béatrice

    2012-01-01

    Le fipronil, insecticide largement utilisé, est un perturbateur thyroïdien chez le rat modulant le catabolisme hépatique des hormones thyroïdiennes. Ses effets chez le mouton, considéré comme un modèle plus pertinent que le rat pour étudier une régulation de la fonction thyroïdienne chez l'Homme, sont plus limités. Le but de cette thèse était de caractériser au niveau hépatique le mode d'action du fipronil sur la fonction thyroïdienne en s'intéressant 1) au rôle potentiel du principal métabol...

  19. Le Peer to Peer: Vers un Nouveau Modèle de Civilisation

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu’il s’agit d’une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d’un nouvel imaginaire social, et possède le potentiel de devenir le pilier d’un nouveau mode d’économie politique, voire d’un nouveau type de civilisation. Pour cela, nous allons d’abord définir le P2P, décrire en bref ces manifestations, et le différencier d’autres modalités d’échange intersubjectif tel que le marché, la hiérarchie, l’économie du don. Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n’est ni géré par un mode hiérarchique ou par l’état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun. Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l’échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding. En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants. Abstract: “Peer to peer” is hypothesized as a new social formation with intersubjective dynamics characteristic of distributed

  20. Clone - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...le URL: ftp://ftp.biosciencedbc.jp/archive/clest/LATEST/clest_clone.zip File size: 660 KB Simple search URL ...ion Download License Update History of This Database Site Policy | Contact Us Clone - ClEST | LSDB Archive ...

  1. En quoi est-ce que cela aidera Veronica ? | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Uganda Post and Telecoms Ltd (UPTL), société d'État. C'est à peu près à ce moment qu'il a accepté le poste de directeur exécutif de la Commission des communications de l'Ouganda (UCC), premier organe indépendant de ...

  2. Identification de Staphylococcus aureus : est-il possible de réduire ...

    African Journals Online (AJOL)

    SARAH

    31 janv. 2014 ... influencer la recherche de la staphylocoagulase libre ? 6027. Identification de Staphylococcus aureus : est-il possible de réduire le volume de plasma de lapin sans influencer la recherche de la staphylocoagulase libre ? Bankolé H.S., Dougnon T.V., Fiogbé E.P., Amoussou A.N., Baba-Moussa L.

  3. 1 1) Pourquoi est-ce que je ne parviens pas à ouvrir les formulaires ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Faites vos calculs avec soin car votre demande pourrait ne pas être admissible.) 6) Existe-t-il une liste de pays admissibles dans lesquels mon établissement ou organisme est autorisé à travailler ou à avoir des partenaires ? Non, le CRDI n'a rien de tel; cependant, il ne soutient des travaux que dans les pays à faible.

  4. Le genre comme rapport d’inégalité sociale dans le discours publicitaire

    Directory of Open Access Journals (Sweden)

    Jean-Claude Soulages

    2016-12-01

    Full Text Available Loin de se réduire à une simple transaction commerciale, une annonce publicitaire est un espace de croyances sur des identités, des rôles et des pratiques sociales. Au même titre que d’autres productions fictionnelles de la culture de masse, elle représente l’une des faces de ce miroir social alimenté par la circulation incessante d’attitudes et de croyances, affichant même s’il s’agit bien souvent pour cette dernière d’un positionnement ludique, un second monde peuplé par nos avatars. La publicité tout comme le fait la fiction télévisée définit l’horizon des possibles d’une communauté donnée. Ce qu’elles réalisent toutes deux c’est l’entrée de l’imaginaire dans le réel. Même si, à partir des années 70, s’opère un lent défigement des stéréotypes sexistes, le publicitaire ne se fera aucunement le porte-parole explicite d’une quelconque lutte féministe, il optera toujours pour une tactique ambivalente de double speak: des effets de décadrage mettant en exergue des situations délibérément décalées ou burlesques (Un homme qui change les couches de bébé! Un clown qui fait la lessive!, mais cristallisant des inégalités de rôles. En jouant tout à la fois sur le défigement et la réactivation des stéréotypes, c’est bien un rôle de passeur et de go between, qu’est assigné le publicitaire en se faisant l’arbitre ventriloque de ces conflits de légitimité et de construction identitaire qui agitent notre modernité.

  5. Descartes, est-ce la France ?

    Directory of Open Access Journals (Sweden)

    Pierre Macherey

    2004-04-01

    Full Text Available Le cas de Descartes présente un intérêt privilégié pour l’examen des conditions dans lesquelles une philosophie vient à être considérée comme représentant un esprit national. Le livre d’A. Glucksman, Descartes, c’est la France, publié en 1987 à l’occasion du 350e anniversaire de la parution du Discours de la méthode, constitue un exemple extrême de ce type d’opération, qui exploite une doctrine en en infléchissant certains enjeux fondamentaux.Descartes’ case is particularly interesting to examine the conditions under which a philosophy comes to the point of being considered to represent a national thought. A. Glucksman’s book, Descartes, c’est la France, published in 1987, for the 350th anniversary of the publication of the Discours de la méthode is an extreme example of that kind of process, which exploits a doctrine inflecting some of its fundamental stakes.

  6. Au-delà de la croissance rapide : combiner le paradoxe et la logique dominante pour un modèle d’hypercroissance durable

    OpenAIRE

    Chanut-Guieu , Cécile; Guieu , Gilles; Tannery , Franck; Dana , Léo-Paul

    2014-01-01

    International audience; Au-delà de la croissance rapide: Combiner le paradoxe et la logique dominant pour un modèle d'hypercroissance durable Résumé : Lorsque la PME est en croissance rapide, les enjeux qu'elle doit relever sont nombreux et exigeants. Ceci est encore plus vrai pour les PME en hypercroissance, dont le rythme de développement les amène à doubler de taille en quatre années. A travers l'analyse longitudinale et multi-méthodes de la constitution d'un groupe de taille moyenne (600 ...

  7. Une façon plus sécuritaire de combattre le paludisme au Mexique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2010 ... Le nombre de cas de paludisme a dégringolé au Mexique — de 25 023 en 1998 (un sommet) à 4 895 en 2001, puis à 1 985 en 2008. Le pays y est arrivé sans recourir au DDT. Aux termes de l'Accord de libre-échange nord‑américain, le Mexique s'était engagé à éliminer graduellement l'utilisation du DDT ...

  8. Économie | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une table ronde sur l'industrie du vêtement en Asie s'est tenue le 26 mars 2015 à Phnom Penh, au Cambodge. Elle était organisée par le Cambodia Development Resource Institute (CDRI) et commanditée par le CRDI. Plus de 45 intervenants de l'industrie du vêtement ont participé à cet événement, notamment des ...

  9. Dynamiques et rôle économique et social du secteur informel des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'économie des pays en développement, africain notamment, est caractérisée par la coexistence d'un secteur formel et d'un autre dit informel. ... Ce projet vise à mieux comprendre le dynamique actuelle du secteur informel des TIC et lele économique et social qu'il joue au Burkina Faso, au Cameroun et au Sénégal, ...

  10. Les implications socio-economiques des parkings le long de la ...

    African Journals Online (AJOL)

    Cependant, ce rôle de transit s'exerce dans un contexte concurrentiel dans la mesure où le corridor togolais, essentiellement routier, n'est pas le seul qui dessert les pays enclavés. Pour faire face à cette concurrence, chaque pays côtier multiplie des opérations de charme afin d'attirer plus opérateurs économiques de ...

  11. [Paragraphe contenant le titre de l'article, style « Titre article »

    African Journals Online (AJOL)

    Jimi Cissoko

    changes climatic, etc. These effects can be measured with the consumption of .... La même remarque s'observe lorsqu'on change de combustible : le foyer mixte modifié à pétrole (Flm0k2,6+) est fermé, il présente ..... déterminer le choix des populations à changer leurs habitudes. Le Tableau 4montre l'évolution des prix des.

  12. Économie | Page 27 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Inde s'est lancée dans un train de réformes au milieu des années 1980. ... (la mondialisation) et le relâchement des mesures de contrôle internes ont sans nul ... Ce livre révèle les voies par lesquelles l'innovation en matière de gestion des ...

  13. : tous les projets | Page 382 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Programme: Gouvernance et justice. Financement total : CA$ 213,300.00. Gestion axée sur la demande en vue de l'adaptation à la rareté de l'eau et aux changements climatiques dans le bassin du Saïss (Maroc). Projet. Le bassin du Saïss est un sous-bassin versant du bassin du Sebou, situé dans le nord du Maroc.

  14. L'action du CRDI — le développement du secteur privé

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    Le CRDI est du nombre. Il reconnaît depuis longtemps la valeur de l'industrie, des échanges et du commerce comme moteurs de la croissance économique. Grâce au soutien concret qu'il a accordé au développement du secteur privé, le CRDI a appris que deux types d'aide peuvent porter fruit : améliorer le con- texte dans ...

  15. Dissection aortique dans le syndrome de Marfan: à propos d'un cas ...

    African Journals Online (AJOL)

    Nous rapportons le cas d'un jeune homme de 30 ans chez qui nous avons fait le diagnostic de la dissection aortique dans le syndrome de Marfan. Il a pu bénéficier d'une intervention chirurgicale à coeur ouvert avec un remplacement de la valve aortique. A ce jour, 30ème mois après l'opération aucune complication n'est ...

  16. Suivre et contrer la circulation de l'information erronée dans le delta ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un des pires incidents violents au Kenya depuis 2007 est survenu le 22 août 2012, lorsque 52 personnes sont mortes à la suite de violences ethniques entre des cultivateurs orma et des membres de la nation pokomo, un peuple nomade, dans le comté du fleuve Tana. Le présent projet de recherche d'une durée de deux ...

  17. La théorie de la diplomatie dans le Saint Empire Romain

    OpenAIRE

    Weber, Wolfgang E. J.

    2016-01-01

    Principes Dans ce que l’on nomme officiellement, depuis 1500 environ jusqu’à sa fin en 1806, le Saint Empire romain de la nation allemande (Heiliges Römisches Reich Deutscher Nation), le développement de la théorie de la diplomatie, autrement dit de conceptions relatives aux diplomates et à la diplomatie, est le fait d’élites soucieuses de mieux comprendre des problèmes posé...

  18. Les voies d'eau de l'espoir | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 déc. 2010 ... Le prochain objectif consistait à procéder au revêtement d'un canal secondaire dans la zone d'irrigation. Comme c'est le cas de tous les canaux secondaires non ... Pour sa part, l'équipe de recherche a versé 51 000 EGP provenant du budget du projet. Le projet d'amélioration du canal a débuté dans un ...

  19. L'apport de l'imagerie dans le diagnostic de la tu- berculose uro ...

    African Journals Online (AJOL)

    D'où le concours de l'imagerie dans le diagnostic et la mise en route du traitement médical. ... tère lombaire selon la technique de Boari. Le ... La sérologie VIH était négative. Les suites ... la recherche de BK (uroculture) s'est révélé positif ; la ...

  20. Liste de vérification Bourse de recherche 2018 pour le CRDI | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Certains numériseurs le feront automatiquement. Cependant, si le vôtre n'offre pas cette possibilité, il existe des méthodes manuelles pour ce faire, qui font appel à Adobe Acrobat, Microsoft Word ou d'autres logiciels. Le CRDI ne fournit pas d'instructions à ce sujet, mais il est possible de trouver des instructions sur Internet.

  1. Le nouveau visage de la philanthropie en Inde | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Connectez-vous avec Nirojan sur LinkedIn. La philanthropie est en hausse en Inde et le phénomène devrait continuer à croître. La nouvelle richesse transforme également le visage des dons de charité et retient l'attention du public. Par conséquent, le nombre de conseillers en philanthropie augmente aussi. La relation ...

  2. Le rêve entendu par les chrétiens de la Communauté Évangélique du Congo

    OpenAIRE

    MANSIANTIMA MIANKENDA , Alain-Fidèle

    2015-01-01

    International audience; Pour Sigmund FREUD, le rêve est une source de connaissance de soi. C'est la « voie royale » de la connaissance de l'inconscient. Selon lui, le sommeil est un état où le dormeur ne veut rien savoir du monde extérieur. Le rêve est donc le gardien du sommeil, c'est lui qui nous permet de rester endormis puisqu'en réalisant les désirs, il supprime le psychisme de ses excitations. Les fidèles de la Communauté Evangélique du Congo, en particulier ceux de la Paroisse de N'dji...

  3. Le CRDI en Afghanistan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Depuis près de 40 ans, le CRDI collabore étroitement avec les chercheurs des pays en développement et les appuie dans leur quête de moyens de créer des sociétés en meilleure santé, plus équitables et plus prospères. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G ...

  4. Le CRDI au Bhoutan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il en résulte des solutions locales, novatrices et durables, qui offrent des choix aux personnes qui en ont le plus besoin et font changer les choses. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter la page. Web du Bureau régional de ...

  5. Le CRDI au Kenya

    International Development Research Centre (IDRC) Digital Library (Canada)

    afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter.

  6. Le CRDI en Jordanie

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... dans les pays en développement afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9.

  7. Le CRDI au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    de ces technologies et tentent de déterminer si un régime de microcrédit pourrait encourager leur adoption. On cherche par cela à accroître la sécurité alimentaire de même que le rendement des cultures de dolique, de sorgho et de mil. □ Menaces pesant sur les moyens de subsistance. Financement octroyé pour le Mali :.

  8. Festivals de cinéma dans le monde arabe

    Directory of Open Access Journals (Sweden)

    Jean-Michel Frodon

    2013-12-01

    Full Text Available Alors que les deux grands festivals « historiques » du monde arabe, Carthage (JCC et Le Caire, sont entrés en décadence, on assiste depuis le début des années 2000 à une véritable explosion du phénomène festivalier dans le monde arabe. Le pays le plus en pointe est le Maroc, quoique de manière contrastée, avec une manifestation de prestige à Marrakech, et une nuée de petites manifestations. Dans les émirats du Golfe, la multiplication des festivals traduit une stratégie de communication plutôt qu’une volonté de développement culturel. Cette stratégie est fragilisée par la concurrence que se livrent les différents acteurs. Dans les autres pays arabes, on trouve une grande variété de situations sous le signe de la dispersion. Pourtant, l’accumulation de festivals (une centaine dans la région finit par avoir des effets d’ensemble, au-delà des buts, moyens et limites de chacun d’eux. Le phénomène festivalier, bien qu’inscrit dans des agendas locaux ou nationaux, génère de manière plus vaste des réseaux générationnels, financiers, de procédures d’expertise, de processus d’interrelation, géographiques mais aussi entre le cinéma et les autres arts ou médias.

  9. Le Kongo de Sony Labou Tansi

    Directory of Open Access Journals (Sweden)

    Céline Gahungu

    2015-02-01

    Full Text Available Les textes inédits de Sony Labou Tansi proposent une réflexion sur l’histoire, et plus singulièrement sur celle du Kongo. Le souvenir du prestigieux royaume apparaît dès les premiers manuscrits, composés au début des années 1970. Loin d’être circonscrit aux écrits de jeunesse, le Kongo surgit sous de multiples formes dans le dédale des textes rédigés au cours des années suivantes. Cette fascination pousse l’écrivain dans une dynamique de recherche esthétique : comment évoquer cet illo tempore mythique sans sacrifier à une historicité convenue ? Comment inventer une écriture en mesure de rendre compte du fabuleux royaume ?L’analyse littéraire ne peut cependant faire fi du contexte politique dans lequel Sony Labou Tansi s’inscrit. Outre sa dimension historique et toponymique, Kongo est un ethnonyme dont l’auteur s’est réclamé. Celui-ci a revendiqué à de nombreuses reprises son appartenance à une identité kongo au point de s’être engagé, à la fin des années 1980, dans les rangs du MCDDI1. Ce discours identitaire et l’adhésion à un parti ethnique ont troublé l’image d’un auteur volontiers perçu comme un démocrate véritable. Est-il possible d’articuler le Kongo littéraire et le Kongo politique ? Le Kongo, dont l’ombre portée apparaît dans les manuscrits littéraires mais également dans les articles et les déclarations politiques, pourrait-il nous aider à saisir les enjeux de l’écriture protéiforme de Sony Labou Tansi ?

  10. Le contrôle de la reproduction chez les poissons.

    Directory of Open Access Journals (Sweden)

    CHEVASSUS B.

    1979-07-01

    Full Text Available L'utilisation de populations monosexes peut permettre d'accroître la rentabilité économique, lorsque la reproduction est trop rapide (aquaculture extensive dans les pays tropicaux ou dans le cas d'espèces où l'un des sexes est plus avantageux (meilleure vitesse de croissance ou maturation plus tardive. Nous avons analysé dans ce papier quatre méthodes permettant la production de populations monosexes. Si l'inversion sexuelle par traitement hormonal ou (a gynogenèse induite (dans le cas d'une homogamétie femelle ne semblent pas directement exploitables, on peut attendre du sexage génétique qui combine ces deux méthodes, des résultats prometteurs. L'hybridation interspécifique peut également conduire à une descendance monosexe dans des cas particuliers.

  11. La culture matérielle enfantine entre le cute et le cool

    Directory of Open Access Journals (Sweden)

    Gilles Brougère

    2012-11-01

    Full Text Available Cet article explore la façon dont on adresse un objet à l’enfant, c’est-à-dire la rhétorique à l’œuvre pour séduire les enfants (et les parents dans certains cas. Si l’éducation peut être présente pour certains produits, domine très largement aujourd’hui une rhétorique du fun, une association de l’objet à l’enfance via le divertissement et l’insertion dans une culture des pairs. Pour partie cet adressage se fait à travers l’utilisation de personnages ou d’univers sous licence qui proposent une rhétorique du fun prête à l’emploi. Mais l’analyse des univers disponibles montre que l’on peut décomposer le fun à travers deux pôles opposés, le cute, dont Hello Kitty constitue un exemple archétypal, et le cool, que Titeuf permet de saisir dans sa logique. A travers la distinction du cute et du cool, il s’agit de contribuer à l’analyse du déploiement contemporain d’une culture du divertissement qui est incorporée aux objets de l’enfance, tout en étant un moyen de capter l’intérêt de ceux-ci.

  12. Établissement d'une plateforme commune de recherche sur le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    épidémie se caractérise par la complexité des sous-types de VIH, est une cible capitale pour la recherche visant à évaluer le vaccin contre le VIH. Cette subvention appuiera l'établissement d'un partenariat réunissant l'Institute of Human ...

  13. La gestion forestière communautaire dans le sud-ouest de Madagascar

    DEFF Research Database (Denmark)

    Casse, Thorkil; Milhøj, Anders

    2012-01-01

    La principale conclusion est que le modèle de transfert de la gestion forestière vers les communautés locales malgaches, du moins dans cette partie du pays, n'a pas modifié significativement l'attitude des villageois vis-à-vis de la conservation de la forêt....

  14. Le rendement du sorgho fera un bond au Soudan grâce à un semoir ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    an dernier le premier prix de l'Innovation Contest in Knowledge Management and Knowledge Sharing in Agricultural and Rural Development in the MENA Region. Ce prix est assorti d'une bourse de 5 000 $. Le WaHIP a été ...

  15. La Collecte de renseignements personnels dans le contexte d'une ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    whoskin

    Le CRDI est assujetti à la Loi sur la protection des renseignements personnels, L.R.C. 1985, c. P-21. (http://www.canlii.org/ca/loi/p-21/). Les renseignements recueillis dans le contexte de votre demande, dont certains peuvent être de nature personnelle, peuvent comprendre notamment ce qui suit : • études et emplois ...

  16. Le développement a un visage et une adresse aux Philippines ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    31 janv. 2011 ... Le barangay, qui est la structure de base de l'organisation administrative, ressemble à un village. D'après le code philippin de l'administration locale, il doit compter au moins 2 000 habitants en zone rurale et 5 000 en zone urbaine. Cellule fondamentale de la planification et de la mise en application des ...

  17. Résultats de recherche | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mars 2018 ... Le programme conjoint canado-israélien de recherche en santé est un programme d'une durée de sept années et d'un budget de 35 millions de CAD, conclu entre le CRDI, l'Israel Science Foundation, l'Azrieli Foundation et les Instituts de recherche en s. Livres.

  18. Nouveau partenariat pour le développement de l'Afrique | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 juil. 2011 ... Devant elle, la promesse d'un avenir meilleur lui est offerte par le Nouveau partenariat pour le développement de l'Afrique (NEPAD), un plan radical qui offre ... Les populations africaines réclament de vraies élections, un débat public plus libre et un gouvernement plus responsable et respectueux des lois.

  19. : tous les projets | Page 413 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    S'attaquer à la marginalisation, à la criminalité et à la violence chez les jeunes - lele du capital social communautaire. Projet. Il est maintenant reconnu que les adolescents ont besoin d'un capital social positif (réseaux sociaux, relations interpersonnelles) pour devenir des adultes productifs et socialement responsables.

  20. Le renforcement des systèmes de santé | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 avr. 2013 ... Avec le soutien du CRDI, Walter Flores et une coalition dirigée par le Centro de Estudios para la Equidad y Gobernanza en los Sistemas de Salud ... Les briques et les clics sont importants; il est essentiel de disposer d'infrastructures convenables et de systèmes efficaces de gestion de l'information.

  1. Incidence de la taxation selon le sexe : améliorer la production de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Incidence de la taxation selon le sexe : améliorer la production de revenus et la ... et de réduire la pauvreté, il est essentiel de comprendre la nature des réformes fiscales ... Le CRDI félicite la première cohorte de chercheuses en science des ...

  2. Le Chien de faïence

    Directory of Open Access Journals (Sweden)

    Marie-Laure Schultze

    2011-11-01

    Full Text Available Marie-Laure Schultze est enseignante-chercheure depuis une vingtaine d'années. Elle a travaillé en Angleterre, au Canada et surtout en France, où elle est actuellement en poste à Aix-Marseille Université. Elle y a ouvert avec une collègue des ateliers (exceptionnellement rares dans les universités françaises de traduction créatrice et d’écriture plurilingue ; ces ateliers sont destinés à leurs étudiants apprenant l’anglais et consolidant le français. En parallèle, et dans les interstices laissés par sa recherche sur la place de l’écriture créatrice dans l’apprentissage des langues et sa famille (un compagnon et trois enfants constituent le noyau de la drupe, elle écrit et publie bon an mal an cahin caha ses textes (de la fiction courte, du théâtre, deux romans en chantier, des histoires pour enfants... sur son blog http://carnetdetextes.wordpress.com/

  3. Hypnose : que se passe-t-il dans le cerveau ?

    OpenAIRE

    Touzet , Claude

    2017-01-01

    The Conversation; L'hypnose est un état de "transe" imposé au sujet qui permet d'obtenir de celui-ci qu'il se conforme aux suggestions qui lui sont faites indépendamment de leur véracité. Par exemple, le sujet n'éprouve pas de douleur alors même que nous savons que ce qu'il subit est douloureux.

  4. Publications | Page 34 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  5. Publications | Page 33 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  6. Publications | Page 29 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  7. Le chaos et l'harmonie la fabrication du Réel

    CERN Document Server

    Xuan Thuan, Trinh

    1998-01-01

    Cette fin de siècle a vu un véritable bouleversement dans notre façon de concevoir le monde. Après avoir dominé la pensée occidentale pendant trois cents ans, la vision newtonienne d'un univers fragmenté, mécaniste et déterministe a fait place à celle d'un monde exubérant de créativité. Le Réel n'est plus déterminé seulement par des lois naturelles appliquées à des conditions initiales particulières, mais aussi moulé et façonné par une suite d'événements contingents et historiques qui peuvent bouleverser la réalité à son niveau le plus profond. Celui du bolide rocailleux venu percuter la Terre il y a quelque 65 millions d'années et responsable de la mort des dinosaures en est un exemple. Les lois physiques ont perdu leur rigidité. Avec l'avènement de la mécanique quantique, le hasard est entré en force dans le monde subatomique. Le monde macroscopique n'a pas été épargné. Avec la théorie du chaos, le hasard et le non-déterminisme ont envahi non seulement la vie de tous le...

  8. Le numérique pour stopper le moulin à rumeurs | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 sept. 2016 ... Au sud-est du Kenya, une information erronée peut se révéler mortelle, mais une organisation canadienne oeuvre à la prevention des conflits. Un projet financé par le CRDI mise sur la technologie des textos pour lutter contre la désinformation et à sauver des vies au Kenya. Cet article fait partie d'une série ...

  9. Des drones survolant le delta | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 nov. 2016 ... Photo prise par un drone survolant la ville de Fuvemeh. Appeaning-Addo et al. 2015. Les vagues balayant le rivage de Fuvemeh, une ville ghanéenne qui est située près du delta du fleuve Volta et que menacent les inondations et l'érosion des côtes. Par Brian Owens, Canadian Geographic. La région du ...

  10. Pour que brûle le feu du changement | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 déc. 2010 ... Créé en 1994, il finance des recherches aussi variées que pertinentes ... Grâce à cette recherche, les consommateurs sont beaucoup plus ... en intégrant politiques et programmes est en partie à l'origine de ce succès. ... un rapport qui lie sans équivoque le tabagisme à la maladie et au décès prématuré.

  11. Le principe d'Anselme : la lecture de l'argument d'Anselme par Charles Hartshorne

    NARCIS (Netherlands)

    Manson, Nadine

    2007-01-01

    Peut-on ou non prouver Dieu? Cette question tire son origine du XI-ème siècle, et plus particulièrement de celui que l'on appelle le << père de la Scolastique>>, Anselme de Canterbury. Le monde a bien changé depuis Anselme. La philosophie n'est plus divine, elle n'est plus qu'humaine. Dieu n'est

  12. Le type et l'authenticité du texte et leur influence sur la compréhension

    OpenAIRE

    Meta Lah

    2004-01-01

    L'objet de cette étude est d'analyser lele du texte dans la compréhension écrite, notamment sous deux de ses aspects: le type et l'authenticité. Le but est surtout pra­ tique: en apprendre plus sur lele du texte pour pouvoir ensuite mieux enseigner et évaluer la compréhension écrite. Dans la pratique pédagogique il arrive souvent que les exercices de compréhen­ sion écrite proposés aux élèves ne les differencient pas assez, ce qui soulève certai­ nes questions sur ce qui est plus facile...

  13. ÉTUDE DE CAS — Costa Rica : Du choix pour le consommateur à l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 déc. 2010 ... La CPC s'est adressée aux parties en cause pour obtenir l'information qui lui permettrait d'évaluer le pouvoir de marché de chacune. Une situation atypique, car normalement, c'est la CPC qui a le fardeau de la preuve, souligne Pamela Sittenfeld, directrice générale de la CPC au moment de l'enquête, ...

  14. Graphite suspension in carbon dioxide; Suspension de graphite dans le gaz carbonique

    Energy Technology Data Exchange (ETDEWEB)

    Roche, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Moussez, C; Rouvillois, X; Brevet, R [Societe Nationale d' Etude et de Construction de Moteurs d' Aviation (SNECMA), 75 - Paris (France)

    1965-07-01

    Since 1963 the Atomic Division of SNECMA has been conducting, under a contract with the CEA, an experimental work with a two-component fluid comprised of carbon dioxide and small graphite particles. The primary purpose was the determination of basic engineering information pertaining to the stability and the flowability of the suspension. The final form of the experimental loop consists mainly of the following items: a light-phase compressor, a heavy-phase pump, an electrical-resistance type heater section, a cooling heat exchanger, a hairpin loop, a transparent test section and a separator. During the course of the testing, it was observed that the fluid could be circulated quite easily in a broad range of variation of the suspension density and velocity - density from 30 to 170 kg/m{sup 3} and velocity from 2 to 24 m/s. The system could be restarted and circulation maintained without any difficulty, even with the heavy-phase pump alone. The graphite did not have a tendency to pack or agglomerate during operation. No graphite deposition was observed on the wall of the tubing. A long period run (250 hours) has shown the evolution of the particle dimensions. Starting with graphite of surface area around 20 m{sup 2}/g (graphite particles about 1 {mu}), the powder surface area reaches an asymptotic value of 300 m{sup 2}/g (all the particles less than 0.3 {mu}). Moisture effect on flow stability, flow distribution between two parallel channels, pressure drop in straight tubes, recompression ratio in diffusers were also investigated. (author) [French] Depuis 1963 la Division Atomique de la SNECMA conduit, dans le cadre d'un contrat avec le Commissariat A l'Energie Atomique, l'etude experimentale d'une suspension de fines particules de graphite dans le gaz carbonique. L'objectif principal est d'obtenir des informations d'ordre mecanique et technologique sur la mise en oeuvre de l'ecoulement de ce fluide diphase. Le circuit experimental comprend principalement: un

  15. Le piano touchant/touché: l'instrument du contretemps chez Gide, le cas du Journal et des Notes sur Chopin

    OpenAIRE

    Zorica Vukušić, Maja

    2011-01-01

    André Gide, romancier, essayiste, critique et traducteur, a été le diariste dont le journal (écrit de 1887 jusqu`à 1949) est imbibé de musique. Gide a aussi été pianiste – amateur (dans le sens barthésien du terme), tout comme Nietzsche, Sartre ou Barthes. Leur proximité nous est donnée dans une sorte de polémique imaginée qui dépasse le discours. Sans doute Adorno et Jankélévitch ont été meilleurs pianistes et meilleurs philosophes de la musique, mais Gide s`est éloigné de la ...

  16. La importancia de la experiencia estética y el arte actual

    OpenAIRE

    Tejada, Jesús

    2003-01-01

    Es imprescindible que la reflexión estética aborde el problema de la crisis del arte actual y que analice las distintas respuestas que en la práctica se le están dando. La renovación del diálogo con planteamientos estéticos tradicionales puede arrojar una nueva luz sobre la actividad de la creatividad artística, al destacar los conceptos de emoción y conocimiento entre otros.

  17. Le fictif et le réel dans L’Empereur et l’assassin de Chen Kaige

    Directory of Open Access Journals (Sweden)

    Xiaomin Giafferri

    2008-12-01

    Full Text Available Comme tout texte historique littéraire refait l’Histoire en la manipulant, le récit filmique est doublement mensongère du fait de sa double représentation : le décor et les acteurs représentent une situation qui est la fiction, et le film lui-même représente sous forme d’images juxtaposées cette première représentation. Sans vouloir faire la part du réel et de l’imaginaire, le présent travail tente de montrer comment, dans le film L’empereur et l’assassin de Chen Kaige, l’illusion de l’authenticité s’établit à travers les mécanismes de la fictionnalisation de l’Histoire. L’observation de leur manifestation est amenée à considérer deux axes principaux : l’organisation du récit et la mise en scène des personnages.

  18. Fluid Flow in Low Permeable, Porous Media Écoulements fluides dans un milieu poreux peu perméable

    Directory of Open Access Journals (Sweden)

    Dutta N. C.

    2006-11-01

    kinetic theory of chemical reaction in which the time-temperature history is provided by the solution of an appropriate heat conduction equation. This model of geopressure has a practical application since it deals with the generation and maintenance of abnormally high fluid pressures over geologic time and impacts the hydrocarbon migration in clastic basins. La migration des hydrocarbures traite du déplacement du pétrole consécutif à l'expulsion des roches mères vers les réservoirs saturés en eau ou à travers des zones perméables créées par des fractures ou des failles. Bien que les principes sous-jacents contrôlant les mouvements de fluides dans les milieux poreux (réservoirs soient bien compris des ingénieurs de réservoir, on connaît moins de choses sur les caractéristiques des écoulements dans les milieux poreux peu perméables, comme les argiles et les schistes. En termes d'écoulement, les paramètres principaux sont la porosité, la perméabilité, et les gradients potentiels des fluides. Pour les argiles et les schistes, ces paramètres sont peu connus; et cependant ce sont eux qui contrôlent les périodes pendant lesquelles les écoulements fluides se sont produits dans les bassins sédimentaires (de 100 à 100 millions d'années. Dans cet article, on examine la dépendance paramétrique des constantes temporelles des écoulements fluides dans les sédiments peu perméables par rapport à leur porosité et leur perméabilité. Dans une première partie, on présente une technique d'étude de l'effet d'un écoulement dans les argiles qui produit la sous-compaction et l'augmentation de la pression de fluide par rapport à la pression hydrostatique normale. On se place dans des conditions d'avant-forage ; la technique utilise la méthode des analyses de vitesse par mise en collection de point milieu commun des données sismiques de surface, et est basée sur le concept développé par Hottmann et Johnson (1965 et Pennebaker (1968. Dans une seconde

  19. René Girard, Le bouc émissaire

    OpenAIRE

    Pailler, Jean-Marie

    2017-01-01

    René Girard est mort le 4 novembre 2015. Un retirage d’une de ses œuvres majeures, Le bouc émissaire, publiée en 1982, a eu lieu vers la fin de ce même mois. Ce retirage d’opportunité nécrologique allait, hélas, s’avérer plus opportun encore que prévu. Entre-temps s’était produite la tuerie du Bataclan, le 13 novembre. Cet événement et la chaîne de ceux qui ont suivi se prêtent à plusieurs lectures. L’une des plus suggestives – et des moins rassurantes – est celle qui fait appel aux rivalités...

  20. Une Analyse de film pour comprendre le racisme

    OpenAIRE

    Rosiejka, Veronica Ann

    2014-01-01

    Il y a une nouvelle vague de racisme ouvert en France. Cependant, c'est un phénomène avec des racines sociales et historiques complexes. Ce mémoire cherche à comprendre le racisme de deux manières : généralement, aussi bien que spécifiquement à la France. Le centre d'attention principal de cette étude est la psychologie du racisme, comment le racisme fonctionne et ses conséquences, éléments qui sont étudiés à travers l'analyse d'une série de neuf courts-métrages,...

  1. Le Bestiaire d'amour de Gustave Flaubert (1)

    OpenAIRE

    Loïc Windels

    2010-01-01

    « Désirer, c'est tuer ». Voilà ce qu’un Ministère de la Prévention fera bientôt imprimer sur le bandeau accompagnant les ventes du second des Trois contes. Du reste, il est certain que sa carte du Tendre empiète quelque peu sur les géographies du Cruel. Qui se penche sur son bestiaire en relève généralement assez vite le caractère symbolique et la couleur pré-freudienne. Flaubert ferait, avec le légendaire médiéval, ce que Freud peu après avec la mythologie grecque. Ces remarques et quelques ...

  2. Le matérialisme scientifique

    Science.gov (United States)

    Meunier, Jean-François

    2004-03-01

    De nos jours, il arrive quotidiennement aux grands hommes d'avoir à fréquenter d'ignorants mortels épris d'une conviction maladive que la science est la grande responsable de tous les maux du monde. Évidemment sans physique atomique, il n'y aurait pas eu d'Hiroshima et sans révolution industrielle, pas de pollution et etc. Cependant, ces accusations envers le progrès technique sont tout à fait injustes, irréfléchies et, j'irai même jusqu'à dire, irresponsables, puisque le calcul, i.e. la planification, même la plus élémentaire, est ce qui caractérise le mieux, pragmatiquement, la société humaine. À mon avis, les problèmes sociaux tireraient plutôt leur origine de sciences sociales irréalistes, qui, concrètment, inspireraient ou serviraient d'alibis à ceux qui détiennent véritablement le pouvoir. Dans cet article, je tenterai donc de démontrer la meilleure véracité et efficacité du matérialisme scientifique. Cette doctrine, dont Mario Bunge est le plus illustre représentant, s'appuy sur les résultats théoriques et expérimentaux des sciences factuelles ainsi que sur l'exactitude logique des mathématiques, utilisées ici comme langage universel de l'expression des idées. Cette conception philosophique qui s'inspire principalement du modèle des théories physiques, stipule que les réalités sociales sont, comme tout autre réalité, matérielles, mathématisables et représentables comme des systèmes en interaction. En fait, le modèle des physiciens ayant historiquement fait ses preuves en matière de testabilité et de cohérence interne est proposé d'être appliquer aux sciences sociales, aujourd'hui scindées des sciences dites pures sous l'inspiration des pseudo penseurs néo-kantiens, phénoménologiques et post-moderne. Cette nouvelle approche permettrait ainsi d'évoluer plus exactement vers une compréhension des bases sociales et biologiques du comportement humain afin de développer une éthique sans cesse plus r

  3. Le travail en évolution

    OpenAIRE

    Alexandre, Marie; Attali, Michaël; Baeza, Carole; Champy-Remoussenard, Patricia; Deschenaux, Frédéric; Deville, Julie; Gonin, Audrey; Guedj-Chauchard, Muriel; Guillemot, Valérie; Hardouin, Magali; Hébrard, Pierre; Labbé, Sabrina; Maillard, Fabienne; Roussel, Chantal; Saint-Martin, Jean

    2014-01-01

    Le travail est une réalité sociale souvent perçue comme « centrale » dans l’organisation de la société et soumise à des « métamorphoses » rapides et permanentes qui se répercutent sur les pratiques éducatives. À l’heure où le chômage et les formes de précarité vont grandissant, où la demande de professionnalisation des dispositifs de formation se fait pressante, des questions complexes pour la recherche en éducation se trouvent posées. Les processus de professionnalisation, s’ils interpellent...

  4. Programme de bourses de recherche sur le changement climatique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une faculté d'adaptation limitée est souvent reconnue comme l'un des principaux facteurs de vulnérabilité aux changements climatiques. Le programme Adaptation aux changements climatiques en Afrique (ACCA) du CRDI vise à aider les sociétés africaines à faire face aux changements climatiques. Cette subvention ...

  5. Livres | Page 27 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... en appuyant la recherche sur des questions essentielles de développement international. ... Dix ans de réforme : Politique scientifique et technologique en Chine ... Knowledge Shared : Participatory Evaluation in Development Cooperation ... Le droit au logement est un droit fondamental de la personne réaffirmé en juin ...

  6. La croissance demographique et son impact sur le developpement ...

    African Journals Online (AJOL)

    La croissance demographique et son impact sur le developpement des grandes villes au ... La ville de Porto-Novo au Bénin n'est pas en marge de cette réalité que ... and the need for improving its framework of life through its development.

  7. Publications | Page 120 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'... ÉTUDE DE CAS — Rosario, ...

  8. Centre de recherches pour le développement international ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Julie Pépin

    employé est un voyageur occasionnel (selon la définition donnée à la section 4); ou ... droit à une avance de déplacement ni à un remboursement des frais ..... incluses dans le coût des billets d'avion à divulguer au public. 14.

  9. Publications | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'.

  10. Asie centrale | Page 35 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Soutien aux processus d'élaboration des politiques de réglementation des biotechnologies en Asie du Sud-Est. Langue French. Read more about Innovation en matière de biocarburants sous le signe de l'inclusion en Indonésie. Langue French. Read more about Toward Inclusive Biofuel ...

  11. Tumelo le Moruo

    Directory of Open Access Journals (Sweden)

    Vuyani S. Vellem

    2015-03-01

    Full Text Available Paleng ya rona batho ba batsho, tumelo ya boKreste e fihlile lefatsheng la rona la Afrika Borwa mmoho le dikgoka tsa ditjhaba tsa boPhirima. BoKreste bo fihlile ka nako ya dintwa tseo mohopolo wa tsona e neng e le ho hapa lefatshe la, batho ba batsho. Ka mantswe amang, rona batho ba batsho, re ile ra qetella re le setjhaba se ileng sa hlolwa, mme lefatshe la rona la nkuwa ka dikgoka. Ka hare ho dikgoka tsena, ho ne ho dutse tumelo ya boKreste. Makgowa a ile are: �A re kwaleng mahlo re rapeleng, rona ra kwala mahlo, mme ha re qeta hore Amen, re bula mahlo, ra fumana lefatshe le nkuwe matsohong a rona ho setse Bibele.� Re ile ra sala le Bibele eo ka yona re lekileng dilemong tse fitileng ho lwana ntwa ya topollo, kapa tokoloho hofihlela selemong sa 1994. Le ha re ile ra fumana tokoloho ka selemo seo, hare so ka re lokoloha ho tsa moruo. E kaba sena se bolela eng mabapi le tumelo ya rona ya boKreste? Segolweng sena re leka ho araba potso ena. Tumelo ke eng ho batho ba sa lokolohang moruong wa naha ya bona? Re lekola pale ya boKreste, tumelo ya batho le maemo a kereke ntlheng ya ho tadimana le tokoloho ka tumelo.Faith and economics. In our history from a black perspective, Christianity arrived through violent conquest from the west. Evidentially, this faith coincided with wars of dispossession and the ultimate defeat of black Africans. It is difficult to separate the violent defeat of black Africans from the arrival of Christian faith. This well-known statement within the circles of black Theology of liberation: When the white man arrived in our land he said, �let us pray and after prayer, when we opened our eyes, our land was taken and only the Bible was left in our hands,� captures the black sentiment of this history. Ironically, it was this Bible that black Africans used to wage their struggle for liberation up to the demise of apartheid in 1994.Nonetheless, political liberation is not enough as the struggle for economic liberation

  12. Le Combat de l’amour divin et de l’amour profane : un ballet de Charpentier pour le collège d’Harcourt

    OpenAIRE

    Demeilliez , Marie

    2014-01-01

    International audience; De l’activité de Marc-Antoine Charpentier au service des jésuites, nous sont parvenus un vaste répertoire religieux ainsi que le célèbre « opéra chrétien » David et Jonathas (1688), l’une des rares partitions composées pour le collège Louis-le-Grand qui soit conservée. Alors que le musicien en fut le maître de musique pendant plusieurs années, l’on sait peu de choses de sa participation aux somptueuses représentations théâtrales dont le collège s’est fait une spécialit...

  13. Le système alimentaire mondial est-il soluble dans le développement durable ?

    OpenAIRE

    Rastoin, J.L.

    2006-01-01

    In a process of world economic domination by an agro-industrial and agro-tertiary food system, the author wonders about the feasibility of an alternative model. The intensive agro-industrial model (financiarized, concentrated, specialized and globalized), allows remarkable results in terms of products prices and safety, but generates negative externalities. In the long term, this model could threat the food equilibrium of the populations and ecological balance of our planet. The concept of su...

  14. Quand le lait devient enjeu social : le cas de la société peule dans le Séno (Burkina Faso

    Directory of Open Access Journals (Sweden)

    Madina Querre

    2003-09-01

    Full Text Available L’intérêt pour le « lait » en tant que sujet de recherche est issu, ici, de questionnements autour de l’allaitement en tant que facteur de transmission du VIH. En effet, la transmission du VIH par l’allaitement représente un important problème de santé publique dans les pays du Sud. La mise en place des programmes de prévention reste un problème complexe qui touche divers domaines dont une partie concerne directement notre discipline, étant d’ordre social et culturel. Les perceptions qui valorisent l’allaitement maternel sont très ancrées dans la plupart des cultures « tradi­tionnelles », mettant en valeur celles du lait. Le lait prend en effet dans la société peule une valeur qui va au-delà de la simple question de l’allaitement, étant présent au cœur même de la structure socio-économique. C’est cet aspect qui constituera le propos de cet article.Le terme Kossam, qui désigne le lait, signifie « ce qui est meilleur ». A la base de l’organisation socio-économique peule, son exploitation révèle une originalité particulière concernant les femmes : c’est le lait qui donne aux femmes la possibilité d’une émancipation sociale et économique. En effet, tel que cela sera développé dans cet article, le lait de vache est la propriété de la femme dès l’instant où elle est mariée ; elle peut alors en disposer selon ses intérêts pour la consommation et/ou la commercialisation. Elle peut donc avoir une certaine marge de liberté dans ses actions sans être sous la tutelle complète de son époux. Le fait même qu’elle en soit propriétaire fait référence à un fonctionnement et à une représentation sociale spécifiques.Le lait et sa productrice, la vache, sont au cœur du fonctionnement socio-économique peul. Le lait est considéré comme étant à la base de l’alimentation ; même si dans les faits l’alimentation est aussi organisée autour du mil. Aussi, envisager le

  15. Des filles en or : lele méconnu des femmes dans les mines ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 oct. 2017 ... C'est là que Mme Nakacho a commencé, il y a trois ans. ... et peu de recherches ont été faites sur les rôles des femmes dans ce secteur. ... pour adapter les lois et les politiques gouvernementales de sorte qu'elles appuient le ...

  16. Bibliographie de l’île de Clipperton – Île de La Passion (1711-2005)

    OpenAIRE

    Jost, Christian

    2008-01-01

    L’île de Clipperton, baptisée « Île de La Passion » par ses découvreurs français en 1711, porte pourtant le nom d’un pirate anglais. Malgré les très courtes périodes d’occupation qu’elle connut au début du XXe siècle et dans les années 1960, son histoire est jalonnée de nombreux écrits. Son intérêt scientifique sur le plan des études environnmentales et les enjeux économique et géopolitique récemment renouvelés conduisent l’auteur à publier ici cette bibliographie de plus de trois cent cinqua...

  17. Storicizzare le teorie psicocritiche

    Directory of Open Access Journals (Sweden)

    Roberto Talamo

    2015-07-01

    Full Text Available Le teorie psicoanalitiche della letteratura, dopo una fase di alterne fortune, sono oggi praticate da una cerchia di adepti sempre più ristretta. Le nuove koinè critico-teoriche tendono infatti a relegare la dottrina freudiana all’interno di un sapere letterario (e non interpretativo o a sostituire ad essa strumenti ritenuti più efficaci nella descrizione della sfera del mentale in letteratura (neuroestetica e neuronarratologia. La proposta storiografica che qui si avanza non vuole prendere parte in questo dibattito pro o contro la psicocritica, ma vuole leggere le proposte di teoria psicoanalitica della letteratura alla luce di una riflessione sul concetto di ibridazione, concetto sul quale queste teorie hanno costruito il loro confronto con i paradigmi teorici di volta in volta egemoni.

  18. Rebelle De Fatou Keita Ou le Combat Feminin Contre la Patriarchie ...

    African Journals Online (AJOL)

    Le combat féministe est un sujet d'actualité dans une Afrique toujours gouvernée par des systèmes phallocentriques qui emprisonnent la femme ou l'enterrent dans la misère. L'écriture, parmi d'autres moyens, est une arme par excellence utilisée dans le combat contre le système patriarcal. L'écrivaine féministe s'en sert ...

  19. A. Bandura. Auto-efficacité. Le sentiment d’efficacité personnelle

    OpenAIRE

    Rondier, Maïlys

    2009-01-01

    Albert Bandura est docteur en psychologie et enseigne à l’université de Stanford (Californie). Il est l’auteur de L’Apprentissage social (Mardaga, 1985). Depuis les années 80, Albert Bandura s’intéresse au sentiment d’efficacité personnelle. Ce concept s’inscrit dans le cadre de la théorie sociocognitive (théorie issue du béhaviorisme et du cognitivisme). Selon cette théorie, le fonctionnement et le développement psychologique doivent être compris en considérant trois facteurs en interaction ...

  20. Être et exister: le cas de La Nausée

    Directory of Open Access Journals (Sweden)

    Maarten van Buuren

    2007-06-01

    Le trajet de La Nausée est un trajet descendant, comparable à Mort à venise. Celui de L’Etre et le Néant est un trajet ascendant comparable à La Montagne magique. Par rapport à L’Etre et le Néant qui décrit l’extase triomphante de l’esprit, La Nausée se dessine comme l’étape précédente: celle de la descente en enfer.

  1. Extrême-Orient | Page 89 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans les couples où seul l'un des partenaires est séropositif pour le VIH (couples sérodiscordants), la prise d'antirétroviraux par le partenaire séropositif peut réduire le taux de transmission du VIH, du moins à court terme. C'est ce qui ressort d'une étude menée par Yiming Shao, titulaire d'une chaire de recherche du CRDI, ...

  2. Recherche pour le développement — Cambodge | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 janv. 2011 ... Après avoir été dévasté par la guerre civile et avoir subi l'occupation étrangère et le règne violent des Khmers rouges, le Cambodge s'est dirigé vers une transition radicale.En vertu des Accords de paix de Paris de 1991, le cessez-le-feu a été instauré, et les Cambodgiens ont été tenus d'organiser des ...

  3. Le Tableau du maître flamand : œuvre/bibliothèque

    Directory of Open Access Journals (Sweden)

    Anne-Sophie Huguet

    2002-11-01

    Full Text Available L’auteur montre le renouveau du roman policier chez Arturo Pérez-Reverte, grâce à une métaphore de la lecture comme jeu d’échecs. En conditionnant lele du lecteur, le jeu acquiert une dimension métaphysique. La frontière entre fiction et réalité est brouillée par les multiples références intertextuelles et à l’iconographie, vues comme les méandres d’une bibliothèque labyrinthique.

  4. Effet-dose de l’acide oléique alimentaire. Cet acide est-il conditionnellement essentiel ?

    Directory of Open Access Journals (Sweden)

    Bourre Jean-Marie

    2000-11-01

    Full Text Available Dans un travail précédent [1] nous avons montré que, globalement, au terme de la période de gestation-lactation chez des rats de 21 jours, la carence alimentaire en acide oléique entraîne une diminution de la concentration en 18:1(n-9; la synthèse endogène ne compense donc pas l’absence d’acide oléique dans les aliments. Afin de déterminer exactement l’effet de la présence et de la concentration de l’acide oléique dans l’alimentation sur la composition en acides gras de divers organes, les huiles végétales commerciales n’étant pas utilisables (car contenant toujours de l’acide oléique, des triglycérides ont été synthétisés par voie chimique et enzymologique; ils ont été formés soit d’acide oléique, soit d’acide alpha-linolénique, soit d’acide linoléique. La détermination de l’effet-dose a été réalisée avec un protocole expérimental portant sur 7 groupes de rats ayant reçu chacun des aliments de composition identique (en particulier au niveau des acides gras indispensables : les acides linoléique et alpha-linolénique mais dont la teneur, variable, en acide oléique était située entre 0 et 6 000 mg pour 100 g d’aliments. Les rates ont été nourries avec les régimes à partir de 2 semaines avant l’accouplement, leurs portées ont été sacrifiées soit à 21, soit à 60 jours. Quand la teneur de l’acide oléique augmente dans les aliments, les principales modifications observées chez les animaux de 21 jours sont les suivantes.– Concernant le 18:1(n-9 : dans le foie, le muscle, le coeur, les reins et les testicules, sa concentration constante (le plateau de la courbe est atteinte aux environs de 4 g d’acide oléique pour 100 g d’alimentation. En deçà de cette dose, la réponse est croissante. Dans le cerveau, la myéline et les terminaisons nerveuses (mais non le nerf sciatique, la teneur en acide oléique reste optimale et constante.– La concentration du 16:1(n-7 diminue

  5. Le zapping, les ethnologues, et leurs Indiens

    Directory of Open Access Journals (Sweden)

    Frédérique Langue

    2005-06-01

    Full Text Available Comme toujours s'agissant des expositions mises en scène au Grand Palais, la présentation est parfaite, impeccable. La mise en valeur des objets venus aussi bien de musées brésiliens qu'européens, et les commentaires qui les accompagnent, orientent le visiteur dans un labyrinthe "exotique" de poteries et d'objets de plume, coupé de temps à autre de documentaires portant sur les rituels amérindiens, chants psalmodiques à l'appui. L'auditoire y semble comme vissé sur place, davantage d'ailleur...

  6. le du Liver X Receptor dans la régulation transcriptionnelle de la lipogenèse

    OpenAIRE

    Ducheix, Simon

    2013-01-01

    Chez les mammiferes, la lipogenese ou synthese de novo des acides gras joue un rôle essentiel a l'homeostasie energetique. Elle est particulierement active dans le foie. Le Liver X Receptor (LXR) est un recepteur nucleaire de classe II qui est implique dans la regulation de l'expression de genes importants dans cette voie metabolique. Au niveau hepatique, LXR regule directement l'expression de certains genes de la lipogenese et aussi l'expression des facteurs de transcription SREBP-1c et ChRE...

  7. Physique ou leçons sur les principes généraux de la nature II

    CERN Document Server

    Aristote

    2015-01-01

    Extrait : ""Définition de la nature : elle est dans les êtres, le principe du mouvement et du repos. Des êtres naturels. L'existence de la nature est évidente ; il n'est pas nécessaire de la démontrer.""

  8. Physical Properties of P.V.C. Attenuated Network Copolymers Produced by Ionizing Radiation; Proprietes physiques des copolymeres obtenus sous l'action de rayonnements ionisants et dont le reseau est attenue par l'effet du chlorure de polyvinyle; Fizicheskie svojstva polivinilkhloridnykh obednennykh tsepej sopolimerov, poluchennykh v rezul'tate vozdejstviya ioniziruyushchej radiatsii; Propiedades fisicas de los copolimeros de redes atenuadas por cloruro de polivinilo obtenidos por irradiacion

    Energy Technology Data Exchange (ETDEWEB)

    Pinner, S H [Tube Investments Research Laboratories, Hinxton Hall, Cambridge (United Kingdom)

    1960-07-15

    The cross-linking of polyvinyl chloride with ionizing radiation poses special problems. Due to rather unfavourable cross-linking and dislinking parameters for this polymer, the radiation doses necessary for high cross-link densities are uneconomicall y large and discolouration and dehydrohalogenatio n are simultaneously produced. These difficulties have been overcome by the incorporation into the P. V. C., prior to irradiation, of diallyl and triallyl esters. Heavily cross-linked products are thereby obtained with relatively low doses of ionizing radiation. Examination of the physical properties of the products suggests that these are not simply graft copolymers, which term normally implies the presence of long branch chains, but are polymer attenuated allyl networks. In these materials, the desirable properties of the parent polymer and of the allyl network are combined. The tensile strength, modulus and elongation of the attenuated network copolymers are presented and discussed as a function of temperature and of the concentration and functionality of the allyl ester. Reference is also made to the swelling and chemical resistance of the products. (author) [French] La reticulation du chlorure de polyvinyle sous l'action des rayonnements ionisants pose des problemes particuliers. Les parametres de reticulation et de degradation etant plutot defavorables pour ce polymere, les doses d'irradiation necessaires a l'obtention de fortes densites de pontage sont trop elevees pour donner des resultats economiquement interessants; elles provoquent simultanement la decoloration et la deshalogenhydratation. Il a ete possible de surmonter ces difficultes par introduction d'esters diallyliques et triallyliques dans le chlorure de polyvinyle, avant irradiation. Ce procede permet d'obtenir au moyen de doses d'irradiation relativement faibles des produits fortement reticules. L'etude des proprietes physiques de ces produits montre qu'il s'agit non pas de simples copolymeres greffes

  9. The oscillatory behavior of heated channels: an analysis of the density effect. Part I. The mechanism (non linear analysis). Part II. The oscillations thresholds (linearized analysis); Sur le comportement oscillatoire de canaux chauffes. - Etude theorique de l'effet de densite. 1ere partie: le mecanisme (analyse non lineaire), 2eme partie: seuils d'oscillation (analyse lineaire)

    Energy Technology Data Exchange (ETDEWEB)

    Boure, J [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The problem of the oscillatory behavior of heated channels is presented in terms of delay-times and a density effect model is proposed to explain the behavior. The density effect is the consequence of the physical relationship between enthalpy and density of the fluid. In the first part non-linear equations are derived from the model in a dimensionless form. A description of the mechanism of oscillations is given, based on the analysis of the equations. An inventory of the governing parameters is established. At this point of the study, some facts in agreement with the experiments can be pointed out. In the second part the start of the oscillatory behavior of heated channels is studied in terms of the density effect. The threshold equations are derived, after linearization of the equations obtained in Part I. They can be solved rigorously by numerical methods to yield: -1) a relation between the describing parameters at the onset of oscillations, and -2) the frequency of the oscillations. By comparing the results predicted by the model to the experimental behavior of actual systems, the density effect is very often shown to be the actual cause of oscillatory behaviors. (author) [French] Premiere partie: mecanisme (equations non linearisees). On expose le probleme du comportement oscillatoire des canaux chauffes en mettant l'accent sur la presence de retards dans le systeme et on propose un modele a 'effet de densite' pour expliquer ce comportement. L'effet de densite est la consequence de la relation physique entre l'enthalpie et la masse volumique du fluide. Les equations non lineaires du schema mathematique correspondant sont etablies et mises sous forme adimensionnelle. L'analyse de ces equations conduit a une description du mecanisme des oscillations. On donne la liste des parametres dont depend le comportement du modele. A ce stade de l'etude, on peut deja relever dans ce comportement plusieurs faits conformes a l'experience. Deuxieme partie: seuils d

  10. Du texte aux archives : le problème de la source

    Directory of Open Access Journals (Sweden)

    Joseph Morsel

    2009-02-01

    Full Text Available Il est à remarquer que le Verbe divin semble avoir fait peu d’état des côtés extérieurs et sensibles de l’écriture et de la parole. Il n’écrivit qu’une seule fois – et encore, sur la terre. Sans doute n’estimait-il, dans la vibration du mot, que cet insaisissable au-delà, dont le magnétisme inspiré par la Foi peut pénétrer un vocable dans l’instant où on le profère. Qui sait si le reste n’est pas de peu d’importance, en effet ?... Toujours est-il qu’il a permis seulement que l’on imprimât son...

  11. A project for storing the radioactive sludges from Marcoule in the soil (1960); Une solution de stockage dans le sol des boues radioactives de Marcoule (1960)

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, P; Gailledreau, C [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    A study of the feasibility of storing radioactive sludges in the soil. Special attention is paid to the case of the Marcoule plant, producing three kinds of sludges. The movement of the different fission products is given. (author) [French] Etude de la possibilite de stocker dans le sol des boues radioactives. Le cas de la station de traitement des effluents de Marcoule, produisant trois types de boues, est etudie plus specialement. Le mouvement des divers produits de fission est precise. (auteur)

  12. Exploiter la Littérature en Classe du Fle: Allah N'est Pas Obligé D ...

    African Journals Online (AJOL)

    Prof

    allons exploiter un extrait d'un texte littéraire: Allah n'est pas obligé d'Ahmadou. Kourouma au niveau A1/A2 du CECR. Dans Allah n'est pas obligé l'écrivain ivoirien dépeint le phénomène d'enfant soldat à travers la vie et les pérégrinations de Birahima le protagoniste. Etat de lieu. Pour se tirer de la situation ci-dessus, ...

  13. Le bureau d'études mécaniques du groupe TS-MME

    CERN Document Server

    Menot, C

    2004-01-01

    Le bureau d'études du groupe MME représente le principal support d'ingénierie mécanique pour le LHC et quelques projets autres. Il est constitué de trois sections au mandat distinct. Ses activités couvrent le design des divers équipements : des aimants supraconducteurs du LHC et leur alimentation électrique, le design pour le système vide et de l'instrumentation et calibration de faisceau. Le groupe a aussi en charge le design de tout système se rapportant aux complexes PS et SPS Les principaux sujets présentés dans ce rapport concernent la structure du bureau d'études et son effectif, les ressources à disposition, son domaine d'activité, son mode de fonctionnement, les outils et les méthodologies développés. La coordination entre sections du groupe, qui apportent chacune son expertise, sera mise en évidence. Une vision du futur avec les besoins en ressources liés aux activités vitales pour le CERN est abordée en conclusion.

  14. Approximation auto-coherente a deux particules, pseudogap et supraconductivite dans le modele de Hubbard attractif

    Science.gov (United States)

    Allen, Steve

    2000-10-01

    Dans cette these nous presentons une nouvelle methode non perturbative pour le calcul des proprietes d'un systeme de fermions. Notre methode generalise l'approximation auto-coherente a deux particules proposee par Vilk et Tremblay pour le modele de Hubbard repulsif. Notre methode peut s'appliquer a l'etude du comportement pre-critique lorsque la symetrie du parametre d'ordre est suffisamment elevee. Nous appliquons la methode au probleme du pseudogap dans le modele de Hubbard attractif. Nos resultats montrent un excellent accord avec les donnees Monte Carlo pour de petits systemes. Nous observons que le regime ou apparait le pseudogap dans le poids spectral a une particule est un regime classique renormalise caracterise par une frequence caracteristique des fluctuations supraconductrices inferieure a la temperature. Une autre caracteristique est la faible densite de superfluide de cette phase demontrant que nous ne sommes pas en presence de paires preformees. Les resultats obtenus semblent montrer que la haute symetrie du parametre d'ordre et la bidimensionalite du systeme etudie elargissent le domaine de temperature pour lequel le regime pseudogap est observe. Nous argumentons que ce resultat est transposable aux supraconducteurs a haute temperature critique ou le pseudogap apparait a des' temperatures beaucoup plus grandes que la temperature critique. La forte symetrie dans ces systemes pourraient etre reliee a la theorie SO(5) de Zhang. En annexe, nous demontrons un resultat tout recent qui permettrait d'assurer l'auto-coherence entre les proprietes a une et a deux particules par l'ajout d'une dynamique au vertex irreductible. Cet ajout laisse entrevoir la possibilite d'etendre la methode au cas d'une forte interaction.

  15. Les fluctuations supraconductrices dans le compose praseodyme-cerium-oxyde de cuivre

    Science.gov (United States)

    Renaud, Jacques

    Ce travail etudie les fluctuations supraconductrices dans le compose supraconducteur a haute temperature critique dope aux electrons Pr2-xCe xCuO4+delta. La technique utilisee pour sonder ces fluctuations est le transport electrique DC dans le plan ab. Il s'agit, a notre connaissance, de la premiere etude de ce type dans la classe generale des supraconducteurs a haute temperature critique dopes aux electrons et, plus particulierement, dans Pr2-xCe xCuO4+delta. De plus, l'etude est effectuee pour trois regimes de dopage, soit sous-dope x = 0.135, dopage optimal x = 0.15 et surdope x = 0.17. Les echantillons etudies sont des couches minces d'epaisseur plus grande que 100 nm crues par ablation laser. Les mesures electriques DC effectuees dans ce travail sont la resistance en reponse lineaire et les courbes IV en reponse non lineaire en fonction de la temperature. La mise en oeuvre experimentale de ces mesures a necessite une grande attention au filtrage et aux effets de chauffage a haut courant. Nous montrons que, sans cette attention, les donnees experimentales sont toujours erronees dans le regime pertinent pour nos echantillons. Les resultats pour le dopage optimal x = 0.15 sont expliques de facon tres convaincante dans le cadre de fluctuations purement 2D. D'abord, le regime des fluctuations gaussiennes est tres bien decrit par le modele d'Aslamazov-Larkin en deux dimensions. Ensuite, le regime de fluctuations critiques, se trouvant a plus basse temperature que le regime gaussien, est tres bien decrit par la physique 2D de Kosterlitz-Thouless. Dans cette analyse, les deux regimes ont des temperatures critiques coherentes entre elles, ce qui semble confirmer ce scenario 2D. Une analyse des donnees dans le cadre de fluctuations 3D est exploree mais donne des conclusions incoherentes. Les resultats pour les autres dopages sont qualitativement equivalents avec le dopage optimal et permettent donc une explication purement 2D. Par contre, contrairement au dopage optimal

  16. Experimental study of chemical-mechanical coupling during percolation of reactive fluid through rocks under stress, in the context of the CO{sub 2} geological sequestration; Etude experimentale du couplage chimie-mecanique lors de la percolation d'un fluide reactif dans des roches sous contrainte, dans le contexte de la sequestration geologique du CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Le Guen, Y

    2006-10-15

    CO{sub 2} injection into geological repositories will induce chemical and mechanical instabilities. The study of these instabilities is based on experimental deformation of natural rock samples under stress, in the presence of fluids containing, or not, dissolved CO{sub 2}. Triaxial cells used for the experiments permitted an independent control and measurement of stress, temperature, fluid pressure and composition. Vertical strains were measured during several months, with a resolution of 1.10{sup -12} s{sup -1} on the strain rate. Simultaneously, fluids were analysed in order to quantify fluid-rock interactions. For limestone samples, percolation of CO{sub 2}-rich fluids increases strain rate by a factor 1.7 up to 5; on the other hand, sandstone deformation remained almost the same. Increase in strain rate with limestone samples was explained by injected water acidification by the CO{sub 2} which increases rock solubility and reaction kinetics. On the opposite, small effect of CO{sub 2} on quartz explains the absence of deformation. X-ray observations confirmed the importance of rock composition and structure on the porosity evolution. Numerical simulations of rock elastic properties showed increasing shear stress into the sample. Measured deformation showed an evolution of reservoir rocks mechanical properties. It was interpreted as the consequence of pressure solution mechanisms both at grains contacts and on grain free surfaces. (author)

  17. Le concept d’ethos.

    Directory of Open Access Journals (Sweden)

    Bernard Fusulier

    2011-09-01

    Full Text Available Dans cet article, l’auteur traite de la signification et de l’usage du concept d’ethos. Dans la sociologie classique, ce dernier a été utilisé pour comprendre et qualifier la rationalité socialement et éthiquement encastrée des conduites sociales. Exprimant l’intériorisation d’un principe organisateur de pratiques, dessinant une matrice globale des comportements, il est porteur d’une vision qui paraît datée à l’heure du “brouillage des classes sociales”, de la “modernité liquide” et de “l’homme pluriel”. Néanmoins, si l’on reconnaît l’existence d’un univers social non entièrement liquéfié, c’est-à-dire où continuent à exister des milieux sociaux sédimentés qui imprègnent avec plus ou moins de profondeur le système de personnalité de celui qui s’y insère durablement, l’ethos reste un concept heuristique pour saisir et interpréter les récurrences de comportements qui peuvent s’y observer. Permettant de comprendre ce que les espaces d’insertion “font aux individus” ainsi que la façon dont les principes organisateurs de pratiques entrent en transaction (en consonance, en dissonance ou en concurrence, il garde toute sa pertinence dans la boîte à outils théoriques du sociologue et de l’anthropologue d’aujourd’hui.

  18. Elaboration of an Elasto-Plastic Model for High Porosity Chalks. Application to the Compaction of Petroleum Reservoirs Elaboration d'un modèle de comportement élasto-plastique pour les craies très poreuses. Application à la compaction des réservoirs pétroliers

    Directory of Open Access Journals (Sweden)

    Shahrour I.

    2006-11-01

    Full Text Available This paper presents a study of the compaction of petroleum reservoirs applied to very porous carbonate rocks such as chalk. In production estimates made in reservoir engineering, the processing of the mechanical problem is often greatly simplified. Good modelling of how materials behave gives special consideration to the influence of mechanical deformations on fluid recovery. After an analysis of the mechanical behaviour of very porous chalks, an elastoplastic behaviour model is derived so as to reproduce the principal experimental observations. This behaviour model can then be used to perform local simulations of the mechanical behaviour of a reservoir under- going depletion and thus to demonstrate the importance of the stress path and the initial stress state on the deformation of materials and hence on the recovery rate. Dans les applications pétrolières, les études de la compaction des roches réservoirs interviennent dans l'estimation des quantités de fluide récupérables et de la subsidence induite par la déplétion du champ de production. Dans la première partie du travail, nous montrons qu'à partir de l'équation linéarisée de la conservation de la masse de fluide, il est possible d'exprimer un taux de récupération distinguant les contributions respectives du fluide et de la roche. En ingénierie de réservoirs, l'hypothèse d'un chemin de contrainte prépondérant dans le milieu de production permet d'exprimer la contribution de la déformation de la roche au moyen de la compressibilité volumique des pores selon ce chemin. Le taux de récupération obtenu est alors dépendant du chemin de contrainte. Lorsque le chemin de contrainte dans le réservoir n'est pas homogène, il est alors nécessaire de connaître la loi de comportement mécanique du matériau étudié. Dans le cas des carbonates très poreux, nous désirons montrer l'influence liée au choix du chemin de contrainte sur les estimations obtenues par une m

  19. Le modele de Hubbard bidimensionnel a faible couplage: Thermodynamique et phenomenes critiques

    Science.gov (United States)

    Roy, Sebastien

    Une etude systematique du modele de Hubbard en deux dimensions a faible couplage a l'aide de la theorie Auto-Coherente a Deux Particules (ACDP) dans le diagramme temperature-dopage-interaction-sauts permet de mettre en evidence l'influence des fluctuations magnetiques sur les proprietes thermodynamiques du systeme electronique sur reseau. Le regime classique renormalise a temperature finie pres du dopage nul est marque par la grandeur de la longueur de correlation de spin comparee a la longueur thermique de de Broglie et est caracterisee par un accroissement drastique de la longueur de correlation de spin. Cette croissance exponentielle a dopage nul marque la presence d'un pic de chaleur specifique en fonction de la temperature a basse temperature. Une temperature de crossover est alors associee a la temperature a laquelle la longueur de correlation de spin est egale a la longueur thermique de de Broglie. C'est a cette temperature caracteristique, ou est observee l'ouverture du pseudogap dans le poids spectral, que se situe le maximum du pic de chaleur specifique. La presence de ce pic a des consequences sur l'evolution du potentiel chimique avec le dopage lorsque l'uniformite thermodynamique est respectee. Les contraintes imposees par les lois de la thermodynamique font en sorte que l'evolution du potentiel chimique avec le dopage est non triviale. On demontre entre autres que le potentiel chimique est proportionnel a la double occupation qui est reliee au moment local. Par ailleurs, une derivation de la fonction de mise a l'echelle de la susceptibilite de spin a frequence nulle au voisinage d'un point critique marque sans equivoque la presence d'un point critique quantique en dopage pour une valeur donnee de l'interaction. Ce point critique, associe a une transition de phase magnetique en fonction du dopage a temperature nulle, induit un comportement non trivial sur les proprietes physiques du systeme a temperature finie. L'approche quantitative ACDP permet de

  20. Le Goff. Balance crítico de un legado

    Directory of Open Access Journals (Sweden)

    Carlos Astarita

    2014-07-01

    Full Text Available Los primeros trabajos de Jacques Le Goff, sobre mercaderes, banqueros e intelectuales de la Edad Media, presentan cualidades que anuncian su desarrollo posterior: débil teoría económica y mayor desarrollo sobre historia de las ideas. A partir de 1964, con la publicación de La civilización del occidente medieval, se produce un cambio. Ese cambio se inscribe en una nueva orientación general de la escuela de Annales: el estudio de las mentalidades. Le Goff pretende realizar un análisis de la mentalidad del hombre medieval. Su estudio se basa principalmente en textos eruditos eclesiásticos. Se demuestra en este artículo que ese tipo de fuentes permiten acceder a la mentalidad de la parte sacerdotal de la clase de poder. De manera secundaria, Le Goff estudió fuentes literarias que permiten acercarse a la mentalidad de los caballeros. Para el análisis de los campesinos y de distintos sectores subalternos se necesitarían otro tipo de fuentes que nunca fueron utilizadas por Le Goff. Este análisis mantiene algunas semejanzas con el materialismo histórico, pero también tiene profundas diferencias con la doctrina de Marx. En base a esto se determina el alcance del legado de Le Goff

  1. Réflexions sur le pluralisme familial

    OpenAIRE

    Agallopoulou, Pénélope; Annoussamy, David; Arboncana, Aliou; Boujeka, Augustin; Callus, Thérèse; Clément, Christèle; Clément, Christèle; Fulchiron, Hugues; Gallus, Nicole; Guez, Philippe; Jančić, Olga Cvejić; Lafargue, Régis; Leyssac, Marie-Paule Lucas de; Millard, Éric; Miranda, Antonello

    2012-01-01

    Il n’est pas une, mais des manières de fonder, de vivre et de défaire le lien familial. Construite autour d’un enfant ou d’un couple, marié ou non, hétéro ou homosexuel, la famille, hiérarchisée ou égalitaire, parfois polygame, monoparentale, nucléaire ou élargie, unie ou désunie, séparée, regroupée, recomposée…se décline au pluriel. Ce pluralisme familial, qui découle des conceptions idéologiques, politiques, religieuses, culturelles, parfois même économiques de chacun est plus que jamais vi...

  2. Une façon plus sécuritaire de combattre le paludisme au Mexique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2010 ... Le pays y est arrivé sans recourir au DDT. ... 'importante flambée de paludisme qui est survenue dans l'État d'Oaxaca en 1998 a donné naissance à une nouvelle ... Améliorer la santé au Guatemala – Maria Carlota Monroy.

  3. Le syndrome de Budd-Chiari: une complication rare de la ...

    African Journals Online (AJOL)

    L'atteinte hépatique au cours de la sarcoïdose est une localisation fréquente, habituellement asymptomatique. La cholestase anictérique et l'hypertension portale représentent ses principales complications. Le syndrome de Budd-Chiari est une complication peu connue qui demeure exceptionnelle. Nous rapportons un ...

  4. Nuevo León

    Directory of Open Access Journals (Sweden)

    Laura Nelly Medellín Mendoza

    2006-01-01

    Full Text Available El ensayo analiza la transición política nuevoleonesa a partir de un contexto de liberalización política. En Nuevo León el régimen político autoritario fue cediendo en el plano electoral, dada la presión que conjuntamente la sociedad política y la sociedad civil ejercieron por lograr reglas democráticas. Este avance gradual permitió garantizar un organismo electoral confiable y que determinó en buena medida la garantía de la alternancia en 1997. El pan fue el partido que capitalizó el bono democrático, pero una vez en la responsabilidad de gobierno, no pudo ampliar el proceso de liberalización política al mediatizar las reformas electorales y no comprometerse para sacar del atolladero legislativo las iniciativas que garantizaban mecanismos de participación ciudadana: referéndum y plebiscito.

  5. Les nouveaux mécanismes du contrôle organisationnel

    Directory of Open Access Journals (Sweden)

    Rosimeri Carvalho da Silva

    Full Text Available Dans cet essai on discute les mécanismes de contrôle mis en évidence par l'adoption de nouvelles technologies de gestion qui ont proporcionné une restructuration productive. La relevance de cette discussion est dans la compréhension que l'adoption de ces nouvelles technologies impliquent des alterations dans le système de contrôle que, même si elles ne remplacent pas complètement les modes de contrôle utilisés avant, mettent l'accent sur un mode de contrôle plus subtil que privilegie des mécanismes qu'influencient le partage d'une vision de monde.

  6. Integration des PLC dans l'infrastructure de contrôle AB/CO

    CERN Document Server

    Locci, F

    2005-01-01

    L’interface lEPLC qui a été mise au point dans le cadre du projet de consolidation ISOLDE, est dorénavant utilisée chaque fois qu’un groupe équipement souhaite interconnecter un système à base de composants industriels dans l’infrastructure de contrôle AB/CO. Et en plus récemment pour la machine LEIR, le CTF, REX … mais aussi pour le contrôle de divers équipements du LHC. Ce document décrit les objectifs de l’interface IEPLC, le protocole d’échange et les outils de configuration associés, dans sa version de base.

  7. Évaluation spatiale et prospectives sur le risque de pollution diffuse par le nitrate sur le bassin versant de la Bultière

    Directory of Open Access Journals (Sweden)

    LE FLAHEC, François

    2015-06-01

    Full Text Available En France, la protection des captages d'eau potable est une préoccupation majeure : le Grenelle Environnement a identifié plus de cinq cents sites menacés par les pollutions diffuses, d'où la nécessité de mettre en place des plans d'action pour les protéger. En Vendée, dans le bassin versant de la Bultière, confronté à des rejets importants de nitrate, une étude par modélisation agronomique et hydrologique a été mise en œuvre avec le logiciel Swat, un outil alliant analyse spatiale et simulation, qui doit permettre de donner des orientations et de prioriser des solutions.

  8. La crise de Crimée (mars 2014) : comment en est-on arrivé là ?

    OpenAIRE

    Richard, Yann

    2014-01-01

    La crise ukrainienne a des causes internes et externes nombreuses. On peut regretter que la presse française en parle de façon très orientée sans prendre le temps de présenter le point de vue russe, si ce n’est pour affirmer que le président Poutine relançait la guerre froide et réactivait l’impérialisme russe. Le rattachement de la Crimée est sans conteste une annexion déguisée et c’est un coup de force autant qu’un rejet des prescriptions élémentaires du droit international. Toutefois, il f...

  9. Transformations agricoles | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 déc. 2010 ... La région de Souss Massa au centre du Maroc est réputée pour ses fruits et légumes destinés surtout à l'exportation. Toutefois, le manque de pluie chronique dans les régions montagneuses nuit au développement économique et à la santé humaine, car il réduit le rendement de la production et oblige les ...

  10. Conférence principale : Le changement climatique mondial, ses ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 mai 2011 ... Le Dr Nobre a présenté le terme « anthropocene » [traduction] pour décrire la période la plus récente de l'histoire de la terre, à partir de la révolution industrielle. « L'influence de l'humanité sur la terre au cours des derniers siècles est devenue importante au point de constituer une nouvelle ère géologique, ...

  11. Réseaux (2005) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 avr. 2016 ... Le recours au réseau est au coeur de cette façon d'aborder la collaboration. Ces pages Web sur les réseaux rassemblent la riche expérience que le CRDI a acquise dans son travail quotidien avec les réseaux au fil des ans et l'information glanée grâce à une évaluation stratégique menée de 2004 à 2006.

  12. Monde « réel » et monde imaginaire. Lele de la bande son dans Eraserhead, de David Lynch

    OpenAIRE

    Bobée, Emmanuelle

    2012-01-01

    Par définition, un film de fiction dépeint un monde imaginaire dans lequel évoluent – le plus souvent – des personnages, que le spectateur feint de considérer comme des êtres de chair et de sang, en vertu de ce que l’on nomme le « pacte de fiction ». Au sein de ce monde imaginaire ou monde diégétique, comment le spectateur peut-il faire la distinction entre ce qui est « réel », du point de vue des personnages, et ce qui ne l’est pas ? En effet, contrairement à ce qui se produit dans la vie ré...

  13. Images du Mage, images pour le Mage

    Directory of Open Access Journals (Sweden)

    Daniel GREGORIO

    2007-01-01

    Full Text Available Les œuvres d’Alphonse X proposent diverses représentations du mage, qui en font, tour à tour, l’ennemi ou l’allié de la religion chrétienne. Il est vrai que parfois, comme le montre l’histoire de Simon le magicien, la pratique de la magie implique un commerce direct et néfaste avec les forces infernales. Néanmoins, les personnages de Merlin et des Rois Mages, tels qu’ils sont présentés par Alphonse X, démontrent que magie et religion peuvent cohabiter, à condition toutefois que le mage croit en la virginité de Marie et en l’Incarnation et que sa pratique magique soit bénéfique pour la communauté. Ce bénéfice requiert parfois la reconstruction de l’univers quotidien ; pour ce faire, le magicien doit savoir quand et comment utiliser des objets et des pentacles, qui lui permettront de soumettre les forces surnaturelles. Il doit donc posséder une connaissance approfondie du monde naturel et des esprits qui, conjuguée à sa foi religieuse, l’empêchera de tomber dans la démonolâtrie.Las obras alfonsíes proponen diversas aproximaciones al personaje del mago, generalmente considerado como un ser antagónico del hombre religioso. Es cierto que en algunas ocasiones, como ocurre con Simón el mago, la práctica de las artes mágicas significa un trato directo y nefasto con las fuerzas infernales. Sin embargo, personajes como Merlín o los Reyes Magos, tal y como los describe Alfonso X, subrayan una posible cohabitación entre magia y religión sin que la práctica de la una signifique la exclusión de la otra. Sólo hay que cumplir con dos condiciones : creer en la virginidad de María y que Dios se hizo hombre, y proporcionar a la comunidad un beneficio claro. Este beneficio requiere en ocasiones remodelar lo cotidiano, utilizando objetos y pentáculos, en circunstancias extremadamente determinadas, lo que implica un conocimiento exhaustivo tanto del mundo natural como del simbólico y de los espíritus. Es este

  14. LUTTE CONTRE LE CANCER AU MAROC - L’APPORT DE LA FONDATION LALLA SALMA

    Directory of Open Access Journals (Sweden)

    Rachid BEKKALI

    2017-05-01

    Full Text Available Depuis la création de la Fondation Lalla Salma le 22 novembre 2005, la lutte contre le cancer au Maroc est devenue une priorité de santé publique. A cet effet, la Fondation et le Ministère de la Santé ont développé le Plan National de Prévention et de Contrôle du Cancer 2010-2019. Dans ce cadre, la Fondation mène des actions dans les domaines de la sensibilisation, de la prévention, de la détection précoce et de l’accès aux soins. De plus, la Fondation développe des activités de solidarité sociale par la construction de "Maisons de vie" pour les patients et leurs proches, la création d’un réseau de bénévoles à travers le Royaume, le développement des soins palliatifs à domicile et le soutien scolaire des orphelins du cancer.Sous le leadership de Son Altesse Royale La Princesse Lalla Salma, La Fondation mobilise les fonds nécessaires, coordonne les différentes actions et fédère les différents intervenants dans la lutte contre le cancer.En tant qu’Ambassadrice de bonne volonté de l'OMS pour la promotion de la prévention et des soins du cancer, Son Altesse Royale a aussi un rôle important dans la plaidoirie pour la lutte contre le cancer dans le monde, et soutient plusieurs pays africains pour la mise en place de programmes de prévention et de contrôle du cancer et d’accès aux médicaments.

  15. Gas market is today strategical; Le marche du gaz est aujourd'hui strategique

    Energy Technology Data Exchange (ETDEWEB)

    Darricarrere, Y.L. [Total, 92 - Courbevoie (France)

    2006-07-01

    The energy market, and in particular the gas market, is today seething with excitement. In France, in Europe and in the rest of the world, the energy stakes are in the center of preoccupations. This article is an interview of Y.L. Darricarrere, general director of the gas and electricity division of Total group, who explains his opinions about the opening of European and French energy markets, presents the ambitions of Total group on these markets, and comments some recent events of the European energy scene: concentration between gas and electric utilities, the Suez and Gaz de France (GdF) project of merger, the risks linked with the coming in of national companies from producing countries, like Gazprom and Sonatrach, on the European market, the restriction of access of foreign companies to hydrocarbon reserves in Russia and Latin America (come back of the 'energy nationalism'), Total's policy for anticipating the increase of the world energy demand and the depletion of fossil fuel reserves. (J.S.)

  16. Le portable, c'est un concentré de physique!

    CERN Multimedia

    Brézin, Edouard

    2005-01-01

    Physics is ignored by french people. Edouard Brézin, President of the Science Academy and a spcecialist of quantic mechanics, tells in this article: from the computer to the portable phone, without forgetting the laser, the GPS and Internet, repercussions of physics are multiple (3 pages)

  17. Petroleum: the neo-pessimism is unfounded; Petrole: le neo-pessimisme est infonde

    Energy Technology Data Exchange (ETDEWEB)

    Noel, P

    2004-10-15

    The author takes stock on the dynamic of the oil system. He shows how the economic laws can be applied to the petroleum market and analyzes the effects of the prices evolution. The creeping oil shock of 2003-2004 has proven less disruptive than one may have anticipated. Commodity cycles on the one hand the shaky management of marginal supply by OPEC on the other hand, are very likely to create ample prices swings with little relations, if any, to the actual scarcity-or lack thereof-of oil resources. (A.L.B.)

  18. What is cosmic radiation?; Qu'est ce-que le rayonnement cosmique?

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The earth was indeed receiving ionizing radiations from the heavens. This cosmic radiation consists of particles travelling near the speed of light. It consists of two components, the first of which is permanent and of galactic origin, while the other is more sporadic, depending on the sun's activities. Natural land-based sources expose each of us to an average total dose of 2.4 mSv per year (source UNSCEAR). In addition, the human activities using ionizing radiation contribute to an average annual exposure of 1.4 mSv, originating primarily with medical activities ( radiodiagnostic and radiation therapy). Members of flights crew are subject to exposure. The total dose of cosmic radiation received is is directly proportional with the duration of exposure, and thus with the duration of the flight. Measurement taken on board aircraft during the 1990's showed that flight personnel (on long haul flights) receive an average dose of approximately the same magnitude as the one due to exposure to natural radioactivity in France. The damage caused by ionizing radiation depends on the quantity of energy released by radiation into the cells of each organ or tissue of the human body(exposure dose). For a given quantity of absorbed energy (dose expressed in Gray), the damage will vary according to the nature of the radiation and the affected organ. These effects are of two types: acute effects and deferred effects. Two measurements are essential for radiation protection: the measurements of the dose of radiation absorbed by the body and the assessment of the risk associated with the absorbed dose. Two units were thus created: the gray and the sievert. (N.C.)

  19. AIDS Review 2005 : Qu'est-ce qui mijote ? Le sida et la politique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Giving girls and women the power to decide. Addressing Africa's unmet need for family planning by intensifying sexual and reproductive and adolescent health research. View moreGiving girls and women the power to decide ...

  20. "Le Style est l'Homme Meme": The Action of Literature.

    Science.gov (United States)

    Brown, Marshall

    1997-01-01

    Suggests that doing literary criticism is how teachers and students hear other voices as they read, instead of projections of themselves. Espouses the study of style as the vehicle of literary criticism. Proposes a definition of style. (RS)

  1. The Systems Approach: Plus Ca Change, Plus C'est le Meme

    Science.gov (United States)

    Sprinthall, Norman A.; Erickson, V. Lois

    1973-01-01

    A systems approach to counselor education is a good step forward if we are willing to face the content question and redefine the objectives of counselor education itself, a redefinition which includes new roles and new functions. Without such a major change, the systems approach may become a mehtod that supports the illusion of change. (Author)

  2. Le cru, le cuit et le pourri dans _Le vice-consul_ de Marguerite Duras

    Directory of Open Access Journals (Sweden)

    Hélène Caron

    2011-05-01

    Full Text Available Bien que plusieurs articles critiques aient déjà avancé de nouvelles perspectives sur le texte Le Vice-Consul (LVC de Marguerite Duras, l’analyse de la représentation de la nourriture dans ce roman n’a fait l’objet d’aucune étude. Cet article tente donc de combler cette lacune en proposant d’analyser les images du cru et du cuit, images qui se rejoignent sous les notions du pourri et de l’abject, tout en offrant quelques interprétations de l’un des passages critiques du roman où la folle mendiante croque la tête d’un poisson vivant.

  3. Le charme slave

    Directory of Open Access Journals (Sweden)

    Antonella Mauri

    2012-09-01

    Full Text Available Antonella Mauri analyse l’image des femmes slaves immigrées en Italie telle qu’elle apparaît à travers la publicité, la littérature romanesque (La ballata dei lavavetri de Peter Del monte, Luce Profuga de Valerio Aiolli, Pornokiller de Bruno Ventavoli, le cinéma, la bande dessinée (Danilo Maramotti, image qu’elle oppose aux résultats d’une enquête qu’elle a menée sur le terrain. Elle s’interroge en particulier sur la permanence des stéréotypes liés à la femme slave.

  4. Le Brahmane du Komintern

    Directory of Open Access Journals (Sweden)

    Elizabeth Burgos

    2008-01-01

    Full Text Available Le Brahmane du Komintern, largometraje documental del realizador francés Vladimir León, constituye un ejercicio ejemplar de investigación histórica y  de lograda factura de realización. Y, pese a no haber contado con la ayuda de ninguno organismo público, se trata de un ambicioso proyecto que cubre una amplia extensión geográfica que abarca: Estados Unidos, México, Moscú, Berlín, y la India. Gira en torno a una figura que tuvo en su tiempo su hora de gloria. Un bengalí, hijo de braman, la c...

  5. Fluid Mechanics.

    Science.gov (United States)

    Drazin, Philip

    1987-01-01

    Outlines the contents of Volume II of "Principia" by Sir Isaac Newton. Reviews the contributions of subsequent scientists to the physics of fluid dynamics. Discusses the treatment of fluid mechanics in physics curricula. Highlights a few of the problems of modern research in fluid dynamics. Shows that problems still remain. (CW)

  6. Le CRDI au Ghana

    International Development Research Centre (IDRC) Digital Library (Canada)

    pour prévenir le paludisme, des études ayant démontré que leur utilisation pouvait réduire considérablement la mortalité infantile. Les chercheurs ont également suggéré aux gouvernements différents moyens pour inciter les gens à acheter les moustiquaires et à les utiliser correctement. Les TI au service de la démocratie.

  7. Le Culture preistoriche

    OpenAIRE

    Tanda, Giuseppa

    1987-01-01

    Le più antiche manifestazioni della presenza dell'uomo, nella provincia di Sassari (e in Sardegna), risalgono al Quaternario: sono state osservate nel 1979, nel bacino del rio Altana-Anzos, situato nel territorio dei comuni di Laerru e Perfugas. Il presente lavoro propone un excursus dal Paleolitico al Neolitico (antico, medio e recente) fino all'Età del Rame e all'Età del Bronzo (II metà del III millennio-1600 a.C.).

  8. Le CRDI en Chine

    International Development Research Centre (IDRC) Digital Library (Canada)

    les employés du secteur non structuré ont de meilleures conditions de travail. □ les citoyens influencent les décisions relatives aux dépenses publiques. Soutien accordé par le CRDI depuis 1981. 222 activités d'une valeur de 59 millions CAD. Chercheurs et agriculteurs s'emploient à améliorer les moyens de subsistance.

  9. Le CRDI en Tunisie

    International Development Research Centre (IDRC) Digital Library (Canada)

    les citoyens arabes sont plus présents sur Internet. Soutien accordé depuis 1975. 49 activités. 8 millions cad. Dans la foulée du Printemps arabe, les chercheurs conçoivent des réformes visant à assurer l'essor de la démocratie et en examinent la validité. CRDI centre de recherches pour le développement international.

  10. Développement du logiciel de contrôle de Vertex Locator

    CERN Document Server

    Mennane, M

    2005-01-01

    L’expérience LHCb, qui consiste à mettre en collision deux faisceaux de particules pour en observer les phénomènes résultants, est dotée d’un système de contrôle fondé sur l’utilisation du logiciel PVSS et d’un système client-serveur. PVSS permet à l’utilisateur du détecteur de gérer par le biais d’une interface graphique toute l’électronique. Le système client-serveur intégré à PVSS, appelé DIM, offre quant à lui la possibilité de configurer et de surveiller le détecteur à partir d’un ordinateur quelconque. Toute une chaîne de contrôle a été conçue pour le Vertex Locator, détecteur le plus proche du point de collision permettant de reconstituer la trajectoire des particules issues de l’impact. Deux cartes électroniques sont au coeur de la chaîne de contrôle du Vertex Locator : le control board qui permet d’envoyer via I2C des commandes de configuration aux composants et de distribuer des signaux de synchronisation, et le temperature board qui permet de veil...

  11. Les mesures de métrologie pour le CLIC

    CERN Document Server

    Cherif, A

    2008-01-01

    Le projet CLIC est en tout point un défi technique majeur ; c?est le cas également pour la mesure dimensionnelle. Quels sont les équipements et les méthodes qui permettent de caractériser les pièces avec une incertitude de mesure aussi réduite que possible, vu les tolérances micrométriques imposées ? Afin de répondre à cette question, une veille technologique a été maintenue sur une longue période. Les acteurs relevants ont été contactés pour bénéficier d?une ouverture sur les dernières avancées dans le domaine. Différentes techniques ont été étudiées et comparées telles que la digitalisation, la tomographie X, la mesure tridimensionnelle. L'assemblage de haute précision des composants est aussi primordial. Sa mise en ?uvre sous un microscope optique ou à l'aide d'une machine tridimensionnelle est en cours d?étude. L'exposé traitera aussi de la mesure de rugosité, un domaine où nous disposons de moyens adaptés aux exigences spécifiques du projet.

  12. Fluid Sampling under Adverse Conditions Echantillonnage des fluides en conditions difficiles

    Directory of Open Access Journals (Sweden)

    Williams J. M.

    2006-12-01

    'échantillonnage DST, l'échantillonnage par coiled tubing, et les méthodes isocinétiques. Il met également l'accent sur leurs limites. On insiste sur l'importance d'un usage optimal de la technologie existante, par combinaison des techniques traditionnelles et des développements nouveaux, qu'il s'agisse du conditionnement correct du puits, de l'interprétation des données du champ, ou surtout d'une manipulation adéquate des échantillons. Cet article insiste aussi sur le besoin d'un meilleur échange d'informations sur l'échantillonnage entre organisations, et rappelle le manque de normes industrielles à jour en matière d'échantillonnage des fluides. Il est proposé de constituer un projet industriel pour identifier et documenter les procédures adéquates.

  13. Bourse de recherche : Innovation en matière de vaccins pour le bétail

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 sept. 2017 ... Date butoir : le 6 septembre 2017 Prière de noter que toutes les demandes doivent être présentées en ligne. Cette bourse de recherche est accessible uniquement aux citoyens kenyans.

  14. , TOUCHE PAS À MA TERRE, I ! ' C'EST MA VIE !

    International Development Research Centre (IDRC) Digital Library (Canada)

    nouvelles lois afin d'assurer un plus grand contrôle sur leurs terres arables. C'est ... phénomène, du respect des réglementations locales de gestion foncière. ...... imposé dans la mesure où, l'Etat ayant octroyé les différents permis à. Newcrest ...

  15. J.M. Barrie : Les masques de Jacobus Hook Partie I/II : Le Capitaine Hook à Eton ou Le Solitaire1

    OpenAIRE

    Faivre, Céline-Albin

    2013-01-01

    Cette causerie n’aurait pas lieu si le Doyen ne m’avait pas lancé un défi. Je me trouvai ici le 4 juin dernier, lorsque, pendant le déjeuner, au beau milieu de son discours, le Doyen me mit au défi de réfuter cette terrible accusation : « James Hook, le Capitaine pirate, était un grand mais non pas un bon Etonien. » Or, à mon avis, Hook était un bon mais non pas un grand Etonien ; et c’est cette envie de vous en convaincre qui m’a poussé à venir ici cet après-midi, tout en sachant néanmoins q...

  16. Evénement Diversité - "Le Cerveau a-t-il un sexe ?" - C. Vidal

    CERN Multimedia

    CERN. Geneva

    2013-01-01

    L'objectif de cette conférence est de donner à comprendre lele de la biologie mais aussi l'influence de l'environnement social et culturel dans la construction de nos identités de femmes et d'hommes.

  17. Transfert du modèle prédictif d'épidémie de paludisme aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans les hautes terres d'Afrique de l'Est, les épidémies de paludisme sont en ... de facteurs non biophysiques dans la prévalence et le contrôle de cette maladie. ... IWRA/CRDI sur les changements climatiques et la gestion adaptive de l'eau.

  18. Le syndrome de la pince aorto-mésentérique: rare, mais pensez-y ...

    African Journals Online (AJOL)

    Le syndrome de la pince aorto-mésentérique «SPAM » ou syndrome de Wilkie, est une obstruction ... Les états de dénutrition avancés en sont souvent la caus e, et le SPAM se manifeste ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  19. Technical Evaluation Report on the Fluid Dynamics Panel Symposium on Validation of Computational Fluid Dynamics

    Science.gov (United States)

    1989-05-01

    separately each of the papers presented and makes general comments on the seven major topic sessions. In addition, a Poster Presentation was reviewed in...Appendix to this report. The Poster Papers, also listed in an Appendix, are published in CP437 Volume I. Le pr6sent rapport fait le point et donne une...ConfErence AGARD CP 437 Volume I dont une liste en est donn6e h I’annexe au pr6sent rapport. Une liste des r6unions d’information/exposition est

  20. Le sous-titrage : une pratique à la marge de la traduction

    Directory of Open Access Journals (Sweden)

    Dumas, Louise

    2014-12-01

    Full Text Available Le sous-titre interlinguistique est un objet difficile à appréhender théoriquement. S'il permet d'aller d'une langue à une autre, il implique aussi un passage de l'écoute à la lecture et du cinéma à l'écriture. Le caractère interlinguistique est souvent mis en avant pour amener à considérer le sous-titrage comme une traduction. Sa complexité médiologique suggère toutefois qu'il est plus qu'une traduction. En même temps, les fortes contraintes (exigence de brièveté, de lisibilité, de cohérence avec l'image cinématographique auxquelles il est soumis font qu'il est moins qu'une traduction – moins exact, moins long, moins « équivalent » au texte original. Le présent travail se propose de réfléchir de manière théorique aux rapports entre sous-titrage et traduction. Pour ce faire, nous confronterons le sous-titrage aux concepts fondamentaux de la traductologie. Premièrement, le passage de l'oral à l'écrit opéré dans les sous-titres est intimement lié à la distinction traductologique entre traduction et interprétariat. Pour pouvoir condenser les dialogues, résumer leur contenu, le sous-titreur est amené à les interpréter, ce qui permet de souligner l'étroite parenté entre traduction, interprétariat et interprétation. Deuxièmement, les fortes contraintes auxquelles sont soumis les sous-titres invitent à s'interroger sur la notion d'équivalence qui se trouve normalement au principe de toute traduction. Toutes les théories traductologiques insistent sur le fait qu'une équivalence n'est jamais parfaite et que le traducteur privilégie certains niveaux d'équivalence : en poussant à l'extrême cette dynamique de sélection constitutive de l'équivalence, on peut considérer que les sous-titres sont équivalents aux dialogues. En tant que cas limite, le sous-titrage permet de tester les concepts fondamentaux de la traductologie et de définir leurs limites.

  1. Être et exister: le cas de La Nausée

    NARCIS (Netherlands)

    Buuren, M.B. van

    2007-01-01

    Dans La Nausée, Jean-Paul Sartre oppose ‘exister’ à ‘être’. Exister, c’est la contingence, c’est la facticité, c’est la matière qui étouffe petit à petit Antoine Roquentin. L’existence lui inspire angoisse, répulsion et nausée. L’être, pale lueur d’espoir, s’y oppose comme le domaine de

  2. La metaphore est-elle la marque de l’insuffisance de l’esprit?

    Directory of Open Access Journals (Sweden)

    Isabelle Oliveira

    2010-01-01

    Full Text Available L’une des caractéristiques les plus communément reconnues à la discipline de la terminologie est sa conceptualité. Au contraire de l’opinion émise sur la métaphore, la terminologie s’efforce de travailler à partir de notions précises dont le sens doit être délimité et l’articulation à d’autres notions explicitée afin de bannir les ambiguïtés et les fausses évidences qu’elles véhiculent. Elle se distingue aussi du texte poétique caractérisé en particulier par la richesse des images et le jeu sur les signifiants. On comprend dès lors pourquoi la métaphore apparaît de prime abord comme une ennemie du champ de la terminologie qu’il faudrait bannir à tout prix. Cette figure de rhétorique consistant en un transport de sens risque à tout moment de rendre inopérant l’effort d’univocité et de rigueur du travail du terminologue. Mais la métaphore n’est pourtant pas absente des textes de spécialité. Il faut dès lors se demander si cette présence est « accidentelle”, contingente, ou si elle est incontournable et signifiante. Pour cela, il nous faudra étudier à la fois la place de la métaphore dans le texte de spécialité, et le discours des scientifiques portant sur elle. Mais une telle démarche nous laisse prisonnier de la dichotomie entre concept et métaphore et masque peutêtre une parenté inaperçue entre eux. Si le concept est habité par la métaphore, qu’en est-il du discours de spécialité? N’est-il pas réduit à n’être qu’un vaste poème qui ne s’avouerait pas comme tel? Est-elle seulement une figure de style ou aurait-elle un impact qui outrepasseraitsa modeste fonction discursive ? Il semble bien, même si le débat sur la métaphore et son usage est loin d’être clos. Notre théorie s’inscrit plutôt dans le sens d’une réévaluation du sens, d’une extension toujours plus grande de l’impact de ce trope qui, plus qu’une simple finalité esthétique, aurait une

  3. Dutch industry, smart(est) industry

    NARCIS (Netherlands)

    Sol, E.J.; Steinbuch, M.; Keulen, F. van; Houten, F.J.A.M.; Horst, T.J.J. van der

    2015-01-01

    Digitalisering verandert onze samenleving. De combinatie van opkomende technologieën, zoals het Internet, micro-sensoren, 3D-printing en big data maakt volledig nieuwe producten en diensten mogelijk. In de industrie wordt niet voor niets gesproken over een vierde industriële revolutie. Het is voor

  4. Le corps, instrument de connaissance du monde: la connaissance des Anciens Toltèques

    Directory of Open Access Journals (Sweden)

    Mabel Franzone

    2009-10-01

    Full Text Available Cet article traite le corps comme instrument de la connaissance de l’univers. Le corps s’étend vers des contrées infinies, se prolonge, atteint d’autres règnes, cherche l’unité absolue de ce qu’on appelle l’intention. L’intention est le mot clé pour les Anciens Toltèques, réunissant sous ce mot le visible et l’invisible, la volonté de la Nature et celle de l’univers. Le corps n’est qu’un instrument et pour arriver à le parfaire devons chercher la totalité de nous-mêmes, réussir la communication de deux côtés, droit et gauche, aller à la quête d’autres expériences, inimaginables. Les conditions nécessaires sont d’avoir un corps puissant et d’emmagasiner de l’énergie. Tout l’enseignement des sorciers est fondé dans un vrai changement de conception du monde et de la perception de ce monde. L’objectif final est celui de pouvoir choisir sa propre mort ; la vraie, la seule, l’unique liberté de l’homme.

  5. L’économie politique du désir dans le rituel et le militantisme au SriLanka

    Directory of Open Access Journals (Sweden)

    Wim Van Daele

    2013-03-01

    Full Text Available Le désir est au cœur des interactions complexes entre le développement et la religion. Cet article examine ses différentes expressions, comme étant une des préoccupations fondamentales de nombreuses religions, qui motivent à la fois le développement et les alternatives au développement. Au SriLanka, face au changement social, la forme néolibérale et mondialisée du développement est comprise et réinterprétée à travers des idiomes et des formations locales du désir. L’économie néolibérale cultive le désir et mène à un accroissement présumé de la présence des preta (fantômes affamés et avides qui se manifestent parfois au moment de la mort d’une personne. Les fantômes affamés, en tant que formations fétichisées du désir, trouvent un écho chez les consommateurs et les entrepreneurs, qui montrent unappétit insatiable vis-à-vis d’une richesse matérielle en constante croissance. Ainsi, l’apaisement ritualisé des fantômes affamés et le militantisme social de groupes tels que le Movement for National Land and Agricultural Reform (MONLAR sont clairement liés par leur préoccupation mutuelle face à l’insécurité existentielle des êtres humains et non humains, causée par un désir excessif et déséquilibré. L’action rituelle et le militantisme social divergent toutefois dans la formulation explicite de leurs préoccupations spécifiques concernant le désir. Le rituel matérialise et condense l’angoisse liée au désir, alors que le militantisme social décrit la fétichisation du désir en termes économiques, politiques et scientifiques plus abstraits.

  6. A la recherche de l'opérationnalité : le cas de l'agriculture familiale dans le Nordeste du Brésil

    OpenAIRE

    Caron, P.; Sabourin, E.; Sautier, D.; Gama da Silva, P.C.; Tonneau, J.P.

    1997-01-01

    Le projet d'appui au développement de l'agriculture familiale dans le Nordeste du Brésil a pour but de produire des références méthodologiques (analyse de situation et intervention) pour la recherche (identification de thèmes prioritaires), pour le développement (connaissances pour l'action) et pour la formation. Pour atteindre ces objectifs, l'équipe du projet est impliquée dans différentes opérations de développement conduites en partenariat avec des acteurs locaux, en assurant trois princi...

  7. Le Conseil des gouverneurs | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Conseil des gouverneurs guide le travail du CRDI en lui fournissant une orientation stratégique, en examinant ses activités et en approuvant ses budgets. Les gouverneurs – un maximum de 14 – sont nommés par le gouverneur en conseil du Canada pour un mandat d'au plus quatre ans, qui peut être reconduit. La Loi ...

  8. Le nouveau modèle africain | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 juil. 2011 ... L'annulation de la dette, un commerce plus équitable, davantage d'aide : voilà le plan d'action mondial dont on convient qu'il faut de toute urgence mettre en oeuvre en vue d'accélérer le développement en Afrique. Or, ce serait rater le bateau que de ne pas s'engager dans la voie tout autre que les ...

  9. LE RÈGNE DU SÉMIOTIQUE : Fondement de la poéticité du langage romanesque chez Ken Bugul

    Directory of Open Access Journals (Sweden)

    Christian Ahihou

    2011-11-01

    Full Text Available Le règne du sémiotique dans le langage a pour effet le passage au premier plan des formes du langage que sont notamment la musicalité et les jeux de mots. C’est vrai pour Ken Bugul qui a affirmé que : « La langue maternelle, c’est des sentiments, des odeurs, des sonorités, des attouchements. C’est la langue de ma mère et non la langue de la mère de tout le monde ». Certes, le signe ne perd pas sa signification, mais il subit la domination du caractère poétique du langage qui le porte.

  10. Vécu et représentation de l'ulcère de Buruli dans le district sanitaire ...

    African Journals Online (AJOL)

    Ulcère de Buruli et de déterminer le vécu de la maladie. Il s'est agi d'une étude prospective qui s'est déroulée dans le District Sanitaire de Sotouboua d'Août à septembre 2008. Les 35 malades inclus dans l'étude ont été identifiés à partir des ...

  11. Systèmes de Gestion de Production et Systèmes de Contrôle de Gestion

    OpenAIRE

    Travaillé , Denis

    2009-01-01

    L'interrogation fondamentale des travaux de recherche porte sur la question de la séparabilité et de l'interaction entre système de gestion de production et système de contrôle de gestion. Le premier temps de la réflexion concerne la spécificité du contrôle de gestion en contexte de "Juste-à-Temps. Le second temps de la recherche est relatif aux systèmes d'information de production intégrés en relation avec le système de contrôle de gestion et au rôle des représentations comptables dans la qu...

  12. The Vein-type Zn-(Pb, Cu, As, Hg) mineralization at Fedj Hassene ore field, North-Western Tunisia: Mineralogy, Trace Elements, Sulfur Isotopes and Fluid Inclusions; Le champ filonien a Zn-(Pb, Cu, As, Hg) du district minier de Fedj Hassene (Nord Ouest de la Tunisie): Mineralogie, Elements en traces, Isotopes du Soufre et Inclusions Fluides

    Energy Technology Data Exchange (ETDEWEB)

    Bejaouil, J.; Bouhlel, S.; Barca, D.; Braham, A.

    2011-07-01

    The Fedj Hassene district is localized at the edge of the Tuniso-Algerian border 10 km of Ghardimaou area. It consists of a Zn-Pb vein type with minor amounts of Cu-As-Hg. The total Zn reserves are about 370.000t. The mineralization occurs within sub parallel fractures to the Ain El Kohla ESE-WNW fault. Host rocks consist of limestones and marly limestones of the Middle Turonian. In the principal lode of Fedj Hassene, the mineralization occurs as vein filling of massive and brecciated brown sphalerite and minor galena ore with gangue. Other trace minerals are pyrite, chalcopyrite, orpiment, realgar, smithsonite and cerussite. LA-ICP-MS analyses in sphalerites show mean contents of 0,84 wt% Fe, 0,14 wt% Cd and 0,02 wt% Mn Ore. Fluid inclusions study in calcite and sphalerite reveals one mineralizing fluid characterized by an average salinity 23% wt NaCl with decreasing homogenisation temperature. In fact the temperature shows decrease from sphalerite to calcite. The fluid density that corresponds to trapping pressure ranges between 1.00 g/cm{sup 3} and 1.11 g/cm{sup 3} and pressure close to 200 bars. Micro thermometric data in fluid inclusion hosted by gangue mineral presented by calcite show an average temperature of formation around 194 degree centigrade. These inclusions homogenized to the liquid phase between 156 degree centigrade and 210 degree centigrade and salinities values ranging from 22 to 28 wt% NaCl and an average around 23% wt NaCl. The {delta}{sup 3}4S (VCDT) values of sphalerite are in the range of + 4,6% to 6,4% (average=5,6%). Thermochemical reduction of Triassic sulfate by reaction with hydro-carbons is the most probable source for the heavy and the narrow range of the d{delta}{sup 3}4S values. Mineralogical, geochemical of trace elements, fluid inclusions and sulfur isotopes studies allow to include the vein-type ore field of Fedj Hassene in the polymetallic (Pb-Zn-As-Hg) vein mineralization of the nappe zone in northern Tunisia and north eastern

  13. Les géographes et le patrimoine

    Directory of Open Access Journals (Sweden)

    Anne Herzog

    2011-12-01

    Full Text Available Le patrimoine : l’émergence d’un objet dans les champs de recherche des géographes, révélateur d’une géographie conçue comme science de l’espace des sociétésLe patrimoine est devenu un objet commun des géographes. Dans un article de 2007, Vincent Veschambre montre clairement l’émergence des problématiques patrimoniales dans la géographie française contemporaine durant les années 1990, tout en soulignant l’entrée tardive et décalée des géographes dans « le concert patrimonial » par rapport à d...

  14. SYSTÈMES COMPTABLES DANS LE CONTEXTE DE LA MONDIALISATION

    Directory of Open Access Journals (Sweden)

    Loredana Oana Hutanu (Toma

    2013-09-01

    Full Text Available La comptabilité joue un rôle important dans les politiques économiques nationales et internationales et analysées dans le contexte de la mondialisation économique, l’harmonisation des normes comptables, a donné lieu au fil du temps, à une source continue de controverse. L'évolution de la comptabilité dans le contexte actuel est caractérisée par un phénomène d'harmonisation et de normalisation internationale. Cet article veut faire connaitre au public les deux principaux systèmes comptables existants et leur besoin d'harmonisation.

  15. Magic turtle dans le canton du Jura: concept marketing

    OpenAIRE

    Hauser, Magali; Perruchoud-Massy, Marie-Françoise

    2012-01-01

    Depuis juin 2009, Saint-Ursanne/Clos du Doubs est une région pilote du Projet Enjoy Switzerland/ASM ayant pour but d’intervenir sur le développement et la sensibilisation du tourisme dans la région. En parallèle, la Maison du Tourisme, entreprise proposant principalement des offres touristiques dans la région, a ouvert ses portes l’année dernière. Ces deux entités ont travaillé ensemble afin de développer une nouvelle offre touristique intitulée « Magic turtle ». Le Magic turtle, pensé par de...

  16. Quand les sens font sens : traduire le "texte" filmique

    OpenAIRE

    Bonnot, Charles; Brisset, Frédérique; Bruti, Silvia; Caschelin, Sylvain; Cerezo Merchán, Beatriz; de los Reyes Lozano, Julio; Filanti, Rita; Lievois, Katrien; Loison-Charles, Julie; Perrier, Marie; Trainor, Samuel; Zanotti, Serenella

    2017-01-01

    Ce numéro 30 de la revue Palimpsestes s’articule en trois grandes parties. La première partie est dédiée aux sens dans les transferts intersémiotiques. La deuxième s’attache à des formes plus traditionnelles de traduction audiovisuelle, le doublage de séries télévisées, puis de films d’animation pour enfants, le traitement de la voix off dans un film adapté d’un roman noir et le sous-titrage des mots tabous dans les films multilingues. La dernière partie fait intervenir des spécialistes de TA...

  17. Fluids engineering

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    Fluids engineering has played an important role in many applications, from ancient flood control to the design of high-speed compact turbomachinery. New applications of fluids engineering, such as in high-technology materials processing, biotechnology, and advanced combustion systems, have kept up unwaining interest in the subject. More accurate and sophisticated computational and measurement techniques are also constantly being developed and refined. On a more fundamental level, nonlinear dynamics and chaotic behavior of fluid flow are no longer an intellectual curiosity and fluid engineers are increasingly interested in finding practical applications for these emerging sciences. Applications of fluid technology to new areas, as well as the need to improve the design and to enhance the flexibility and reliability of flow-related machines and devices will continue to spur interest in fluids engineering. The objectives of the present seminar were: to exchange current information on arts, science, and technology of fluids engineering; to promote scientific cooperation between the fluids engineering communities of both nations, and to provide an opportunity for the participants and their colleagues to explore possible joint research programs in topics of high priority and mutual interest to both countries. The Seminar provided an excellent forum for reviewing the current state and future needs of fluids engineering for the two nations. With the Seminar ear-marking the first formal scientific exchange between Korea and the United States in the area of fluids engineering, the scope was deliberately left broad and general

  18. INFLUENCE DES TEMPERATURES OPERATIONNELLES SUR LA PERFORMANCE D’UN REFRIGERATEUR SOLAIRE A ADSORPTION QUI FONCTIONNE AVEC LE COUPLE CHARBON ACTIF-METHANOL

    OpenAIRE

    H SOUALMI; Z SAADI; A RAHMANI

    2014-01-01

    Le séchage des produits alimentaires au soleil est un moyen efficace, facile et économique pour conserver les aliments, en particulier les fruits. Le séchoir solaire est l'équipement le plus populaire pour le séchage des fruits. En raison de la nature intermittente de l'énergie solaire, le stockage de l'énergie thermique est nécessaire pour assurer un fonctionnement prolongé du séchoir. L'objectif principal de cette étude est d'évaluer l'efficacité du séchoir solaire intégré avec un lit en gr...

  19. Modèle de compaction élasto-plastique en simulation de bassins Elastoplastic Compaction Model for Basin Simulation

    Directory of Open Access Journals (Sweden)

    Schneider F.

    2006-11-01

    Full Text Available Cet article présente un modèle de compaction des sédiments pour simulateurs de bassins sédimentaires. Dans ce modèle, les concepts précédemment utilisés dans le modèle TEMISPACK sont généralisés et décrits en s'inspirant des formalismes propres à la mécanique des roches et à la mécanique des sols. La compaction des sédiments est décrite, à l'échelle des temps géologiques, par un modèle élasto-plastique où les modules d'incompressibilité et d'écrouissage croissent lorsque la déformation augmente et où le seuil de plasticité est variable. La rhéologie est définie par une relation qui lie la porosité (ou le volume du sédiment à la contrainte effective moyenne en se plaçant dans l'hypothèse de déformation oedométrique. Ce modèle à rhéologie volumiquea été testé sur le logiciel COMP1D qui simule, en 1D, l'histoire géologique d'une colonne sédimentaire. Ce modèle ne doit être considéré que comme un premier pas vers un formalisme plus complet. This article describes a sediment compaction model for sedimentary basin simulators. In this model, the concepts previously used in the TEMISPACK model are generalized and described on the basis of formalisms inherent in rock mechanics and soil mechanics. Sediment compaction is described on the geologic time scale by an elastoplastic model (Fig. 1 in which the moduli of incompressibility and strain hardening increase as deformation increases and in which the plasticity threshold varies. The rheology is defined by an equation connecting the porosity (or volume of the sediment to the mean effective stress by situating itself within the hypothesis of consolidometric deformation. This model is quite similar to the ones used in soil mechanics. It differs only by the choice of the equations linking the volumic variation of the porous medium to the variation of the mean effective stress likewise, in this part coefficient alpha introduced in the definition of effective

  20. La piraterie sur le web

    CERN Multimedia

    2002-01-01

    Les échanges de toutes sortes sont facilités à l'extrême par le web: des forums, des vidéoconférences, le commerce à distance, ou tout simplement la célérité des courriers électroniques ou la convivialité des chats, tout cela participe de la société de communication. Une certaine partie du monde découvre le nouvel horizon des échanges quasi instantanés, mais... les transactions sur le web sont-elles vraiment s res?

  1. Lele de l'information en droit des entreprises en difficulté

    OpenAIRE

    Ould Eba, Moussa

    2013-01-01

    L’information est un moyen de gestion fiable et une garantie indispensable pour la protection des intérêts des acteurs de l’activité économique. Elle joue un rôle important dans la prévention et le traitement des difficultés des entreprises. En effet, à la lumière des informations comptables, financières et sociales, les dirigeants peuvent prévenir les difficultés et prendre les décisions adaptées à la situation de l’entreprise. Toutefois, en cas de procédures collectives, le besoin de protec...

  2. Le pouvoir de la règle

    Directory of Open Access Journals (Sweden)

    Olivier Ihl

    2011-06-01

    Full Text Available La réforme du mode de scrutin ne manque jamais en France de soulever les plus vives controverses. Quelle que soit son ampleur, elle provoque des réactions passionnées, et déjà chez ceux dont la position dépend des configurations de jeu que cette règle délimite. Quel est au juste le pouvoir de régulation d’un mode de scrutin ? De quelle force bénéficie ce type de disposition électorale ? Si le vote est un procédé par lequel les voix recueillies conditionnent une décision collective, ce que l’o...

  3. Trajet entre le réel et la fiction.

    Directory of Open Access Journals (Sweden)

    Véronique Mauron

    2011-04-01

    Full Text Available Au départ, il y a un contrat: un trajet en taxi est offert à un habitant de Sao Paulo en contrepartie d’une histoire racontée. C’est l’idée directrice du film, proposée par l’artiste Fabiana de Barros au cinéaste suisse Michel Favre. À l’arrière d’une voiture, se trouve l’artiste qui accueille un passager et qui lui soumet, en guise de support mental, une image que le spectateur ne voit pas. Cette image déclenche la prise de paroles, le trajet peut commencer dans ...

  4. Buffer fluid

    Energy Technology Data Exchange (ETDEWEB)

    Mirzadzhanzade, A Kh; Dedusanko, G Ya; Dinaburg, L S; Markov, Yu M; Rasizade, Ya N; Rozov, V N; Sherstnev, N M

    1979-08-30

    A drilling fluid is suggested for separating the drilling and plugging fluids which contains as the base increased solution of polyacrylamide and additive. In order to increase the viscoelastic properties of the liquid with simultaneous decrease in the periods of its fabrication, the solution contains as an additive dry bentonite clay. In cases of the use of a buffer fluid under conditions of negative temperatures, it is necessary to add to it table salt or ethylene glycol.

  5. PAVE: Program for assembling and viewing ESTs

    Directory of Open Access Journals (Sweden)

    Bomhoff Matthew

    2009-08-01

    Full Text Available Abstract Background New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. Results The PAVE (Program for Assembling and Viewing ESTs assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. Conclusion The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  6. PAVE: program for assembling and viewing ESTs.

    Science.gov (United States)

    Soderlund, Carol; Johnson, Eric; Bomhoff, Matthew; Descour, Anne

    2009-08-26

    New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. The PAVE (Program for Assembling and Viewing ESTs) assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  7. INFLUENCE DE L’EPAISSEUR SUR LE COEFFICIENT DE DILATATION THERMIQUE DE LA TOLE ALMGSI

    Directory of Open Access Journals (Sweden)

    S SAADALLAH

    2014-12-01

    Full Text Available L’objectif de cet article est l’étude de l’influence de l’épaisseur sur le coefficient de dilatation thermique de la tôle AlMgSi. Les résultats obtenus dépendent fortement de l’épaisseur. Les courbes dilatométriques varient d’une direction à une autre. Il y a présence d’une anisotropie dont l’intensité dépend de l’épaisseur et de la direction de mesure. L’échantillon prélevé selon la direction Y et dont l’épaisseur est de 1.15mm présente une dilatation faible devant les autres. Ce comportement le rend intéressant dans le domaine industriel.

  8. Nouveautés sur le rétrécissement valvulaire aortique

    OpenAIRE

    Pibarot, Philippe; Dumesnil, Jean G.; Mathieu, Patrick

    2007-01-01

    En Occident, le rétrécissement aortique (RA) est la maladie cardiovasculaire la plus fréquente après la maladie coronarienne et l’hypertension artérielle. La cause la plus fréquente de cette pathologie est le RA dégénératif dont le vieillissement a longtemps été considéré comme la cause inéluctable. Des données récentes suggèrent cependant que le RA serait une maladie active présentant de nombreuses similitudes avec l’athérosclérose et, de ce fait, susceptible d’être traitée grâce à des chang...

  9. Effet des conditions climatiques sur le niveau du lac Sidi Ali (Moyen Atlas, Maroc)

    OpenAIRE

    Sayad, Ahmed; Chakiri, Saïd; Martin, Claude; Bejjaji, Zohra; Echarfaoui, Hassan

    2012-01-01

    Le lac Sidi Ali est un lac naturel d'altitude (2070-2080 m), sans exutoire superficiel, déterminé par le barrage d'une coulée basaltique. Doté d'un bassin versant apparent de 15,6 km2, il est alimenté par des eaux de ruissellement et par des sources karstiques. Son niveau subit des variations très fortes, annuelles et interannuelles, sous le contrôle des conditions climatiques, et en particulier des pluies et de l'évapotranspiration. Les périodes de sécheresse qui ont marqué les trois dernièr...

  10. SNP-finding in pig mitochondrial ESTs

    DEFF Research Database (Denmark)

    Scheibye-Alsing, Karsten; Cirera Salicio, Susanna; Gilchrist, M.J.

    2008-01-01

    The Sino-Danish pig genome project produced 685 851 ESTs (Gorodkin et al. 2007), of which 41 499 originated from the mitochondrial genome. In this study, the mitochondrial ESTs were assembled, and 374 putative SNPs were found. Chromatograms for the ESTs containing SNPs were manually inspected, an......, and 112 total (52 non-synonymous) SNPs were found to be of high confidence (five of them are close to disease-causing SNPs in humans). Nine of the high-confidence SNPs were tested experimentally, and eight were confirmed. The SNPs can be accessed online at http://pigest.ku.dk/more.mito...

  11. Ortodoncia estética invisible

    OpenAIRE

    Chávez Sevillano, Manuel Gustavo; Soldevilla Galarza, Luciano

    2014-01-01

    El adulto suele ofrecer resistencia a los convencionales tratamientos ortodóncicos, debido a la necesidad de llevar brackets visibles, tanto metálicos como estéticos de porcelana. El concepto de Ortodoncia Estética Invisible u Ortodoncia Lingual cubre las expectativas de este tipo de pacientes. La técnica multibrackets con aparatología lingual tiene aproximadamente 25 años de desarrollo y con la experiencia de los casos tratados, se ha llegado a la concepción de una técnica completamente prot...

  12. Le Conseil des gouverneurs | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 nov. 2010 ... La gouvernance du CRDI. Reddition de comptes, transparence et efficacité. Au cours de l'exercice 2009–2010, le Conseil des gouverneurs du CRDI a adopté un nouveau cadre stratégique quinquennal, Le développement par l'innovation. Pendant de nombreux mois, les gouverneurs et les membres de la ...

  13. Le tumulus Apatesaro VI (Compte-rendu de fouilles 1990.

    Directory of Open Access Journals (Sweden)

    Jacques Blot

    1992-01-01

    Full Text Available El túmulo pedregoso de Apatesaro VI, excavado en 1990, mide 7 metros de diámetro y 0.20 metros de altura. Este amontonamiento de piedras presenta cierta organización : distribución de bloques   del túmulo en 3 zonas según sus dimensiones ; cista central con depósito de carbones de leña, pero sin ajuar. La fecha : 1267-1005 av. J.C., perteneciente por tanto al Bronce final, hace de este monumento uno de los más antiguos de esta necrópolis.

  14. Crise alimentaire recente dans le troisieme arrondissement de ...

    African Journals Online (AJOL)

    L'objectif de cette recherche est d'étudier les répercussions de la récente crise alimentaire sur les ménages de même que les stratégies développées en réaction aux effets de la crise. La démarche méthodologique adoptée dans le cadre de cette recherche est essentiellement basée sur la recherche documentaire et les ...

  15. Le developpement olympique du kayak Africain : Anglophonie vs ...

    African Journals Online (AJOL)

    Si le kayak de slalom s'est développé récemment en Afrique (premier Championnat continental organisé en 2009), il a été médiatisé à la faveur de sa reconnaissance olympique. Mais quels sont les enjeux culturels du développement olympique du kayak en Afrique francophone ? Comment cette activité a-t-elle pu ...

  16. Communiquez avec nous | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Communiquez avec nous. Le siège social du CRDI est situé à Ottawa, au Canada. Nos quatre bureaux régionaux nous permettent de rester proches de nos chercheurs et des projets que nous finançons en Asie, en Amérique latine et dans les Caraïbes, au Moyen-Orient et en Afrique du Nord, ainsi qu'en Afrique ...

  17. Publications | Page 45 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans les pays en développement, le manque de diversité dans l'alimentation est l'une des principales causes de la malnutrition et de la prévalence de maladies ... et une perte de diversité des cultures locales, ce qui a eu une incidence négative sur la sécurité alimentaire et la résilience face aux changements climatiques.

  18. Gestion des agroecosystemes sur le mont agou en zone forestiere ...

    African Journals Online (AJOL)

    Dans le but d'une meilleure mise en valeur de l'espace, plusieurs espèces végétales sont cultivées en association essentiellement avec Persea americana. L'approche méthodologique est basée sur des inventaires floristiques et écologiques sur 45 placettes de 25 m x 25 m dans les agrosystèmes. Une diversité de 85 ...

  19. Enjeux et enseignements | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 janv. 2011 ... En fait, le développement proprement dit est généralement associé à ces transitions dangereuses et prometteuses — transitions de la dictature à la démocratie, d'économies défaillantes à des marchés bien gérés, de la guerre à la paix. Malgré les risques et les renversements subits qu'elles comportent, ...

  20. 2225-IJBCS-Article-Koussi Angèle

    African Journals Online (AJOL)

    hp

    teneur importante en lipides du soja lui confère un bon pouvoir calorifique. Par ailleurs, la consommation des aliments sources de protéines végétales (les légumineuses) est à encourager car elles sont disponibles et peu coûteuses par rapport aux protéines animales. En outre, la supplémentation des céréales par le soja ...

  1. La redécouverte du droit : le trajet parcouru

    NARCIS (Netherlands)

    Hesseling, G.S.C.M.; Oomen, B.M.

    2005-01-01

    Au Mali, l'année 1991 marque la fin du régime autoritaire de la IIe République et le début d'une ère plus démocratique. En février 1993 est votée la loi-cadre sur la décentralisation. Au moment où, en 2001, les premiers juristes commencent leur aventure de recherche - qui aboutira à l'ouvrage

  2. Sociologie D'une Revolte Armee: Le Cas de Libye

    African Journals Online (AJOL)

    part, appuyés par la police de l'ordre public, provoquant ainsi des morts parmi les .... Elle garantit aussi au prisonnier de guerre le droit à la dignité, au respect ... 5 Déclaration de l'ancien gouverneur du B.C.l, farhat Ben ghdara à la presse internationale et ..... Une société civile n'est elle pas, par définition, l'antipode, voire.

  3. Des drones survolant le delta | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 nov. 2016 ... Photo prise par un drone survolant la ville de Fuvemeh. Appeaning-Addo et al. 2015. Les vagues balayant le rivage de Fuvemeh, une ville ghanéenne qui est située près du delta du fleuve Volta et que menacent les inondations et l'érosion des côtes. Par Brian Owens, Canadian Geographic. La région du ...

  4. Canada : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La chimiothérapie est la principale forme de traitement du cancer, mais elle ne peut pas guérir la plupart des types de cancers. Région: Canada, Israel, China. Programme: Programme de recherche en santé Canada-Israël. Financement total : CA$ 670,000.00. Cibler les cellules sénescentes dans le cancer du pancréas.

  5. Publications | Page 75 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Effets de la coupe des feuilles et de la transplantation des jeunes plants sur la consommation hydrique et la croissance du mil (Pennisetum glaucum [L.] R.Br.) au Niger : mémoire de fin de cycle (restricted access). Le mil (Pennisetum glaucum [L.] R. Br.) est la plante alimentaire la plus cultivée dans la zone sahélienne du ...

  6. Pharmacogénétique: qu'en est-il au Maroc?

    Science.gov (United States)

    Idrissi, Meryem Janati; Ouldim, Karim; Amarti, Afaf; El Hassouni, Mohamed; Khabbal, Youssef

    2013-01-01

    La pharmacogénétique est l’étude de l'influence des variations génétiques interindividuelles sur la réponse aux médicaments, avec le but d'améliorer la prise en charge des patients en visant une médecine personnalisée. Au fait le génome de deux personnes ne diffère que par 0.1% des 3.2 milliards de paires de bases, ce qui implique les effets indésirables des médicaments, qui ont un très important impact sur le plan clinique que sur le plan économique. Or cette dernière décennie ces effets indésirables ont pu être évités grâce aux tests pharmacogénétiques. Au Maroc, la recherche en pharmacogénétique commence à susciter l'intérêt des chercheurs avec quelques études. Une toute première étude en 1986, sur l'acétylation de l'isoniazide chez la population marocaine, suivie par deux autres en 2011 se focalisant sur le métabolisme du tacrolimus et des anti-vitamines K. Ainsi l'espoir maintenant est d'identifier les majoritaires polymorphismes génétiques affectant les patients marocains, afin de leur fournir une prise en charge adaptée. PMID:23785548

  7. Le principe roman

    CERN Document Server

    Ferrari, Jérôme

    2015-01-01

    Fasciné par la figure du physicien allemand Werner Heisenberg (1901-1976), fondateur de la mécanique quantique, inventeur du célèbre "principe d'incertitude" et Prix Nobel de physique en 1932, un jeune aspirant-philosophe désenchanté s'efforce, à l'aube du XXIe siècle, de considérer l'incomplétude de sa propre existence à l'aune des travaux et de la destinée de cet exceptionnel homme de sciences qui incarne pour lui la rencontre du langage scientifique et de la poésie, lesquels, chacun à leur manière, en ouvrant la voie au scandale de l'inédit, dessillent les yeux sur le monde pour en révéler la mystérieuse beauté que ne cessent de confisquer le matérialisme à l'œuvre dans l'Histoire des hommes.

  8. Le consentement libre et éclairé aux soins en psychiatrie

    Science.gov (United States)

    Neilson, Grainne; Chaimowitz, Gary

    2015-01-01

    Résumé Le patient a le droit d’être informé sur les soins de santé qui lui sont proposés et de participer activement à la prise de décisions relativement à ces soins. Le respect de la dignité et de l’autonomie de la personne passe par le respect de son droit de prendre des décisions à propos de ses soins psychiatriques, notamment de refuser un traitement, pour autant qu’elle soit apte à prendre des décisions. Il importe que le psychiatre connaisse les fondements éthiques du consentement libre et éclairé et les exigences prévues par le droit en cette matière, y compris la jurisprudence. Le consentement n’est pas immuable, pouvant changer avec le temps, au fil de l’évolution des conditions et des circonstances. Par conséquent, le consentement doit être un processus continu.

  9. Le nouveau modèle québécois axé sur la gouvernance

    Directory of Open Access Journals (Sweden)

    Jeffrey Roy

    2002-10-01

    Full Text Available L'article soutient qu'il a bien eu un modèle québécois de développement, mais il est devenu inefficace et remis en question. Ce modèle se distinguait par son interventionniste étatique dynamique et par la constitution d'alliances entre les différents partenaires sociaux. Mais les fondements d'un modèle performant tels que l'étatisme et le nationalisme civique sont devenus empreints de faiblesses et d'insuffisances que l'utilisation du concept de gouvernance permet d'identifier. Le concept se définit comme étant « la coordination efficace de l'ensemble des activités d'une entité socio-économico-politique quand les ressources, le pouvoir et l'information sont vastement distribués ». Malgré l'inefficacité décrite, il est possible de repenser le modèle québécois de développement par la construction des communautés qui s'appuie sur la régionalité et la socialité. Finalement, le renouveau s'appuierait sur une stratégie de-gouvernance pour un meilleur usage de l'intelligence collective et des cités-régions intelligentes.The article supports that it indeed had a Quebecois model of development, but it became ineffective and questioned. This model distinguished itself by his(her dynamic state interventionist and by the constitution of alliances among the various social partners. But the foundations of a successful model such as the state control and the civil nationalism became printed by weaknesses and by incapacities which the use of the concept of governance allows to identify. The concept defines itself as being « the effective coordination of all the activities of an entity « socio-économico-politique » when the resources, the power and the information are distributed spaciously » Meanwhile the described ineffectiveness, it is possible to rethink the Quebecois model of development by the construction of the communities which leans on the regionality and the sociality. Finally, the flourish would lean on a strategy

  10. Partenariats pour le développement de la capacité en matière de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Afrique est particulièrement démunie à cet égard — elle n'est pas seulement le ... L'Initiative internationale pour un vaccin contre le sida (IAVI) et le projet de ... Cela comporte un soutien à long terme afin de créer à la fois une capacité de ...... L'idée à l'origine du CREA était un regain d'espace pour la recherche qui ...

  11. : tous les projets | Page 17 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ces dernières années, c'est en Amérique latine qu'on a observé le nombre le plus élevé de cas de dengue, soit au Brésil, en Colombie et au Mexique. Région: Brazil, Colombia, Mexico. Programme: Food, Environment, and Health. Financement total : CA$ 999,100.00. Prévenir les maladies liées au virus Zika avec de ...

  12. : tous les projets | Page 108 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative Think tank (ITT) et le Think Tank Fund (TTF) s'associent pour soutenir des collaborations entre pairs entre les think tanks établis dans les régions où oeuvrent l'ITT (Afrique, Amérique latine et Asie du Sud) et le TTF (Europe centrale, Europe de l'Est et ancienne Union soviétique). Date de début : 1 novembre 2013.

  13. Effets du charbon actif dans le milieu de culture sur l'induction de la ...

    African Journals Online (AJOL)

    SARAH

    30 avr. 2014 ... Conclusion et application de la recherche : L'ajout du charbon actif est bénéfique pour le développement .... développement du système racinaire et de ..... génotypes sélectionnés. Compte rendu. Premier séminaire maghrébin sur la génétique de la résistance du palmier dattier. Projet de lutte contre le.

  14. Amélioration de la nutrition en Éthiopie par le truchement de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Amélioration de la nutrition en Éthiopie par le truchement de la sélection végétale et de la gestion des sols (FCRSAI). L'Éthiopie présente l'un des plus hauts taux de malnutrition au monde. La situation est particulièrement grave dans le sud du pays en raison de la faible productivité agricole et du régime alimentaire ...

  15. : tous les projets | Page 607 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La collectivité de Craigieburn, dans la province du KwaZulu-Natal, en Afrique du Sud, est située dans un milieu humide couvrant 1 200 ha et jouant un rôle de premier plan dans la régulation et le maintien de la Sand River. Date de début : 18 juin 2006. End Date: 15 mars 2010. Sujet: RIVER BASINS, WETLANDS, LAND ...

  16. Tanzanie | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La Tanzanie est un pays visé par le programme Innovation pour la santé des mères et des enfants d'Afrique, une initiative financée par plusieurs bailleurs de fonds. Les chercheurs ... émergentes. Les politiques rationnelles d'efficacité énergétique jouent un rôle crucial dans la lutte contre les changements climatiques.

  17. Repenser l'évaluation | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 oct. 2010 ... Toutefois, dans le monde en évolution rapide qui est le nôtre, comment faudrait-il évaluer les méthodes d'évaluation ? Cette question était au coeur d'un récent débat d'experts à l'Université Carleton, organisé par l'International Program for Development Evaluation Training (IPDET), la Banque mondiale et ...

  18. Méditerranée asiatique : un modèle urbain polycentrique

    OpenAIRE

    Gipouloux , François

    2012-01-01

    Publication de la revue "Diplomatie. Affaires stratégiques et relations internationales" http://www.diplomatie-presse.com/; International audience; En Asie orientale, un corridor maritime a pris forme autour de plates-formes logistiques et portuaires, fidèles au modèle de Hong Kong. C'est là que bat le coeur de l'économie régionale.

  19. SYSTEME MULTISENSEUR DE PERCEPTION 3D POUR LE ROBOT MOBILE HILARE

    OpenAIRE

    Ferrer , Michel

    1982-01-01

    L'ETUDE PRESENTEE S'INSERE DANS LE VASTE DOMAINE DE LA VISION ARTIFICIELLE. ELLE CONCERNE PLUS PARTICULIEREMENT L'INTEGRATION DU SYSTEME DE PERCEPTION TROIS DIMENSIONS (3D) DU ROBOT MOBILE AUTONOME HILARE. CE SYSTEME EST COMPOSE D'UNE CAMERA MATRICIELLE A SEMICONDUCTEURS, D'UN TELEMETRE LASER ET D'UNE STRUCTURE MECANIQUE ASSURANT LA DEFLEXION DU FAISCEAU LASER. DANS CE MEMOIRE SONT DECRITS: LA CONCEPTION DE LA STRUCTURE DEFLECTRICE; LE LOGICIEL DE TRAITEMENT DES IMAGES VIDEO MULTINIVEAUX BASE...

  20. Le syndrome de sevrage nicotinique après chirurgie cardiaque: à ...

    African Journals Online (AJOL)

    L'agitation post-opératoire constitue une pathologie extrêmement fréquente. Les étiologies à évoquer en réanimation sont nombreuses. Le syndrome de sevrage à la nicotine est une cause possible mais rarement évoquée. Nous rapportons le cas d'un patient tabagique qui a été admis en unité de soins intensifs pour un ...

  1. Comment les travaux de recherche subventionnés par le CRDI ont ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 oct. 2010 ... Un engagement à long terme s'impose si l'on veut opérer des changements salutaires et durables dans les pays en développement. Depuis 1970, le CRDI soutient des travaux de recherche qui poursuivent ce but précis. Pour marquer son 40e anniversaire, le Centre s'est penché sur quelques-uns des ...

  2. Amélioration de la gouvernance du secteur piscicole dans le bassin ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    depuis l'introduction du paiche (Arapaima gigas). La deuxième se trouvait dans le sud-est du bassin, où l'on fait l'élevage d'espèces indigènes comme le tambaqui. (Piaractus brachypomus). Premières incidences. Émergence de leaders locaux par recherche-action. L'un des principaux résultats fut de réunir les pêcheurs.

  3. Le phosphore limite-t-il la production intensive du riz dans la plaine ...

    African Journals Online (AJOL)

    admin

    Le phosphore (P) est un élément important dans la nutrition minérale du riz et dans l'élaboration du rendement paddy. Des essais soustractifs ont été conduits en milieu paysan dans la plaine rizicole de Bagré au cours de trois campagnes successives pour évaluer l'effet de l'application de P sur le rendement paddy. La.

  4. Après le Brexit, un diagnostic lucide sur l'avenir de l'Union européenne

    OpenAIRE

    Kahn, Sylvain

    2016-01-01

    Faut-il être traumatisé par le Brexit? Le cas des Britanniques est très particulier. Ils sont entrés à reculons dans l'Union européenne en 1973, et ils ont tout de suite commencé par demander des clauses d'exemption. L'UE et les Britanniques, concrètement qu'est-ce que c'est? C'est un pays qui, depuis 43 ans, ne cesse de s'opposer autant que possible à toute avancée fédérale, à davantage d'intégration, et promeut une Europe à la carte. C'est d'ailleurs le seul pays avec le Danemark qui avait ...

  5. Performance Analysis of Compositional and Modified Black-Oil Models For a Gas Lift Process Analyse des performances de modèles black-oil pour le procédé d’extraction par injection de gaz

    Directory of Open Access Journals (Sweden)

    Mahmudi M.

    2013-03-01

    galement atteinte, avec un coût minimum du calcul, par l’utilisation de modèles modifiés de type black- oil des fluides. Le modèle modifié de black-oil est un outil performant dans le cas où un nombre élevé d’itérations du modèle est nécessaire pour trouver les combinaisons optimales des paramètres du procédé d’extraction par injection de gaz.

  6. Schroedinger fluid

    International Nuclear Information System (INIS)

    Kan, K.K.

    1983-01-01

    The relationship of nuclear internal flow and collective inertia, the difference of this flow from that of a classical fluid, and the approach of this flow to rigid flow in independent-particle model rotation are elucidated by reviewing the theory of Schroedinger fluid and its implications for collective vibration and rotation. (author)

  7. 9. Le contemporain et l’anachronique : un palimpseste inverse chez Jacques Ferron

    OpenAIRE

    Méchoulan, Éric

    2018-01-01

    « Derrière le portrait mortuaire de l’abbé Armour Lupien, on n’inscrivit qu’une phrase et elle était de lui : “C’est le fils qui a engendré le Père et, sans Jésus mourant sur le calvaire, il n’y aurait pas de Dieu.” Elle passa inaperçue. »Jacques Ferron, Le Saint-Élias Terminons, comme nous avons commencé, par un exemple littéraire. Non pour les privilèges à accorder en soi à la littérature, mais bien parce que la littérature a justement été instituée dans ce creuset instable de la culture de...

  8. Lele de l’audit interne dans le pilotage et la performance du système de contrôle interne : cas d’un échantillon d’entreprises algériennes

    OpenAIRE

    Chekroun, Meriem

    2013-01-01

    Les scandales financiers qui ont ébranlé récemment les entreprises publiques algériennes, telle que l’entreprise Sonatrach, ont mis sur le devant de la scène la nécessité de renforcer le système de contrôle interne (SCI) qui est considéré de plus en plus comme une solution à un large éventail de problèmes latents ( les problèmes d’ordre éthique,…), y compris la fonction d’audit interne ayant un rôle prépondérant dans le pilotage et la performance du SCI. Pour ce faire, l’audit ...

  9. Le Kāmasūtra et la « pulsion shastrique » en Inde

    OpenAIRE

    Naudou, Elizabeth

    2013-01-01

    Le mot « shastrique » fait référence au traité (śāstra) d’où sont issus les Kāmasūtra, (plus généralement appelé le Kāmasūtra), « aphorismes sur l’amour » : le Kāmaśāstra, « traité sur l’amour ». Qui dit śāstra, dit, en Inde, exposé religieux ou scientifique, d’où l’expression « pulsion shastrique » que l’on pourrait rendre par « pulsion encyclopédique énumérative et classificatoire ». Le but de cet exposé est de replacer le texte dans cette structure mentale typiquement indienne, qui reflète...

  10. L'analyse des risques l'expert, le décideur et le citoyen

    CERN Document Server

    Chevassus-au-Louis, Bernard

    2007-01-01

    Selon le modèle "standard" d'analyse du risque, utilisé majoritairement aujourd'hui, les experts basent leurs pratiques sur des hypothèses, des concepts, voire des valeurs implicites qui ne peuvent être considérées comme des évidences. La fin du XXe siècle a marqué une crise de l'expertise. Progressivement s'est instauré un débat autour du principe de précaution, principe dont l'application a des conséquences pour la décision et pour l'évaluation du risque lui-même. De son côté, la société civile a un rôle participatif fort à jouer. Se dessinent ainsi les contours d'une analyse de risque "postmoderne", dite "constructiviste", qu'il s'agit de mettre à l'épreuve concrètement.

  11. Equazioni: le icone del sapere

    NARCIS (Netherlands)

    Bais, S.

    2009-01-01

    Il mistero del cosmo è scritto nel linguaggio della matematica, e le equazioni sono le frasi che ne esprimono la bellezza e la profondità. Cercare di spiegare la scienza senza equazioni è come cercare di spiegare l’arte senza illustrazioni: partendo da questo presupposto, Sander Bais presenta una

  12. Le cerveau sous effet placebo

    OpenAIRE

    Touzet , Claude

    2017-01-01

    International audience; Comment le fait de croire qu’on nous injecte de la morphine (alors qu’il s’agit de sérum physiologique) peut-il faire disparaître la douleur ? Investigation sur le cerveau sous placebo.

  13. RETOUR À DELPHES : sur le rapport entre littérature et psychanalyse

    Directory of Open Access Journals (Sweden)

    Marc De Kesel

    2010-05-01

    Full Text Available Partant d’une analyse de l’oracle d’Œdipe, cet essai développe l’essence de la théorie psychanalytique impliquant une critique des paradigmes de la science moderne. Ce sont ces paradigmes qui la rendent incapable à penser le sujet (y compris le sujet de la science. A cause de cette incapacité un autre champ de savoir s’est développé dans les temps modernes, qui est le champ de la littérature. C’est pourquoi, comme le disait déjà Freud, la psychanalyse comme ‘science du sujet’ et la littérature comme ‘savoir du sujet’ ont de grandes affinités. C’est dans l’engagement idiosyncrasique du sujet dans sa lecture ou son écriture – et là seul – que se trouve le lien entre littérature et psychanalyse. C’est aussi là que se montre la raison pour laquelle toute intention d’appliquer la psychanalyse à la littérature est vouée à l’échec. La psychanalyse aussi bien que la littérature doit confronter son affirmation de la fiction au déni total de la fiction dans les sciences hu-maines. Dans un temps où la civilisation de l’image est en train de remplacer la réalité, cette position conjointe de la littérature et de la psychanalyse est plus que nécessaire.

  14. la franchise :approche théorique tentative d'implantation en Algérie: le cas d'yves Rocher

    OpenAIRE

    Moussaoui, Rafika

    2014-01-01

    le premier chapitre présente l'explication théorique de la franchise en abordant la vision financiére ( théorie de rareté, l'agence et la théorie des coûts de transaction).le deuxiéme chapitre intitulé "la pratique de la franchise" la définition , son évolution et sa pratique .Le troisiéme chapitre est consacré au cadre juridique de la franchise et le quatriéme chapitre expose l'éxpérience de la france et le Maroc dans ce domaine et le dernier chapitre on va essayer d'illustrer lele de cet...

  15. Le khatchkar ou la construction de sa petite Arménie.

    Directory of Open Access Journals (Sweden)

    Marie-Blanche Fourcade

    2007-03-01

    Full Text Available « C’est une reproduction d’un khatchkar que mon fils m’a rapporté d’Arménie. Je l’ai mis dans un endroit choisi pour moi, c’est comme une communion avec l’Arménie » disait Vichen lors d’un entretien que je menais sur le patrimoine domestique de la diaspora arménienne au Québec. La plaque de tuff ornée d’une croix 1 , surmontée de motifs végétaux et géométriques est installée sur le manteau de sa cheminée, dans le sous-sol aménagé de sa maison. Elle ...

  16. Les gitans, la prison et le quartier : une relation spécifique devenue le modèle ordinaire

    OpenAIRE

    Cunha, Manuela Ivone P. da

    2005-01-01

    La portion gitane de l'univers détenu dans une prison portugaise représentait dans les anées 80 une modalité de vie carcérale qui échappait aux définitions des «institutions totales». Ce qui n'était alors qu'atypique -- et pouvant par lá même inviter à ramener cette exception à une spécificité «ethnique» -- annonçait pourtant le début d'une tendance plus vaste. Une décénnie plus tard, elle caractériserait l'ensemble de la population incarcérée. C'est cette tendance intégrant gitans et non-git...

  17. LE PROBLÈME HERMÉNEUTIQUE DE L’AMOUR NÉVROTIQUE

    Directory of Open Access Journals (Sweden)

    Yevgeny MEDVEDEV

    2010-11-01

    Full Text Available En relançant le problème herméneutique en tant qu’enjeu entre la catégorie du général et celle du particulier, ce travail cherche à systématiser les manifestations variées du désir amoureux dans la Recherche. Nous trouvons dans le roman la mise-en-œuvre de deux types d’amour analysés par Denis de Rougemont dans son L’Amour et l’occident : l’ amour-passion oriental et l’amour chrétien de la créature. Puisque ces deux types d’amour sont irréconciliables, ils se livrent constamment la bataille, dont l’aboutissement est ce que nous nommons l’amour-jalousie. Cette catégorie du désir est névrotique, car elle se base sur le voisinage simultané du désir de la présence et de l’absence de l’être aimé. Nous montrons dans la présente réflexion qu’en posant au lecteur le défi de la contradiction de l’amour-jalousie, c’est au problème herméneutique que le roman proustien le confronte.

  18. le et responsabilités du réviseur d'entreprises en situation de fraude.

    OpenAIRE

    Veri, Raphaël

    2016-01-01

    le et responsabilités du réviseur d'entreprises en situation de fraude. Mémoire réalisé par VERI Raphaël, encadré par le professeur PEIRCE Robert. NOMA : 8843-12-00 Année académique: 2015-2016 Programme d'étude: GEST2 Ce mémoire a été réalisé afin d’étudier lele et les responsabilités du réviseur d'entreprises qui détecte une fraude dont il n'est ni l'auteur ni un complice direct. Le premier chapitre est consacré à la définition de la profession de réviseur d’entreprises ainsi que des mi...

  19. Apollinaire et le détournement de l’arsenal militaire : la vitesse comme vecteur amoureux

    Directory of Open Access Journals (Sweden)

    Lionel Cuillé

    2014-12-01

    Full Text Available Le détournement de l’arsenal militaire se comprend à la lumière des spéculations de F.T Marinetti sur la vitesse, notion esthétique fédérant le futurisme italien. Le canon de 75, au service duquel Apollinaire est affecté, fut considéré comme une prouesse technologique dont la vélocité devait permettre une victoire fulgurante contre l’Allemagne. C’est ce vecteur de vitesse qui devient le support d’une nouvelle poétique. Certains Calligrammes se lisent dès lors comme un dispositif grâce auquel le poète-artilleur reconfigure, pour la contester, l’opposition entre l’idéal féminin et la luxure, deux postulations que Marinetti déclare exorciser par la magie de la vitesse.

  20. Évolution des contraintes résiduelles dans la couche de diffusion d’un acier modèle Fe-Cr-C nitruré

    DEFF Research Database (Denmark)

    Jegou, Sébastien; Barrallier, Laurent; Somers, Marcel A. J.

    2011-01-01

    Limiter la fatigue et la corrosion des pièces est possible grâce à une nitruration. Des contraintes résiduelles en découlent. Lele de la diffusion du carbone sur le développement de ces contraintes a été étudié sur un acier modèle Fe-3%m.Cr-0.35%m.C.......Limiter la fatigue et la corrosion des pièces est possible grâce à une nitruration. Des contraintes résiduelles en découlent. Lele de la diffusion du carbone sur le développement de ces contraintes a été étudié sur un acier modèle Fe-3%m.Cr-0.35%m.C....