WorldWideScience

Sample records for le fluide est

  1. Bessines – Le Grand Champ Est

    OpenAIRE

    Lemaître, Séverine; Landreau, Guilhem; Ferrié, Jean-Georges; Maguer, Patrick

    2013-01-01

    Identifiant de l'opération archéologique : 204625 Date de l'opération : 2008 (SP) Plusieurs opérations de diagnostics et de fouilles ont été entreprises depuis 2003 au sud-est de la Communauté d’Agglomérations de Niort. Elles montrent une occupation protohistorique particulièrement dense de l’âge du Bronze à l’âge du Fer, au sud-est de l’ancien golfe des Pictons, notamment sur les communes adjacentes de Niort, à Aiffres et à Bessines. Suite au dépôt d’un projet de ZAC, une opération de diagno...

  2. Le travail social est-il de gauche ?

    OpenAIRE

    Girault, Eloïse

    2011-01-01

    Le sociographe est une revue de recherches en travail social, publiée par différents instituts de formation en travail social et qui entend proposer « un cadre de travail, d'écritures, de lectures et d'échanges pour développer une réflexion sur les méthodes et les pratiques d'intervention ». Dans ce numéro, Le sociographe s'efforce d'apporter des éléments de réponse à la question suivante : « Le travail social est-il de gauche ? ». Cette interrogation est fort légitime dans la mesure où, comm...

  3. « Le Paradis, c’est les autres »

    Directory of Open Access Journals (Sweden)

    Rachid Amirou

    2008-11-01

    Full Text Available L’engouement pour des sites ou des lieux est souvent dû à des « Nous » (des communautés éphémères, qui se constituent et qui consacrent ainsi l’espace de visite. La consécration collective est souvent un préalable au succès de certaines destinations (Ibiza, Saint-Tropez, Marrakech, etc.. Le succès des formules de villages de vacances hermétiquement fermés à l’extérieur et indifférents au pays de séjour atteste de l’existence d’un état d’esprit qu’on a classé sous le terme générique de « bulle touristique ». Cependant, la constitution de ces « bulles » – c’est-à-dire la rencontre d’un imaginaire, d’un « nous » et d���un espace touristiques – ne se fait pas uniquement par l’exclusion de l’autre. Elle repose aussi sur un principe interne positif : le rêve d’une sociabilité parfaite, une sorte de paradis relationnel. Le « paradis » touristique, c’est d’abord une rencontre de plain-pied avec les autres (« l’ambiance », souvent d’ailleurs avec les mêmes – rencontre synonyme de relations différentes et moins stressantes, basées sur une connivence réelle ou fantasmée. La généalogie de ce paradis touristique relationnel, qui peut être aussi un enfer pour les autres, reste à décrire et à expliciter, en montrant comment il compose le noyau central de l’imaginaire touristique.

  4. Le bonheur n’est pas l’essentiel ?

    Directory of Open Access Journals (Sweden)

    Salome Berthon

    2007-01-01

    Full Text Available Si nos recherches ethnologiques portent en creux la marque du bonheur et du plaisir, à notre connaissance, ces notions ont rarement sinon jamais été exploitées systématiquement. Des émotions positives que l’on nous narre, en des termes souvent valorisants, aux formes du plaisir que les corps, expressifs ou silencieux, traduisent, c’est au croisement de nos terrains respectifs, pointant différents indicateurs, que nous avons tenté de définir ces notions. Visant à dépasser l’anecdotique et le liminaire au moyen d’une méthodologie « prospective », cette écriture commune fait place libre à une réflexion sur le bonheur et les plaisirs en anthropologie. Distinguant l’immédiateté du plaisir, de l’aspect différé, construit, négocié du bonheur, nous tâchons de voir en quoi, selon les situations et les relations, ils relèvent tantôt du « choisi », tantôt du « subi ». Nous portons ensuite un regard réflexif sur la position du chercheur, dont la subjectivité et les affects n’ont de cesse de mettre son ethnographie et son objectivité à l’épreuve. Si son autorité le conduit à dénier cette part émotionnelle, il devra pourtant s’engager, donner de sa personne pour gagner la confiance de ses interlocuteurs, ouvrir au discours et dévoiler quelques traces, faire surgir le non-dit des émotions, observer tant l’intime que le collectif et, in fine, comprendre ce qui du bonheur fait sens. Amorçant notre conclusion, nous nous interrogeons sur les causes et les effets de ces émotions positives, croisant pratiques et représentations, paroles et silences, automatisme et évidence, naturalité et construction, stabilité et mouvement, etc.

  5. Qu’est-ce que le naturalisme ?

    Directory of Open Access Journals (Sweden)

    Olivier Morin

    2012-01-01

    Full Text Available Cet article répond aux critiques récemment adressées aux tenants du « naturalisme social » dans les pages de la revue SociologieS. Il le fait en défendant un naturalisme minimal, bâti sur trois idées : l’interdisciplinarité est permise ; la pensée est un processus causal qui a lieu dans un monde matériel ; l’humanité est une espèce animale. Ces idées pourront sembler triviales ; le débat auquel nous assistons montre qu’il n’en est rien. Je passerai en revue les arguments les plus fréquemment opposés à ce naturalisme. Le dialogue entre sciences cognitives et sciences sociales ne prélude pas à une O.P.A. de la neurobiologie sur les autres disciplines. Aucun chercheur sérieux ne voit la cognition humaine comme un assemblage de modules à l’architecture entièrement fixée dès la naissance et incapables d’interagir avec leur environnement. Le fait que les processus mentaux n’aient pas lieu uniquement dans nos têtes est aujourd’hui un lieu commun des sciences cognitives. Enfin, l’étude de l’évolution de l’humanité, vue comme une espèce biologique, est porteuse de conclusions qui pour être très générales, n’en sont pas moins pertinentes pour les sciences sociales.What is Naturalism?This article responds to recent critics addressed to the advocates of « social naturalism » in the journal SociologieS. It does so by defending a minimal naturalism structured around three ideas: interdisciplinarity is allowed; thought is a causal process that occurs in a material world; humanity is a species. These ideas may seem trivial; the debate we’re assisting to shows us otherwise. I will go through the arguments that most frequently oppose naturalism. The dialogue between cognitive and social sciences is not a prelude to the takeover of neurobiology on other disciplines. No serious researcher sees human cognition as an assembly of architectural modules entirely fixed from birth and incapable of

  6. Le salaire minimum n'est pas toujours le meilleur moyen d'accroître ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... La hausse du salaire minimum a longtemps été considérée, pour la plupart des pays, comme un moyen de protéger les travailleurs pauvres et leur famille. De fait, cette intervention vigoureuse sur le marché du travail est une mesure de protection sociale à laquelle ont recours beaucoup de pays ...

  7. Le développement durable : est-il possible? est-il mesurable?

    Directory of Open Access Journals (Sweden)

    Belmokaddem MOSTEFA

    2011-04-01

    Full Text Available A la première question, nous répondrons bien sûr, par l’affirmative puisque tous les pays sont engagés dans une nouvelle approche du développement qui ne consiste pas seulement à produire le plus de biens et au moindre coût, afin de vendre beaucoup et réaliser de grands profits. C’était la vision en vigueur dans toutes les techniques de gestion mais on s’est rendu compte que cette production, supposée au moindre coût, était en fait, souvent d’un coût exorbitant, relativement aux dégâts occasionnés dans l’environnement et dans les nuisances occasionnées à la santé de l’homme et à sa tranquillité. Il est temps d’inclure d’autres variables dans le calcul du prix de revient tout en revoyant certaines techniques de production trop salissantes, dangereuses ou grosses consommatrices d’énergie. Nous répondrons aussi par la négative quand on pense qu’au niveau micro économique, les comportements sont édictés par les satisfactions immédiates et les maximisations des profits. Ces comportements qui ne s’intéressent qu’aux résultats à court terme, ne s’intègrent pas facilement dans les plans de développement visant les équilibres macro économiques à long terme.A la deuxième question, nous dirons qu’il y a effectivement des indicateurs pour tester les niveaux de qualité dans l’éducation, la santé, les ressources naturelles... et les gains tirés au niveau social mais les calculs économiques qui déterminent la rentabilité des projets, les profits espérés, les risques financiers encourus ne sont pas toujours en rapport avec les efforts pour réaliser le développement durable qui, eux dépassent la simple notion d’efficacité et de satisfaction. Quand on pense aux générations futures, ce n’est pas seulement en termes de durée dans le temps mais aussi dans la manière d’apprécier les gains espérés.Notre recherche repose sur ces questions qui minent bien des efforts alors qu

  8. Environnement et ambiances bioclimatiques dans le Sud-Est du ...

    African Journals Online (AJOL)

    Pour le traitement de ces données climatologiques,, il a été question de calculer les moyennes mensuelles des indices bioclimatiques sur la normale considérée. ... le pouvoir réfrigérant (K) et la tension de vapeur (tvap) connaissent des variations et déterminent les sensations organiques et corporelles des populations.

  9. Le privé est professionnel ?

    OpenAIRE

    Boni-Le Goff, Isabel

    2017-01-01

    L’article traite des “régimes temporels” des salariés qualifiés du conseil en management. Il souligne la fluctuation des temporalités auxquelles un.e consultant.e peut être soumis.e et montre combien le cadrage organisationnel du temps remet en cause l’opposition et la frontière entre vie privée et vie professionnelle. Face aux normes de disponibilité extensive et à la figure professionnelle légitime d’un expert “sans attache”, les consultant.e.s en couple avec enfant(s) font l’expérience de ...

  10. L'Inde : où est le milieu ? | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Mais ils n'ont pas créé les emplois « fiables » dont l'Inde a désespérément besoin. Le travail peu rémunéré demeure un problème de taille sur le marché du travail indien. Pourtant, l'étude réalisée par M. Mazumdar sur la pauvreté, la croissance et l'inégalité montre que le nombre d'Indiens vivant dans la ...

  11. Regard critique sur On Est Ensemble: 852 mots pour comprendre le ...

    African Journals Online (AJOL)

    Résumé: L'ouvrage intitulé On Est Ensemble: 852 mots pour comprendre le français du Gabon (L. Ditougou, 2009) constitue une contribution importante dans l'histoire du français parlé au Gabon. Cette œuvre présente cependant quelques insuffisances sur le plan métalexicographique. Celles-ci portent sur les pré-textes, ...

  12. Le big bang n'est pas une théorie comme les autres

    CERN Document Server

    Bonnet-Bidaud, Jean-Marc; Leglu, Dominique; Reinisch, Gilbert

    2009-01-01

    Le big bang n'est pas une théorie comme les autres. Ce n'est d'ailleurs pas une théorie physique au sens propre du terme, mais un scénario cosmologique issu des équations de la relativité générale. Il est le modèle qui s'ajuste le mieux aux observations actuelles, mais à quel prix ? Il nous livre un Univers composé à 96 % de matière et d'énergie noires inconnues. C'est donc un euphémisme que de dire que le big bang semble poser autant - sinon plus - de questions qu'il n'en résout. En ce sens, le big bang apparaît davantage comme une paramétrisation de notre ignorance plutôt que comme une modélisation d'un phénomène. Pourtant, le succès du big bang et l'adhésion qu'il suscite, tant dans la sphère scientifique que dans la sphère médiatique, ne se démentent pas. Surmédiatisé, son statut dépasse celui de modèle théorique, et la simple évocation de son nom suffit pour justifier des opérations de marketing scientifique ou rejeter des cosmologies alternatives. Pour éclaircir les pr...

  13. L’interface Habitat / Habitant : quand le lieu de vie est porteur de maladie - Le cas du radon en PACA

    Directory of Open Access Journals (Sweden)

    Cissé E.

    2012-10-01

    Full Text Available Les préoccupations sont croissantes pour étudier les liens entre des conditions environnementales spécifiques et la fréquence de certaines pathologies. Nous proposons d’analyser ici le lien présupposé entre une exposition au radon et le cancer du poumon. Le radon, est un gaz radioactif d’origine naturelle (issu de la désintégration naturelle de l’uranium présent dans la croûte terrestre et plus particulièrement dans certaines formations géologiques. A partir du sol et de l’eau, le radon se diffuse dans l’air (exhalation et se trouve, par effet de confinement, à des concentrations plus élevées à l’intérieur des bâtiments qu’à l’extérieur. Les descendants solides du radon sont alors inhalés avec l’air respiré et se déposent dans le poumon. Il est établi par diverses études scientifiques que le radon a un impact non négligeable sur certains cancers, notamment du poumon (augmentation de 16 % du risque de cancer du poumon par tranche de 100 Bq/m3, et des cancers digestifs via la consommation d’eau qui s’est chargée en radon au contact du socle. Le nombre annuel de décès par cancer du poumon attribuable à l’exposition domestique au radon en France métropolitaine varie entre 1 200 à 3 575 en fonction des relations exposition-réponse utilisées. Plusieurs régions en France se caractérisent par une problématique radon reconnue et étudiée depuis longtemps (Bretagne, Massif central, Corse. Or, si le radon ne recouvre pas l’ensemble de la région PACA, certaines zones géographiques sont particulièrement concernées et méritent d’être étudiées : le Massif des Maures dans le Var, du Mercantour dans les Alpes-Maritimes et du Briançonnais dans les Hautes-Alpes. La région PACA est une des régions de France et d’Europe les plus touchées par la pollution atmosphérique principalement due à l’augmentation du trafic routier et des contributions de régions industrialisées telles que

  14. Il est temps que le Canada rende la justice accessible à tous | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il est temps que le Canada rende la justice accessible à tous. Adrian Di Giovanni, Lotta Teale, Vivek Maru. 29 juin 2016. Des étudiantes à l'école secondaire Female Experimental High School à Herat en Afghanistan. Photo : Graham Crouch / Banque mondiale. Lorsqu'on prive un enfant d'accès à l'école ou qu'on exclut ...

  15. Et le gagnant est... Brendan Baker en entrevue | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 févr. 2011 ... Plus les Canadiens verront d'exemples positifs, plus ils comprendront les difficultés que doivent surmonter les populations des pays en développement, et plus ils éprouveront du souci et de l'empathie à leur égard. Si le piège de la pauvreté persiste encore, c'est entre autres parce que les gens d'ici ...

  16. Baisse de la transmission de la douve du foie dans le nord-est de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    mortelle de cancer du foie liée à l'O. viverrini. Dans cer- taines régions, près de 85 % de la population est porteuse du parasite. Les villages du nord-est de la Thaïlande, où l'on raffole du poisson cru, ont des taux d'infection parmi les plus élevés du pays. Les personnes infectées peuvent porter le parasite adulte pendant ...

  17. Le criquet du Mato Grosso : l'agriculture est-elle responsable ?

    Directory of Open Access Journals (Sweden)

    Lecoq, M.

    1995-01-01

    Full Text Available Le criquet du Mato Grosso : l'agriculture est-elle responsable ?. Investigations through bibliographical references and among the local population provided a collection of documents and evidences showing without any doubt that Rhammatocerus schistocercoides (ReHN, 1906 [Orth. Acrididae Gomphocerinae] outbreaks in Mato Grosso (Brazil are not a new event neither by nature nor by magnitude. Therefore, the present conception on the origin of those outbreaks need to be drastically revised. The previous hypotheses, implying an overrated agricultural development of concerned areas since 1980, must then be rejected.

  18. Le marché du capital-risque en Wallonie: une nouvelle initiative est-elle nécessaire?

    NARCIS (Netherlands)

    de Harlez, Y.; Schwienbacher, A.; Van Wymeersch, C.

    2009-01-01

    Dans la plupart des pays européens, les autorités publiques ont mis en place ces dernières années des mesures destinées à accroître l’offre de capital-risque aux entreprises nationales. C’est notamment le cas des Pays-Bas avec le programme Technopartner Seed Capital et de l’Allemagne avec le

  19. Déchets nucléaires : où est le problème ?

    CERN Document Server

    Sorin, Francis

    2015-01-01

    Faut-il avoir peur des déchets nucléaires ? Sont-ils vraiment, comme le pense une partie du public, ce fardeau empoisonné ingérable faisant peser une menace fatale sur nous-mêmes et sur nos descendants ? Ou sont-ils au contraire, comme l'estime la grande majorité des scientifiques, des résidus que l'on sait fort bien conditionner et mettre hors d'état de nuire ? Entre le public inquiet et les ingénieurs rassurants, comment comprendre l'immense décalage des attitudes ? Et comment, face à ces déchets laissés en héritage, faire la part des choses entre ceux qui dénoncent "un crime contre les générations futures" et ceux qui jugent "la difficulté résolue" ? Bref, "Où est le problème ?" Sans craindre de bousculer bien des idées reçues mais sans méconnaître les risques encourus, Francis Sorin éclaire ici en quelques chapitres percutants les problèmes et les solutions liés à la gestion de ces déchets en France. II s'attache particulièrement au devenir des déchets de haute activité et...

  20. Le "champ" de l'accompagnement des demandeurs d'emploi est-il un "marché" ?

    OpenAIRE

    Remy, Céline

    2015-01-01

    Le but de ce chapitre est d’interroger le champ de l’accompagnement des demandeurs d’emploi comme étant ou non un marché conventionnel. Pour ce faire, les concepts de marché, de quasi-marché, de marché public et de champ sont clarifiés dans un premier temps. Pour comprendre le fonctionnement du marché de l’accompagnement, il est nécessaire dans un deuxième temps d’examiner quatre dimensions qui sont le périmètre et le financement de celui-ci mais également la sélection des opérateurs externes...

  1. Le dessalement de l’eau de mer est-il une voie d’avenir?

    Directory of Open Access Journals (Sweden)

    Jean-Noël Salomon

    2012-06-01

    Full Text Available La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source d’eau potable pour un grand nombre de pays (îles, pays à climat désertique ou subdésertique, etc.. Mais, ce coût restant encore bien supérieur à celui des autres modes d’alimentation, cette technique reste réservée à des États ayant des ressources financières et énergétiques consistantes (Moyen Orient, pays développés, ce qui limite les possibilités. L’avenir du dessalement doit également prendre en compte ses effets sur l’environnement car de plus en plus d’études en montrent les effets pervers et …coûteux. Cet article entend faire le point et attirer l’attention sur l’ensemble de cette technique qui offre une alternative intéressante au spectre de la pénurie d’eau annoncée par bien des médias dans le contexte du réchauffement climatique.

  2. Le dessalement de l’eau de mer est-il une voie d’avenir?

    OpenAIRE

    Jean-Noël Salomon

    2012-01-01

    La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source...

  3. Le Prix mondial de l'alimentation est décerné à un ancien boursier ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mai 2016 ... M. Hillel est chercheur principal au Center for Climate Systems Research, qui relève de l'Earth Institute de l'Université Columbia, et travaille avec le NASA Goddard Institute for Space Studies. Il a oeuvré par le passé avec de nombreux organismes de développement international et s'était vu octroyer une ...

  4. Le fascisme, c’est du théâtre. Macchina scenica e meccanica narrativa

    Directory of Open Access Journals (Sweden)

    Emanuele Canzaniello

    2015-11-01

    Full Text Available «Le fascisme, c’est du théâtre», sostiene Jean Genet, e come tale i suoi legami con la natura e la prassi della messa in scena sono essenziali alla specificità del fenomeno. La resa spettacolare della nazionalizzazione delle masse è stata senz’altro tra i temi fondamentali della ricerca sui totalitarismi. Il mio proposito è qui quello di intarsiare alcuni nuclei consolidati della ricerca storica con le rese squisitamente letterarie di quello che fu poco più che un  decennio di immensi tableaux vivants, visioni di un nuovo ordine di massa. Un’opera d’arte collettiva, basata su una premessa  fondamentale: dare “figurabilità” ai detriti e alle rovine (rimosse? di alcuni miti delle origini propri della cultura romantica, e  consapevolmente avviare e mettere in luce un enorme processo più generale di disgregazione del logos e di tutta la civiltà europea nella sua prospettiva diremo cartesiana, geometrica e razionalista. Il mio discorso si fonda, anche se in breve, su un testo solo: la Gerbe des forces (1937 di A. de Châteaubriant, uno dei più singolari resoconti di pellegrinaggio politico verso il miraggio totalitario che si sia dato tre le due guerre mondiali. Soccorsi non secondari sono il saggio di Sontag Under the sign of Saturn (1980 e quello di Tame La Mystique du Fascisme dans l’oeuvre de Robert Brasillach (1986. According to Jean Genet: «Le fascisme, c’est du théâtre», and as such its relationship with the nature and praxis of staging are essential to the specificity of the phenomenon. The magnificent representation of mass nationalisation is beyond doubt one of the fundamental issues when investigating totalitarianisms. My aim here is to link some wellestablished nuclei of historical research to the literary outputs of what was little more than a decade of immense tableaux vivants, visions of a new mass order. A collective work of art, based on a fundamental premise: to give ‘figurality’ to the rubble

  5. Le Makhzen est-il soluble dans la mondialisation ?

    Directory of Open Access Journals (Sweden)

    Jean-Luc Piermay

    2010-09-01

    Full Text Available L’article étudie les processus de fabrication des territoires à l’œuvre au Maroc depuis un demi-siècle, à travers l’exemple des dynamiques économiques et notamment industrielles. Si en matière de politiques publiques, cette question constitue un domaine d’intervention essentiel sous le règne de Mohammed VI, elle a bénéficié depuis la proclamation de l’indépendance d’une stratégie constante d’intégration du territoire national, stratégie toujours visible à travers le traitement qui est fait des marges spatiales du pays. En revanche, les territoires infranationaux sont peu pris en considération, voire vus avec méfiance, sinon en tant que projections locales des réseaux sociaux et politiques émanant du pouvoir central.Through the economic and industrial dynamics, this paper examines how the building of territories has taken place in Morocco from one half-century. Among the public policies, the economic question is the main field of State intervention under the reign of Mohammed VI. But from Independence (1956 the building of the national territory has taken advantage of an unchanging strategy of integration, still visible through the policies applied to the spaces neighbouring the borders. On the other side, infra national territories are little taken into account, even often seen with suspicion, except as local projections of the social and political networks coming from the State authorities.

  6. Le projet du code civil roumain. Est-il moderne, européen, rigoureux?

    Directory of Open Access Journals (Sweden)

    Marilena Uliescu

    2009-06-01

    Full Text Available Depuis plus de quarante ans le monde des juristes roumains est hanté par la modification - au nom de la modernisation - du vieux code civil. Ainsi que nous l'avons déjà dit, en Corse en 2004, à l'occasion du bicentenaire du code Napoléon, celui-ci a connu en Roumanie un transplant réussi. En effet, l'adoption du Code civil roumain en 1865 - copie presque conforme du code civile français - a posé les fondements du droit civil roumain moderne avec ses principes et ses institutions et y a introduit également la terminologie juridique moderne. La conception générale, les principes, les institutions de droit civil mais surtout la rigueur de la terminologie et des règles ont déterminé - malgré certaines fractures, régies par des lois spéciales - sa miraculeuse survie après presque dix lustres de droitsocialiste.

  7. De quelques retours de M. Chat : Historiographie politique dans Le fond de l’air est rouge

    Directory of Open Access Journals (Sweden)

    Jeremy Hamers

    2012-10-01

    Full Text Available Dans son film de montage Le fond de l’air est rouge, Chris Marker compile un ensemble de représentations hétérogènes issues d’une décennie de luttes (ouvrières, étudiantes, indépendantistes, etc. dans le monde. Par l’assemblage de ces images, le cinéaste déploie une historiographie a priori mélancolique et défaitiste. Le présent texte entend dépasser cette interprétation unilatérale de la critique politique des images pour y identifier les traces d’un retour chronique à l’espoir militant.

  8. Le sens de l’observation est-il utile en sociologie ?

    Directory of Open Access Journals (Sweden)

    Jean Peneff

    2011-10-01

    Full Text Available Le sens de l’observation est non seulement utile mais indispensable en sociologie. Cette capacité est d’abord une pratique de la connaissance ordinaire mais elle peut s’affiner et se perfectionner. La sociologie française s’est récemment rapprochée de l’ethnographie et a opéré un renversement en faveur de l’observation, à la lumière des critiques sur la validité et sur le prétendu universalisme des formules classiques. Parmi les quatre grandes méthodologies sociologiques que sont les enquêtes par questionnaire, les interviews, l’étude de documents et l’observation sociologique, les trois premières ont leur histoire et leur inventaire instrumental est bien décrit, mais pas l’observation. Pourtant, en sociologie, plusieurs courants relatifs à l’observation ont cohabité. L’article s’attache à les retracer, à en détailler les conditions et à réhabiliter l’observation directe ou indirecte, spontanée ou préparée, présente ou légèrement rétrospective comme instrument indispensable à qui veut comprendre des univers sociaux éloignés du sien, tous ceux que l’on ne connaît guère intimement par contact direct.Is the sense of observation useful in sociology?The sense of observation is not only useful but it is essential in sociology. This ability is firstly an ordinary knowledge practice, but it can be refined and improved. French sociology got recently closer to ethnography and a change in favor of observation occurred, on the basis of the criticism of the validity and the so-called universalism of the classical formulas. Among the four major sociological methodologies, the survey investigations, the interviews, the document analysis, and the sociological observation, the three first ones have their history, and their tool inventory is properly described, except for observation. Yet, in sociology, several trends related to observation have lived together. This article attempts to retrace them, to

  9. Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario

    Directory of Open Access Journals (Sweden)

    Anne Grundy

    2017-01-01

    Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l

  10. La guerre contre les drogues illicites : Est-ce qu’elle est perdue ? - Has the war against drugs been lost ? - La guerra contro le droghe è persa ?

    Directory of Open Access Journals (Sweden)

    Dominick M.

    2009-08-01

    Full Text Available Le système légal du Mexique est dans un état de ruine à cause des cartels de la drogue soutenus et subventionnés par les États-Unis d'Amerique. En effet, les États-Unis sont le marché principal de la marijuana, de la cocaine et, en moindre quantité, des drogues synthétiques provénantes du Mexique. L’article met en évidence que les régions frontalières du Mexique sont pris en otage entre d’une part, les principaux producteurs mondiaux de coca et d’autre part, les principaux consommateurs (de l’Amerique du Nord et de l’Europe. Pour cela, l’avis de l’autrice et de son collaborateur est que le Mexique ne peut résoudre seul les problèmes liés au narcotrafique. The Mexican legal system is in a state of ruin because of illegal drug cartels supported, sustained and subsidized by the United States of America. It is the U.S. which is the market for marijuana, cocaine and to a lesser extent synthetic drugs trafficked through Mexico. This article evidences that especially the frontier regions of Mexico have been taken hostage between, on the one hand, the principal world producers of cocaine and, on the other hand, the principal consumers (from North America and from Europe. Accordingly, it is the view of the author and her collaborator that Mexico cannot resolve in isolation the problems involved in narco-trafficking.Il sistema legale messicano versa in uno stato disastroso a causa dei cartelli della droga sostenuti e sovvenzionati dagli Stati Uniti d’America. Infatti, gli USA rappresentano il principale mercato della marijuana, della cocaina e delle droghe sintetiche (queste ultime in misura minore provenienti dal Messico. L’articolo mette in evidenza che le regioni frontaliere del Messico sono prese in ostaggio, da una parte, dai principali produttori modiali di cocaina e, dall’altra, dai principali consumatori (che si trovano nell’America del Nord ed in Europa. Pertanto, secondo l’autrice ed il suo collaboratore

  11. Computation of Viscous-Inviscid Interactions (Le Calcul de l’Interaction Fluide Parfait-Fluide Visqueux).

    Science.gov (United States)

    1981-10-01

    rapport 5 in 6coulement de fluide parfait tictif superpoae Le proc~di Elimine en particulier lea anomalies de couches supercritiques au sens de Crocco- Lees ...amasi sur le rhoix d’un traitemnent pratique de l’interaction rouche limite - onde de char adapt6 am ralcul des profits ou des voilures tranesoniques...sense of Crocco- Lees , even if it is limited to an approximation level of the first order. It also appears desirable 111 12! that the viscous correctionsof

  12. Leishmaniose viscerale et leucemie aigüe lymphoblastique B: quel est le rapport?

    Science.gov (United States)

    El Youssi, Hind; Touaoussa, Aziz; Bergui, Imane; Bougrine, Nawal; Amrani, Moncef Hassani

    2015-01-01

    L'association leishmaniose viscérale et leucémie aigue a été rarement rapportée dans la littérature, cependant le diagnostic concomitant de ces deux entités n'a jamais été rapporté au Maroc. Le lien entre ces deux pathologies n'a pas encore été établi et le traitement n'a pas encore été codifié. Nous rapportons le cas d'un garçon de 12 ans chez qui une leishmaniose viscérale et une leucémie aigue lymphoblastique type B ont été diagnostiquées simultanément. Malgré l'administration d'un traitement antiparasitaire associé à une chimiothérapie l’évolution était marquée par le décès du patient. PMID:26090011

  13. SÉCURITÉ ÉNERGÉTIQUE OUEST-EST: LELE DE LA GRÈCE

    OpenAIRE

    Aristeidis KAVARLIGKOS

    2014-01-01

    La civilisation occidentale fondée et structurée sur la production et la consommation de biens et services a soif d'énergie, afin de soutenir cet édifice. Aujourd'hui, les économies émergentes ont trop pesé sur cette demande, entraînant inévitablement la concurrence dans le domaine de la sécurité énergétique mondiale, ce qui fait des pays producteurs d'hydrocarbure des régulateurs des affaires du monde. Comme un "deus ex machina " les gisements trouvés dans la Méditerranée orientale, la modif...

  14. Danièle Linhart et Aimée Moutet (dir.), Le travail nous est compté. La construction des normes temporelles au travail

    OpenAIRE

    Bouffartigue, Paul

    2009-01-01

    Cet ouvrage mobilise une douzaine d’auteurs et réunit treize études de cas qui constituent autant de terrains d’enquête, par ailleurs diversement situés dans le temps et l’espace : les années 1950-1960 pour ce qui est de deux firmes automobiles en France ; les années 1990-2000 pour les onze autres monographies. Trois établissements sont situés à l’étranger – deux en Russie (roulements à bille, agence bancaire), un en Allemagne orientale (aciérie). Les huit autres secteurs professionnels conce...

  15. Le succès est relatif — Wara Alderete | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... L'Argentine tarde à ratifier la Convention-cadre pour la lutte anti-tabac (CCLAT) de l'Organisation mondiale de la santé, qui impose aux gouvernements qui la ratifient de prendre de véritables mesures de lutte contre le tabagisme, dont de nouvelles lois et des mesures relatives aux prix, d'investir dans ...

  16. En Afrique, l'avenir est mobile | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 janv. 2011 ... Dans les pays industrialisés, les assistants numériques personnels (ANP) servent souvent à la gestion d'agenda, mais des chercheurs financés par le CRDI démontrent que les ANP sans fil peuvent contribuer à améliorer la prestation des soins en Afrique. « Commençons à considérer les ANP comme des ...

  17. Le concept de « société » n’est plus un absolu.

    OpenAIRE

    Christian Ruby

    2006-01-01

    L’auteur (1925), polonais, est sociologue (Varsovie). Suite à la publication de quelques ouvrages analysant les sociétés contemporaines, dont l’un portait sur Le Coût humain de la mondialisation (Paris, Hachette, 2003, traduction de Globalization : The Human Consequences , Cambridge, Polity Press, 1998), il s’attache ici à deux objets : l’historicisation du concept de société et la formulation de la description pertinente de l’existence sociale contemporaine. Ces deux ...

  18. "Quand voyager mentalement dans le temps est difficile) - Une étude comparative des souvenirs et projections définissant le soi chez des patients dépressifs et des sujets contrôles sains

    OpenAIRE

    Wagener, Aurélie; Thirion, Julie; PITCHOT, William; Blairy, Sylvie

    2016-01-01

    INTRODUCTION. Les patients dépressifs présentent des difficultés à effectuer le voyage mental dans le temps, une des fonctions principales de la mémoire autobiographique, c’est-à-dire à se projeter mentalement dans le passé et le futur. Cette étude s’intéresse à des événements passés et futurs potentiels particuliers qui sont les souvenirs et les projections futures définissant le soi (SDS et PFDS, respectivement). Les SDS et les PFDS sont des événements autobiographiques particuliers hauteme...

  19. Le détritisme carbonate profond dans le Crétacé inférieur du Sud-Est français. Ses rapports avec l'eustatisme

    OpenAIRE

    Ferry , Serge

    1987-01-01

    Mémoire HS n° 13 - Géologie Alpine : Le détritisme dans le Sud-Est de la France - Colloque Association des Géologues du Sud-est - Grenoble 11-12 décembre 1986; 10 cycles eustatiques sont définis dans le Crétacé inférieur du Sud-Est français. Sur les plates-formes carbonatées, ils correspondent aux principales séquences "klupféliennes" de comblement, pour lesquelles le moteur tectonique (à-coups de subsidence) est mis en doute. Ces cycles ne sont repérables dans les séries de bassin que si l'a...

  20. RIEN N’EST FIXE: L’EXPÉRIENCE-NIETZSCHE ET LE QUOTIDIEN ÉDUCATIONNEL

    Directory of Open Access Journals (Sweden)

    Luciano Bedin da Costa

    2011-12-01

    Full Text Available Cet article est une lecture du quotidienne éducationnel par la philosophie de riedrich Nietzsche (1844-1900 avec des concepts tels quels : expérience, nihilisme, ressentiment, mauvaise conscience, force et de la volonté de puissance. La théorie de Nietzsche est utilisé comme un outil de réflexion sur les pratiques quotidiennes vécu dans l'éducation, de rompre avec l'inertie du discours des pleurs et nihiliste. Ce que nous appelons l'expérience de Nietzsche implique un autre regard, une grande santé et une éthique pour une évasion de la cristallisation et production des différences. MOTS-CLÉS : expérience; Nietzsche, nihilisme, formation, volonté de puissance

  1. Le contact forêt-savane dans l'est du Cameroun et Chromolaena odorata : considérations préliminaires

    OpenAIRE

    Achoundong, G.; Bonvallot, Jacques; Happi, Y.

    1996-01-01

    Cette étude préliminaire des contacts forêt-savane porte sur une zone de l'est du Cameroun, au sud de la ville de Bertoua. Sous climat équatorial de transition, la savane de Kandara est caractérisée par une avancée rapide de la forêt sur les formations graminéennes malgré les feux de brousse - souvent tardifs - annuels. Lele passif et actif de #Chromolaena odorata$ est analysé. Dans le contexte général de conquête forestière, cette plante semble accélérer le phénomène. (Résumé d'auteur)...

  2. L'Inde : où est le milieu ? | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Des entrepreneurs futés, favorisés par les réformes économiques opérées au début des années 1990, ont tiré parti des nouveaux débouchés sur les ... À long terme toutefois, M. Mazumdar est d'avis qu'il s'agit d'un encouragement manifeste à privilégier l'expansion horizontale plutôt que verticale. S'il était ...

  3. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Vanderci de Andrade AGUILERA

    2013-12-01

    Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  4. L'aiguillat commun (Squalus acanthias) dans le nord-est du Pacifique et histoire de son utilisation

    National Research Council Canada - National Science Library

    Ketchen, K. S

    1986-01-01

    ... présent rapport passe en revue la taxonomie, la distribution, les migrations, la définition des stocks et le cycle vital de l'aiguillat commun dans le contexte d'un compte rendu de son utilisation à travers les...

  5. Lele de la sphère publique en réseau pour ce qui est de favoriser ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Una Hakika : Porter à grande échelle les solutions numériques pour la gestion des conflits au Kenya et en Birmanie. L'information erronée, qu'elle soit le fruit de rumeurs ou d'une désinformation intentionnelle, peut alimenter le conflit et exercer de profondes répercussions sur la paix, la... Voir davantageUna Hakika : Porter ...

  6. le de la société civile pour ce qui est d'influencer les politiques de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    le de la société civile pour ce qui est d'influencer les politiques de santé publique en faveur des femmes autochtones du Mexique. Au Mexique, les iniquités relatives à l'accès aux services de santé et aux services connexes sont sensiblement plus marquées chez les populations autochtones, et en particulier chez les ...

  7. Stéréotyper le Féminin: entre le Doxique et l’Esthétique (Estereotipar o Feminino: entre o Dóxico e o Estético)

    OpenAIRE

    Maingueneau, Dominique; UNIVERSITÉ PARIS XII - VAL-DE-MARNE – PARIS/FRANCE

    2007-01-01

    RÉSUMÉ Cet article cherche à montrer que l’attitude masculine à l’égard des stéréotypes sur les femmes peut correspondre à deux manières de “gérer” l’énigme que représente pour l’homme la différence sexuelle: un régime doxique, celui de l’ “Homme Ordinaire”, et un régime esthétique, celui de “l’Artiste”. Le premier régime trouve à se manifester dans les proverbes, par exemple, dont la visée essentielle est de définir un ordre dans lequel le féminin se voit assigner “sa” place. Il est illustré...

  8. INFLUENCE DE L’INTERACTION FLUIDE-STRUCTURE SUR LE COMPORTEMENT VIBRATOIRE D’UNE CONDUITE EN FLEXION.

    Directory of Open Access Journals (Sweden)

    A BENDAHMANE

    2014-12-01

    Un programme est élaboré et validé, une comparaison des résultats trouvés avec ceux disponibles dans la littérature est faite. Ce qui nous a permis d’étudier l’influence des paramètres physiques et géométriques de la structure couplée sur le paramètre de fréquence. Parmi ces paramètres nous citons la vitesse d’écoulement, la masse volumique, le module d’élasticité, la longueur du tuyau et les conditions aux limites.

  9. Activité physique, indice de masse corporelle, masse graisseuse par impédance: lequel de ces facteurs est le plus associé au risque cardiovasculaire pour nos patients?

    OpenAIRE

    SPRENG, L.

    2015-01-01

    Contexte: Les maladies cardiovasculaires représentent la première cause de mortalité en Suisse et dans le reste du monde depuis des années. Pourtant, elles sont le plus souvent causées par des facteurs de risque évitables et modifiables comme le tabac, l'inactivité physique, le surpoids, le stress, etc. Un dépistage est recommandé dès l'âge de 40 ans et chaque 5 ans chez toutes personnes asymptomatiques afin de pouvoir traiter au plus vite l'apparition d'un nouveau facteur de risqu...

  10. « Mon pays, c’est mes enfants et mes petits-enfants » : exils et transcendance dans Le Bonheur a la queue glissante d’Abla Farhoud

    Directory of Open Access Journals (Sweden)

    Kelly Anne Maddox

    2010-05-01

    Full Text Available L’identitaire dans ce premier roman de Farhoud est inextricablement liée à l’exil, que ce soit l’exil physique, ou bien, l’exil intérieur. D’une part, l’exil physique se manifeste par la migration, d’abord lorsque le personnage principal, Dounia, quitte son village pour vivre dans celui de son mari, et ensuite lorsqu’elle émigre au Canada. D’autre part, l’exil intérieur provient de la subordination imposée par la culture patriarcale. Nous comptons examiner ces deux formes d’exil, ainsi que les conséquences qui en résultent, telles que la marginalisation, la dépossession linguistique, et le refoulement identitaire. Nous discuterons également des tentatives qu’entreprend Dounia de transcender sa marginalisation en établissant des relations interpersonnelles.

  11. Quel est lele des environnements audio-graphiques synchrones dans les interactions d’un cours de langue en ligne?

    Directory of Open Access Journals (Sweden)

    Chahrazed Mirza

    2010-01-01

    Full Text Available L’enseignement-apprentissage du français langue étrangère par communication synchrone multipoint en ligne se pose comme une pratique d’avenir pour l’apprenant à distance. Nourri de dix ans d’expérience de ces environnements, cet article porte un regard critique sur cette pratique en examinant le rapport entre socioconstructivisme, scénarios communicatifs, technologie et appropriation de la langue dans deux formations spécifiques. Selon les théories socioculturelles dont disent s’inspirer les concepteurs de formation dans leur choix d’outils et de scénarios, la mise en place de scénarios communicatifs et leur réalisation active par les apprenants constituent les moteurs de l’apprentissage. Néanmoins, comment ce principe s’actualise-t-il dans la pratique? Pour répondre à cette question, nous étudierons la mise en œuvre de scénarios socioconstructivistes dans deux plateformes audio-synchrones différentes. De cette étude, nous conclurons que la nature du rapport scénario/outil/usagers (et usages influe sur le processus d’appropriation de la langue. Nos conclusions nous permettront aussi d’ouvrir des pistes vers une recherche sur la transférabilité des pratiques d’une technologie à une autre.

  12. Ophiostomales (Ascomycètes) associées à Ips acuminatus Gyll (Coleoptera : Scolytidae) sur le pin sylvestre (Pinus sylvestris L.) dans le sud-est de la France et comparaison avec Ips sexdentatus Boern

    OpenAIRE

    Lieutier, François; Garcia, J.; Yart, Annie; Vouland, G.; Pettinetti, M.; Morelet, M.

    1991-01-01

    Les Ophiostomatales associées à lps acuminatus ont été isolées des insectes, de leurs galeries et de l’aubier des pins sylvestres attaqués, dans le Sud-Est de la France (département du Var), pendant l’épidémie de 1987 et 1988. Des isolements ont aussi été réalisés dans la même région en 1987 sur des populations endémiques d’Ips sexdentatus, et dans 2 autres régions (l’Orléanais (1988) et le Mont Ventoux (1989)) sur des populations endémiques d’I acuminatus. Les vitesses de croissance des ...

  13. Pourquoi le « Disque Blanc » des Beatles est-il Blanc ?

    Directory of Open Access Journals (Sweden)

    Bernard Gensane

    2006-02-01

    Full Text Available Dans « Strawberry Fields Forever » (février 1967, John Lennon prévient, dans une perspective postmoderne, que la représentation artistique est impossible car « nothing is real ». Au même moment, Paul McCartney propose, avec « Penny Lane » (février 1967, une des plus troublantes définitions de ce qu’est la représentation artistique : « And though she feels as if she’s in a play / She is anyway ». Que se passe-t-il, en effet, lorsque l’art est sciemment accepté comme un faux-semblant à la foi...

  14. Le

    NARCIS (Netherlands)

    de Beer, P.T.; Luttikhuizen, R.; Barbier, J.C.; Gautii, J.

    1998-01-01

    Interventions ` visie ` la fois iconomique et sociale, les politiques publiques de l'emploi (PPE) de chaque pays trouvent leur logique dans une relation itroite avec chacun des systhmes nationaux de protection sociale. La premihre partie de cet ouvrage est consacrie ` la prisentation de cas

  15. « Depuis quand le requin est un mammifère ?!?!?! » La pragmaticalisation de la séquence interrogative depuis quand

    Directory of Open Access Journals (Sweden)

    Hernández Patricia

    2016-01-01

    Full Text Available Ce travail aborde les emplois non temporels de la séquence interrogative depuis quand dans des énoncés du type « Depuis quand le requin est un mammifère ?!?!?! », emplois expressifs fréquents en contextes dialogiques. Sans étude particulière dans la littérature, de tels cas peuvent être caractérisés, dans le cadre d’une approche cognitive, comme étant pragmaticalisés (Dostie 2004 i.e. laissant transparaître la subjectivité du locuteur (Traugott 2010. Depuis quand devient ainsi un marqueur discursif (Traugott, Dasher 2004, Dostie, Pusch 2007 autant dans des structures phrastiques (« Depuis quand l’opinion personnelle d’un obscur politicien est-elle vérité ? » que comme mot-phrase (« Le verbe peinturer existe ? Depuis quand ? ». Sur la base d’une grammaire émergeant du discours (Hopper 1987, nous décrivons l’emploi de cette formule à partir de l’analyse d’un corpus d’énoncés relevés sur des sites internet recueillant l’opinion des internautes. Dans ces emplois, nettement subjectifs, depuis quand joue lele d’un marqueur de discordance, cette notion se prêtant, en discours, à des modulations contextuelles. Ce sont ces variations qui nous permettront de proposer une première typologie des emplois subjectivisés de depuis quand en tant que marqueur de discordance : (i manifestation de l’étonnement (« Depuis quand doit-on prouver son innocence ? », (ii expression de la désapprobation (« Depuis quand faut-il manifester sa liberté d’expression en critiquant ceux qui vous ont soutenu et promu ? », (iii mise en scène de l’incongru (« Depuis quand les morts consomment-ils de l’eau ? ». Notre analyse prend en compte, également, des aspects caractéristiques de tels emplois à savoir les questions rhétoriques et l’ironie. Une attention particulière est accordée à des emplois tels que « Depuis quand un procureur s’appelle lui-même comme témoin ? », analysés en termes

  16. Le chantier médiéval dans le Sud-Est de la France: regard sur les techniques de construction et l’organisation du chantier à partir de quelques exemples (XIe-XIVe siècles

    Directory of Open Access Journals (Sweden)

    Esquieu, Yves

    2005-12-01

    Full Text Available The present article illustrates several aspects of the archaeological research on mediaeval construction in south-eastern France (11th-14th cent. by studies in building archaeology led by the authors in various architectural and scientific contexts. It focuses on questions such as the know-how and its transfer, changes in the architectural project, the organization of the building process and its techniques and strategies, by analyzing the masonry and structure of the edifice and, in the case of the pope’s palace in Avignon, by combined research on the architecture and the written sources.Le présent article illustre différents aspects de la recherche sur la construction du XIe au XIVe siècle dans le Sud-Est de la France à l’exemple d’études monumentales menées par ses deux auteurs dans différents contextes architecturaux et scientifiques. Il aborde les questions du savoir-faire et de sa transmission, des changements de projet, et l’organisation du chantier, à partir des indices de la lecture des élévations et, dans le cas de la construction du palais des papes d’Avignon, de l’étude conjointe des sources écrites.

  17. Quelle sorte d'être est le soi? Les implications ontologiques d'une herméneutique du soi

    Directory of Open Access Journals (Sweden)

    Marc-Antoine Vallée

    2010-12-01

    Full Text Available Cet article vise à dégager les implications ontologiques du projet Ricoeurien d’une herméneutique du soi tel que formulé dans Soi-même comme un autre. L’auteur retrace d’abord la double approche de Ricoeur proposant de penser l’attestation du soi suivant la notion aristotélicienne de l’être-vrai et l’homme capable selon les catégories de l’acte et de la puissance. Soulignant le caractère fragmentaire et insuffisant des analyses de Ricoeur, il explore ensuite une troisième façon de nommer l’être du soi selon la catégorie de la relation, développant ainsi l’idée d’une “ontologie de la relation” sous-jacente à cette herméneutique du soi. This article aims to make explicit the ontological implications of the Ricœurian project of a hermeneutics of self as formulated in Oneself as Another. The author first redraws Ricœur’s double approach proposing to think the attestation of the self following the Aristotelian notion of being-true and the capable man following the categories of actuality and potentiality. Underlining the fragmentary nature and the incompleteness of Ricœur’s analysis, he then explores a third way to speak about the being of the self following the category of relation, thus developing the idea of an underlying “ontology of the relation” implied by this hermeneutics of the self.  

  18. La bibliothèque du CERN | Pauline Gagnon présente : « Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels » | 24 mars

    CERN Multimedia

    2015-01-01

    Mardi 24 mars 2015 à 16h00 à la bibliothèque du CERN (bât. 52-1-052) * Le café sera servi à partir de 15h30 *   Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs, qui en avaient prédit l'existence 48 ans auparavant ?  Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va be...

  19. Le Conseil du CERN s'est réuni à Genève (Suisse); Josef Rembser élu comme président du Conseil; le Prix Nobel Carlo Rubbia nommé prochain Directeur Général (1989-1993); La Commission Abragam présente son rapport

    CERN Multimedia

    CERN Press Office. Geneva

    1987-01-01

    Le Conseil du CERN s'est réuni à Genève (Suisse); Josef Rembser élu comme président du Conseil; le Prix Nobel Carlo Rubbia nommé prochain Directeur Général (1989-1993); La Commission Abragam présente son rapport

  20. Identification and characterisation of putative seminal fluid proteins from male reproductive tissue EST libraries in tiger beetles.

    Science.gov (United States)

    Rodríguez-García, María Juliana; Machado, Vilmar; Galián, José

    2015-05-16

    The study of proteins transferred through semen can provide important information for biological questions such as adaptive evolution, the origin of new species and species richness. The objective of this study was to identify seminal fluid proteins (SFPs) that may contribute to the study of the reproductive system of tiger beetles (cicindelids), a group of more than 2,500 species distributed worldwide that occupy a great diversity of habitats. Two cDNA libraries were constructed from the male gonads of Calomera littoralis and Cephalota litorea. Expressed sequence tags (ESTs) were analysed by bioinformatics approaches and 14 unigenes were selected as candidate SFPs, which were submitted to Reverse Transcription Polymerase Chain Reaction (RT-PCR) to identify patterns of tissue-specific expression. We have identified four novel putative SFPs of cicindelids, of which similarity searches did not show homologues with known function. However, two of the protein classes (immune response and hormone) predicted by Protfun are similar to SFPs reported in other insects. Searches for homology in other cicindelids showed one lineage specific SFPs (rapidly evolving proteins), only present in the closely related species C. littoralis and Lophyra flexuosa and two conserved SFP present in other tiger beetles species tested. This work represents the first characterisation of putative SFPs in Adephagan species of the order Coleoptera. The results will serve as a foundation for further studies aimed to understand gene (and protein) functions and their evolutionary implications in this group of ecologically relevant beetles.

  1. Il est beau le lavabo, il est laid le bidet

    DEFF Research Database (Denmark)

    Nølke, Henning

    1998-01-01

    Artiklen analyserer dislokering af subjektet på fransk. Der skelnes mellem tre hovedtyper: venstredislokering med og uden intonationsbrud og højre dislokering. I alle tilfælde indeholder sætningskernen principielt en pronominel kopi af subjektet. Det påvises, at de tre typer svarer til tre forske...

  2. Prévention de la transmission mère-enfant du VIH/sida au Bénin: le consentement des femmes au dépistage est-il libre et éclairé ?

    Science.gov (United States)

    Kêdoté, N.M.; Brousselle, A.; Champagne, F.; Laudy, D.

    2016-01-01

    Résumé Introduction Dans les politiques internationales et nationales sur le VIH/sida, le consentement libre et éclairé est reconnu comme une composante essentielle des programmes de dépistage. Le consentement libre et éclairé implique pour les femmes enceintes d’obtenir des informations sur le programme de prévention de la transmission du VIH de la mère à l’enfant (PTME), de les comprendre et de faire un choix autonome après avoir évalué les risques et avantages. Cependant, aucune évaluation du programme de PTME ne s’est intéressée au consentement. L’objectif de cet article est d’explorer le caractère libre et éclairé du consentement des femmes enceintes quant au dépistage et à leurs motivations à faire le test. Méthode Nous avons utilisé des données récoltées dans le cadre d’une analyse d’implantation du programme de PTME au Bénin. Cette analyse s’appuie sur un devis d’étude de cas multiples incluant six maternités choisies parmi les 56 sites fonctionnels. Spécifiquement pour l’analyse du consentement, nous avons associé les données provenant d’une enquête à celles d’une recherche qualitative. Résultats Hormis trois cas de dépistage à l’insu, le caractère volontaire du consentement au test est respecté sur les sites de PTME. Vingt-neuf cas de refus ont été identifiés. Les raisons les plus souvent évoquées par les femmes enceintes sont la peur du résultat positif et de ses conséquences sur la vie familiale dans 55,2 % des cas et l’attente de l’accord ou du désaccord du mari dans 27,6 % des cas. Si globalement le consentement a été volontaire sur tous les sites, son caractère éclairé est moins probant. PMID:27840660

  3. Vents d’Est, vents d’Ouest : L'introduction de l'esprit des Lumières dans le Vietnam au début du XXe siècle

    OpenAIRE

    Phuong Ngoc, Nguyen

    2015-01-01

    International audience; À partir du milieu du XIXe siècle, le royaume Dai Nam des Nguyen passe progressivement sous l'autorité française : après l'attaque du port de Tourane (actuellement Đà Nẵng) en 1858, Saigon est prise en 1859, le sud du pays devient une colonie française sous l'appellation de Cochinchine à partir de 1862 et le reste du pays, divisé en Tonkin et Annam, entre définitivement en 1884 dans l’empire sous le régime du protectorat. La langue française étant la langue de l'admini...

  4. Twitter a­-t­-il bousculé le droit parlementaire ? : Le jour où le #directAN s'est invité dans l'hémicycle

    OpenAIRE

    Chibois , Jonathan

    2014-01-01

    International audience; En février 2013, lors de l'examen à l'Assemblée nationale du projet de loi sur l'ouverture du mariage aux couples de même sexe, l'agitation est telle sur Twitter que, au quatrième jour de délibération, la séance publique dans l'hémicycle est levée pour quelques minutes. À plusieurs reprises ensuite, fréquentes sont les allusions à des échanges de tweets entre députés, jugés inappropriés, pour lesquels sera demandée, sans succès, une régulation du président de séance. L...

  5. Triatominae et Cactaceae : un risque pour la transmission de la Trypanosomose américaine dans le péridomicile (nord-est du Brésil

    Directory of Open Access Journals (Sweden)

    Emperaire L.

    2006-06-01

    Full Text Available Les observations de terrain réalisées dans le nord-est du Brésil ont montré la fréquente association, dans l’espace péridomiciliaire, entre un cactus, le Cereus jamacaru, la présence de nids dans ses branches et celle de Rhodnius neglectus et de Triatoma pseudomaculata, espèces vectrices du parasite Trypanosoma cruzi, agent de la maladie de Chagas. L’analyse des variables architecturales de cette Cactaceae montre que la présence de nids, et donc d’insectes, est inféodée aux pratiques traditionnelles de gestion de ce cactus. Cette étude souligne l’intérêt d’une approche intégrée de l’écologie des Triatominae pour l’identification des variables indicatrices de risque.

  6. Deep earth fluids and huge metallogenetic belt and fatal geological disaster: 60th anniversary of Professor Du Le-tian engaging in geology

    International Nuclear Information System (INIS)

    Ou Guangxi; Tao Shizhen; Liu Yinhe

    2012-01-01

    Professor Du Le-tian has been researching for a long time on scientific relationship between deep earth fluids and hydrocarbon accumulation and metallogenesis, as well as gestation and prediction of disasters. He has contributed greatly to the development of that scientific field. From 6 to 8, July, 2012, 'Workshop on Deep Earth Fluids and Huge Metallogenetic Belt, Fatal Geological Disaster, as well as 60 th Anniversary of Professor Du Le-tian Engaging in Geology' was successfully convened in Beijing, totally with 76 delegates present who were experts, scholars or students from USA, Hong Kong, or various institutes, colleges or universities of China. In the workshop, the scientific presentations discussed were counted up to 49, on aspects of geological processes of deep earth fluids, relationship between earth degassing and hydrocarbon accumulation or metallogenesis, gestating mechanism of volcanic eruptions and strong earthquakes as well as their relations with mine gas outburst, high-temperature and high-pressure experimental earth science, etc.. (authors)

  7. Le virus de l'enroulement des feuilles du cerisier, largement repandu en France sur noyer, est-il a l'origine de l'incompatibilite de greffage du noyer Juglans regia sur Juglans nigra

    OpenAIRE

    Delbos, R.; Bonnet, A.; Dunez, Jean

    1984-01-01

    Sur les 2 millions de noyers exploités en France, la moitié environ est cultivée en verger : 20 p. 100 des arbres du verger français de noyer sont greffés sur Juglans nigra, le reste étant greffé sur J. regia. Des symptômes de nécrose de la zone de greffe sont signalés assez couramment sur les arbres greffés sur J. nigra, surtout depuis quelques années ; ces symptômes sont tout à fait semblables à ceux décrits aux U.S.A. dans le cas d’arbres greffés sur J. hindsii ou « Paradox » (J. hinds...

  8. Etendue des prestations de l'assurance-maladie sociale : le catalogue des prestations est- il suffisant pour que tous accèdent à des soins de qualité ?

    OpenAIRE

    Polikowski, Marc; Lauffer, Régine; Renard, Delphine; Santos-Eggimann, Brigitte

    2000-01-01

    Le projet "prestations de l'assurance-maladie sociale" est l'un des projets partiels élaborés par l'Office fédéral des assurances sociales (OFAS) dans le cadre de l'analyse des effets de la LAMal. Deux approches complémentaires sont adoptées pour répondre à la question du caractère suffisant du "catalogue" suisse des prestations à charge de l'assurance-maladie sociale: d'une part, la comparaison des "catalogues" des prestations remboursées en Suisse et à l'étranger et, d'autre part, l'examen ...

  9. Sédimentation et diagenèse des minéraux argileux du Jurassique supérieur-Crétacé dans le Jura méridional et le domaine subalpin (France, Sud-Est). Comparaison avec le domaine Atlantique Nord

    OpenAIRE

    Deconinck , Jean-François

    1984-01-01

    Le but de cette thèse est de décrire et d'expliquer l'évolution des assemblages argileux dans les Alpes occidentales depuis l'Oxfordien jusqu'au Crétacé supérieur, et de la comparer à celle connue dans l'Atlantique nord grâce aux forages DSDP. Etude géologique, sédimentologique et géochimique. Les assemblages argileux du Mésozolque supérieur (Malm - Crétacé) du domaine subalpin et du Jura mérldional sont étudiés par diffraction des rayons X, microscopie électronique à transmission et analyses...

  10. Numerical Investigation of an Absorption-Diffusion Cooling Machine Using C3H8/C9H20 as Binary Working Fluid Étude numérique d’une machine frigorifique à absorption-diffusion utilisant le couple C3H8/C9H20

    Directory of Open Access Journals (Sweden)

    Dardour H.

    2013-05-01

    Full Text Available This paper is concerned with the analysis and the simulation of a heat-driven absorption-diffusion cooling machine which can operate with low-grade heat sources. The simplified configuration of the heat-powered absorption-diffusion refrigerating machine considered in this study is based on the Platen-Munters single pressure refrigerators principle [Platen B.C.V. and Munters C.G. (1928 Refrigerator, US Patent 1, 685-764J. Three working fluids are used, nonane as an absorbent, propane as a refrigerant and hydrogen as the inert auxiliary gas. The designed cooling capacity of the machine is 1 kW which is suitable for a domestic use for refrigeration purposes. We restricted the maximum temperature of the driving heat supplied to the generator to 130 °C, a temperature achievable with evacuated-tube solar collectors. The simulations are carried out using a commercially available flow sheeting software with the PengRobinson equation of state as property prediction method. In this paper, we analyze the heat and mass transfer characteristics in all relevant machine components (absorber, condenser, generator and solution heat exchangers. The simulations results allow determining the values of different parameters of the systems such as the refrigerant and the solvent temperatures in various points of the machine, the liquid and the vapor flow rates and compositions. The system performances were parametrically analyzed using the flow sheeting software. Performance characteristics were determined for a wide range of operating conditions allowing investigating and evaluating the effect of various design parameters. Ce papier est consacré à l’étude et l’analyse d’une machine frigorifique à absorption-diffusion. La machine est actionnée grâce à une source de chaleur de température modérée. La configuration et le principe de fonctionnement de l’appareil obéissent au modèle de Platen Munters [Platen B.C.V. and Munters C.G. (1928 Refrigerator

  11. Effet du biotope sur la diversité floristique et le polymorphisme phénotypique des groupements à Tamarix africana Poir. dans les zones arides de la région de Khenchela (Est Algerien

    Directory of Open Access Journals (Sweden)

    Khabtane Abdelhamid

    2012-12-01

    Full Text Available RESUME Le genre Tamarix (Tamaricaceae regroupe plus de 80 espèces, parmi eux le Tamarix africana Poir. qui représente une très grande ubiquité en Algérie, soit du point de vue climatique (humidité et sécheresse, édaphique (sols salés et calcaires; où il représente l’espèce  à caractère typique des plantes thermo xérophytes. Pour contribuer à la connaissance de cette espèce et de son comportement nous avons essayé de suivre le comportement  phytosociologique ainsi que sa variabilité morphologique (l’hauteur, le recouvrement basale, nombre des ramifications à la base.. dans trois biotopes, extrêmement différents du point de vue climatique et édaphique,  dans les zones steppiques arides de la région de Khenchela (Est Algérien et qui sont  choisis  selon un transect Nord - Sud. Les résultats révèlent que les groupements à Tamarix africana Poir. représentent une richesse floristique importante, qui se diffère d’un site à l’autre, avec un polymorphisme phénotypique adaptée aux conditions spécifiques à chacun des trois sites et qui lui permet d’être l’espèce à forme arbustive  la plus adaptée pour la réhabilitation des écosystèmes dégradés dans les zones de transitions Désert-NordMots clés Tamarix africana P. - ubiquité- thermo xérophytes-  régions arides- halophytes- polymorphisme phénotypique

  12. Le cinéma est-il bachelardien? hypothèse théoriques autour de la matière (et des images

    Directory of Open Access Journals (Sweden)

    Éric Thouvenel

    2012-10-01

    Full Text Available Either in his epistemological or "poetic" writings, Gaston Bachelard has almost never referred to the cinema – of which he was contemporary –, unlike other artistic practices, more valued, such as painting or engraving. Where, exceptionally, he mentions the device that produces moving images, this is called as a foil or a negative model, also like his theoretical "opponent" Henri Bergson. This text offers from this "missed encounter" between Bachelard and films to re-examine the relation of the philosopher with the material, either in the books on the four elements and in the epistemological works like Le matérialisme rationnel and Les intuitions atomistiques. Indeed, cinema is an ambiguous art: deeply material in its main relationship with the real and, at the same time, secured by its mode of production (recording and presentification (projection of the images, an immaterial dimension that is now accelerating. By his constant attention to the tangible presence of things, to the qualities of material, to the fundamental relationship between the eye and the hand in a perspective even more phenomenological, Bachelard's thinking help to think the material dimension of motion pictures, often underestimated or simply removed. Conversely, the cinema has been accustomed us to original forms of perception (the blur, the fade, the overprinting, the slow or accelerated motion, which can explain certain aspect of philosopher’s thinking, which have been very few convened.

  13. Pobreza, desigualdad y modelos de bienestar en los países de la UE-15. ¿Cómo le está afectando la crisis?

    OpenAIRE

    López Páramo, Ricardo

    2016-01-01

    Traballo Fin de Grao en Administración e Dirección de Empresas El objetivo fundamental de este trabajo es analizar la pobreza y desigualdad en la Unión Europea, clasificando a los países por modelos del bienestar y comparando la situación actual con la existente en 2009, año en que se inició la crisis económica en la que todavía nos encontramos. Esto nos permitirá conocer qué situación presenta cada país en términos de pobreza y desigualdad, tanto al inicio de la crisis como en la actualid...

  14. Vaincre le vampire violet | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Est depuis le début des années 1990 lorsque le Centre de recherches pour le développement international, une société d'État canadienne, l'a invité à se pencher sur le problème de la striga en Afrique subsaharienne.

  15. Vienne 1780-Paris 1793 ou Le plus révolutionnaire des deux musées n’est peut-être pas celui auquel on pense d’abord...

    OpenAIRE

    Pommier, Édouard

    2011-01-01

    L’ouverture, en 1783, du musée impérial de Vienne, au palais du Belvédère, qui avait été la résidence du prince Eugène, est un événement important dans l’histoire des musées. En effet, Christian von Mechel, qui avait été chargé par Joseph II de l’organiser, adopte pour la première fois et de manière systématique le parti d’une présentation des tableaux de la collection des Habsbourg par « écoles » et, en principe, à l’intérieur des écoles, suivant une progression chronologique. Ce système, ad...

  16. The right to energy is a social, economical and environmental emergency; Le droit a l'energie est une urgence sociale, economique et environnementale

    Energy Technology Data Exchange (ETDEWEB)

    Coulon, Pierre-Jean

    2010-09-15

    2 billion people on the planet do not have access to energy. This energy deficiency has an impact on health, infant mortality, life expectancy, education, and women's emancipation and it slows development. Following the Copenhagen summit, in a financial crisis context that heavily impacted the world economies, energy issues demand real political commitment, because solutions exist. They include awareness-building, responsibility and commitment of society, because a better accessibility for the populations can't be achieve without the beneficiaries. [French] 2 milliards d'individus n'ont pas acces a l'energie sur la planete. Impact sur la sante, sur la mortalite infantile, sur l'esperance de vie, sur l'education, sur l'emancipation des femmes a cette situation de carence energetique est un frein au developpement. Au lendemain du Sommet de Copenhague, dans un contexte de crise financiere qui a impacte lourdement l'economie mondiale, les questions energetiques necessites une reelle volonte politique, car des solutions existent. Celles-ci passent notamment par la sensibilisation, la responsabilisation et l'implication de la societe civile, car permettre une meilleure accessibilite des populations ne peut pas se faire sans les beneficiaires eux-memes.

  17. Contribution méthodologique pour la connaissance du rôle des acteurs locaux dans la réalisation d’un projet de territoire : le cas du projet de la réserve naturelle de Réghaia dans la zone côtière Est de l’Algérois

    Directory of Open Access Journals (Sweden)

    Mohamed Larid

    2010-12-01

    Full Text Available Dans le domaine de la gestion territoriale, on peut constater le manque et l’insuffisance des outils d’analyse des stratégies des acteurs. Ceci est encore plus ressenti dans les sociétés du monde en développement, où les mécanismes de gestion et d’administration du territoire sont souvent dysfonctionnels. Une meilleure connaissance des relations entre les intervenants dans l’application d’un projet territorial, permet des éclairages sur le contexte de sa réalisation et des orientations suceptibles d’avantager sa réussite. Les repères sur les logiques de comportement aident à cerner les enjeux et à poser les questions clés, pour atteindre les objectifs fixés et conforter l’accomplissement des actions arrêtées. Le présent article rend compte des résultats d’une expérience de terrain, réalisée dans une zone côtière humide de la région algéroise. Il propose une contribution, sur le plan méthodologique, pour la collecte d’informations pertinentes sur le comportement et les possibilités des acteurs dans la réalisation d’un projet local, orienté vers la valorisation et la protection d’un patrimoine naturel important.In the field of territorially management, we can see the insufficiency of analysis tools on the strategies of actors. This is even more crucial in case of the developing world, where the management and territorially administration are often dysfunctional. Better knowledge of the roles of stakeholders in the implementation of a territorial project, provides insights of the context of its implementation and guidance likely to favor its success. The logical behavior help to identify issues and key questions, to achieve the objectives and ensure the completion of actions agreed. This article reports the results of a field experiment conducted in a coastal wetland in the region of Algiers. It offers a contribution, on the methodology for collecting information on the behavior and capabilities of

  18. Gestion de l'eau en milieu aride : considérations physiques et sociales pour l'identification des territoires pertinents dans le Sud-Est tunisien

    Directory of Open Access Journals (Sweden)

    Bruno Romagny

    2006-02-01

    Full Text Available La situation actuelle des ressources en eau et de leurs usages dans le Sud-Est tunisien présente des enjeux qui sont communs à de nombreuses régions du bassin méditerranéen : des ressources limitées et déjà largement exploitées pour répondre à la croissance des besoins, le recours accru aux ressources dites non conventionnelles, une situation de concurrence entre usages sectoriels, une marchandisation croissante des ressources, et des conditions climatiques contraignantes qui viennent renforcer les tensions autour de l'eau. Dans le contexte des mutations en cours, face aux risques de déficits en eau et à la nécessité d'un développement économique et social équilibré, ces caractéristiques, parmi d'autres, font de la Jeffara tunisienne un cas d'étude exemplaire des difficultés que pose la gestion intégrée de l'eau. Celle-ci doit prendre en compte les différentes sources d'approvisionnement ainsi que les différents usages associés, et donc l'identification des territoires pertinents pour cette  gestion, compte tenu des relations amont-aval naturelles et artificielles d'une part, et des cohérences institutionnelles et sociales d'autre part.The current situation of the water resources and their uses in South-Eastern Tunisia presents stakes which are common to many areas of the Mediterranean basin : limited and already largely exploited resources to address the growth of the needs, the increasing use of so-called non conventional resources, a competition between sectoral uses of water, an increasing merchandising of the resources, and constraining climatic conditions which reinforce the tensions around water. In the context of the changes in progress, facing the hazard of water deficits and with the need for a balanced economic and social development, these characteristics, among others, make Tunisian Jeffara be an exemplary case of study of the difficulties raised by the integrated water resources management. This one

  19. Qui est Méduse?

    Directory of Open Access Journals (Sweden)

    Julia Kristeva

    2015-04-01

    Full Text Available Une belle histoire de têtes coupées traverse l'Antiquité grecque : celle des Gorgones, trois monstres ailés au corps de femme et à la chevelure de serpents, dont le regard changeait en pierre celui qui se risquait à les contempler – Méduse, Euryalé et Sthéno. Pour commencer, Méduse est une jeune fille qui se fait remarquer : séduite puis violée par Poséidon, elle se révèle fertile puisqu'elle accouche de faux jumeaux, le cheval Pégase et le géant Chrysaor. Une longue fable la transforme en terrible puissance. Pour simplifier, disons que le monstre est par deux fois tué : Persée assassine d'abord Méduse pour assurer la protection de sa mère, Danaé, importunée par le roi Polydectès. Ensuite, il délivre Andromède des liens méduséens qui la retiennent et, pour ce faire, tranche la tête de la Gorgone. La mer se teinte de sang, tandis que le vainqueur tient à l'écart l'épouvantail de Méduse, de peur que ne soient changés en statues de pierre ceux qui s'exposeraient à sa vue.

  20. « Le Paradis, c’est les autres ». Isolat relationnel et expérience du paradis : une entrée par le tourisme “Heaven is other people”. Relational isolation and experience of Heaven in tourism

    Directory of Open Access Journals (Sweden)

    Rachid Amirou

    2008-10-01

    Full Text Available L’engouement pour des sites ou des lieux est souvent dû à des « Nous » (des communautés éphémères, qui se constituent et qui consacrent ainsi l’espace de visite. La consécration collective est souvent un préalable au succès de certaines destinations (Ibiza, Saint-Tropez, Marrakech, etc.. Le succès des formules de villages de vacances hermétiquement fermés à l’extérieur et indifférents au pays de séjour atteste de l’existence d’un état d’esprit qu’on a classé sous le terme générique de « bulle touristique ». Cependant, la constitution de ces « bulles » – c’est-à-dire la rencontre d’un imaginaire, d’un « nous » et d’un espace touristiques – ne se fait pas uniquement par l’exclusion de l’autre. Elle repose aussi sur un principe interne positif : le rêve d’une sociabilité parfaite, une sorte de paradis relationnel. Le « paradis » touristique, c’est d’abord une rencontre de plain-pied avec les autres (« l’ambiance », souvent d’ailleurs avec les mêmes – rencontre synonyme de relations différentes et moins stressantes, basées sur une connivence réelle ou fantasmée. La généalogie de ce paradis touristique relationnel, qui peut être aussi un enfer pour les autres, reste à décrire et à expliciter, en montrant comment il compose le noyau central de l’imaginaire touristique.The appeal of sites or places often stems from the existence of "Us" entities (short-lived communities, which come together and thus consecrate the visited space. Collective consecration is often a prerequisite to the success of some destinations (Ibiza, Saint-Tropez, Marrakech, etc. The success of vacation villages hermetically closed to the outside world and indifferent to the surrounding country is testimony to the existence of a state of mind that has been classed within the generic term "tourist bubble". However, the constitution of such "bubbles" - that is to say, the meeting

  1. Le sud-est européen et l'Europe: Origines et perspectives d'une altérité mal assumée en marge de l'élargissement européen

    Directory of Open Access Journals (Sweden)

    Bojović Boško

    2004-01-01

    Full Text Available (francuski Depuis l'Antiquité l'histoire de la Péninsule balkanique est jalonnée d'alternances entre clivages culturels ou politiques et synthèses de civilisation: Grèce, Rome, Byzance, Empire ottoman. Ce qui a créé une superposition de nuances et de différenciations ethniques et nationales selon les lignes de partage confessionnelles et culturelles, idéologiques et politiques. La rémanence de ces lignes de partage, issues en partie du Moyen Age, et qui ne cessent de se démultiplier depuis le XIXe siècle, fait que les Balkans oscillent de nos jours entre adhésion aux processus d'intégration euro-atlantiques et processus de désintégrations successives sur la base des singularisassions communautaires et de pulsions identitaires. Menace majeure de la stabilité européenne au XIXe siècle connue à l'époque sous la dénomination de "Question d'Orient", la crise balkanique est depuis la fin du XXe siècle une zone d'ombre sur la toile d'intégration européenne. Les redoutables difficultés à gérer cette crise désormais redevenue chronique, font que les Balkans, indépendamment ou non de toutes autres contradictions euro-atlantiques, apparaissent comme un espace crucial au sein duquel la future Grande Europe joue tout ou partie de son avenir.

  2. Hermon est

    OpenAIRE

    Aliquot, Julien

    2012-01-01

    105. Deir el-Aachaiyer Architecture : Krencker & Zschietzschmann 1938, p. 256-264, 292-293, pl. 110-115 et 118, 27 (état des lieux en 1905, compléments en 1933) ; Dentzer-Feydy 1999, p. 531-532 et 551 (notes et dessins de W.J. Bankes) ; Chéhab 1949-1950, p. 111 (tête tourelée de Tyché). Photos : Taylor 1971, p. 86-89 ; Blas de Roblès, Pieri & Yon 2004, p. 179-180 ; Nordiguian 2005, p. 104-105. Site revu. Épigraphie : IGLS 11, 4 (dédicace). Le village moderne de Deir el-Aachaiyer (1250 m d’alt...

  3. Le Sanskrit

    CERN Document Server

    Balbir, Nalini

    2013-01-01

    Cet ouvrage est destiné à tous ceux qui souhaitent se mettre ou se remettre à l'étude du sanskrit et ne peuvent y consacrer que quelques minutes par jour. En suivant le principe de la méthode quotidienne Assimil, vous acquerrez progressivement le vocabulaire et la grammaire de base qui sont nécessaires à la lecture des textes de la littérature sanskrite classique. Vous trouverez dans cette méthode une approche vivante de la langue et de la culture sanskrite classique à travers des textes d'abord adaptés pour le débutant puis authentiques. En quelques mois, vous manierez la langue sans efforts ni hésitation, de manière très naturelle. Les enregistrements reprennent l'intégralité des textes en sanskrit des leçons et des exercices de traduction du livre. Ils sont interprétés, à un rythme progressif, par des locuteurs natifs professionnels.

  4. L'analyse des semences d'arachide fermières pour le contrôle de ...

    African Journals Online (AJOL)

    Le manque de semences sélectionnées en qualité satisfaisante et en quantités suffisantes est une contrainte majeure à la production de l'arachide (Arachis hypogea L.) en Afrique centrale. La multiplication de semences en milieu paysan est le moyen de propagation le plus rapide, le moins cher et le plus durable.

  5. Discordance gradient-surface dans le rétrécissement mitral: le gradient moyen transmitral est-il un critère de sévérité ou un indice de tolérance du rétrécissement mitral serré?

    Science.gov (United States)

    Najih, Hayat; Arous, Salim; Laarje, Aziza; Baghdadi, Dalila; Benouna, Mohamed Ghali; Azzouzi, Leila; Habbal, Rachida

    2016-01-01

    Le rétrécissement mitral (RM) rhumatismal demeure une valvulopathie fréquente dans les pays en voie de développement. Cependant, les pays industrialisés ont vu l'émergence ces dernières années de nouvelles étiologies de RM; notamment l'origine médicamenteuse et/ou toxique responsable de valvulopathies restrictives aussi bien sténosantes que régurgitantes. Pour cette raison, l'évaluation échocardiographique du RM et surtout, la définition de critères objectifs pour conclure au caractère serré du RM reste toujours d'actualité. Les objectifs du travail sont: évaluer l'existence ou non d'une corrélation directe entre le gradient moyen transmitral (GMT) et la sévérité du RM chez les patients porteurs d'un RM serré ou très serré (critère primaire) et analyser les différents paramètres qui conditionnent le gradient moyen transmitral (GMT) (Critère secondaire). Il s'agit d'une étude transversale monocentrique incluant tous les patients admis au service de Cardiologie du CHU Ibn Rochd de Casablanca pour un RM serré ou très serré, sur une période d'une année (Janvier 2014 à Décembre 2014). Nous avons analysés séparément deux groupes de patients : ceux avec un gradient moyen transmitral10mmHg (groupe2). 50 patients porteurs d'un RM serré ou très serré ont été inclus. L'âge moyen de nos patients est de 41,7 ans avec prédominance féminine (sex ratio: 0,25). 64% de nos patients avaient un RM serré et 36% avaient un RM très serré. 52% (26 patients) avaient un GMT 10mmHg, ce qui suggère l'absence de corrélation directe entre la sévérité du RM et le GMT (coefficient de Pearson R: -0,137). Pour la dyspnée, 80% des patients du groupe 1 étaient dyspnéiques stade II de la NYHA et 70% des patients du groupe 2 étaient dyspnéiques stade III (41%) ou IV (29%) de la NYHA, ce qui signifie l'existence d'une corrélation significative entre le GMT et la sévérité de la dyspnée (R: 0,586 et p: 0,001). L'étude analytique de la fr

  6. Mécanique des fluides fondamentale

    CERN Document Server

    Zeytounian, Radyadour K

    1991-01-01

    Ce cours de mecanique des fluides est avant tout un cours theorique qui repond aux questions fondamentales de ce sujet de recherche. Les quatre premiers chapitres presentent les equations propres a determiner l'ecoulement de fluide considere et diverses solutions. Les chapitres 5 et 6sont consacres aux problemes lies la stabilite, aux bifurcations et aux comportements chaotiques. Le livre donne un vision globale des questions traitees en mecanique des fluides qui sont a la base de toute la recherche, de la modelisation et de toutes les applications dans ce domaine.

  7. Peuplement et organisation du territoire dans une région d'implantation ibâḍite : le Jebel Demmer dans le sud-est de l'Ifrîqiya (ve/xie- ixe/xve siècle

    Directory of Open Access Journals (Sweden)

    Mohamed Hassen

    2012-12-01

    Full Text Available Cet article s’intéresse aux formes de peuplement et d’organisation du territoire dans le Jebel Demmer à l’époque médiévale, lorsque cette région du sud de l’Ifrîqiya comportait encore une importante population ibadite, elle-même scindée en plusieurs groupes. Après avoir évoqué la délimitation du territoire à l’époque médiévale, l’article propose une réflexion sur l’apparition et la typologie des qsûr. Leur développement en tant qu’unités fondamentales dans l’organisation de l’espace local est rattaché aux invasions hilaliennes, qui provoquèrent un afflux important de populations ibâḍites dans cette région, qui devint pour quelque temps l’un des bastions de cette minorité en Ifrîqiyya. Enfin, la diffusion du malékisme est évoquée, faisant ressortir la lenteur de ce processus, encore inachevé au début du xve siècle.

  8. Le paludisme au Mexique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nancy Minogue

    Le paludisme est depuis longtemps un important problème de santé publique au Mexique, où les conditions qui prévalent ... C'est dans les régions côtières que le problème a persisté le plus longtemps, les mesures ... recherche sur l'écologie des moustiques a permis d'en découvrir les raisons. « Les moustiques ne se ...

  9. Publications | Page 95 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI et la lutte contre le paludisme. DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le.

  10. An Examination of the Multiphase Darcy Model of Fluid Displacement in Porous Media Examen du modèle polyphasique de Darcy de déplacement de fluides en milieu poreux

    Directory of Open Access Journals (Sweden)

    Wright R. J.

    2006-11-01

    Full Text Available The multiphase Darcy model used to represent two-phase immiscible displacement flow within porous media is critically examined, and the principle assumptions and limitations discussed. We identify some of the main problems which require better understanding in order that conceptual progress in the physics of multiphase flow can keep pace with increasing computional capabilities. The implications of the one-dimensional aspect of present displacement models are explored more fully than have previous authors. This approcch to the conceptual problems of Buckley-Leverett theory enables a new explanation to be given of the shock front stabilisation phenomenon. A specific theoretical example of this problem is given, and is explained in terms of cross-flow effects between adjacent zones of the matrix. To achieve improvement of the present model a cross-flow resistance term would have to be included because, using present methods errors in relative permeability determination are expected, particularly in irregular media and when extreme viscosity ratios are involved. On examine d'une manière critique le modèle polyphasique de Darcy utilisé pour représenter le déplacement d'une phase par une autre non miscible à l'intérieur d'un milieux poreux et on discute les principales hypothèses et limitations. On identifie quelques-uns des principaux problèmes qui demandent une meilleure compréhension pour que les progrès conceptuels dans le domaine de la physique des écoulements polyphasiques puissent aller de pair avec les capacités croissantes de calcul. On explore, plus à fond que ne l'ont fait jusqu'à présent d'autres auteurs, les implications de l'aspect unidimensionnel des modèles actuels de déplacement. Cette approche des problèmes conceptuels de la théorie de Buckley-Leverett permet de donner une nouvelle explication du phénomène de stabilisation du front de choc. On donne un exemple théorique spécifique de ce problème qui est

  11. Le laboratoire, le temple et le marché

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chapra est conseiller économique auprès de l'Agence monétaire d'Arabie Saoudite. Il a beaucoup écrit sur l'économie et la finance en pays islamique, et son ouvrage le plus important est Towards a Just Monetary System: A Discussion of Money, Banking, and Monetary Policy in the Light of Islamic Teachings (1985).

  12. Reflexion sur le climat, l'effet de serre et le rechauffement global ...

    African Journals Online (AJOL)

    Le climat de la Terre est largement influencé par l'état de son atmosphère. Le rayonnement solaire jouerait un rôle primordial dans la climatologie terrestre certes, néanmoins, il n'est plus en mesure à lui tout seul d'expliquer le climat qui prédomine, en moyenne, à la surface de la terre. L'effet de serre serait le phénomène ...

  13. Le développement durable est-il bienvenu dans les organisations ? Cas de l’implantation d’un Système de Management Environnemental en Tunisie

    Directory of Open Access Journals (Sweden)

    Moez Ben Yedder

    2009-02-01

    Full Text Available Les entreprises sociétalement responsables sont celles qui s’inscrivent dans une logique de développement durable. Leur engagement se matérialise, notamment, par le déploiement de systèmes de gestion respectueux de l’environnement tels que les systèmes de management environnemental (SME. En plus de leur portée écologique, ces derniers ont une visée sociale puisqu’ils permettent d’améliorer les conditions de travail des opérateurs. Toutefois, leur mise en place peut être gênée par ces derniers s’ils ne retrouvent pas leurs intérêts lors de l’instauration d’un tel système. L’objectif de ce texte est d’étayer cette idée à partir de l’étude de cas d’une entreprise tunisienne où l’instauration d’un SME n’a pu aboutir en partie à cause de la résistance du personnel. Dans ce sens, nous appuierons l’idée selon laquelle les pratiques du Développement Durable et de la Responsabilité Sociale de l’Entreprise ne se greffent pas ex abrupto sur une entreprise mais nécessitent certains préalables d’ordre organisationnel pour être mis en place.Socially responsible firms are the ones which act in accordance to sustainable development logic. Their engagement is materialised by deploying environment friendly practices such as environmental management system (EMS. Those systems have also a social purpose in the way that they allow enhancing work conditions of operators. However, their setting could be embarrassed by those ones because of the change of habits that it implies for them. The purpose of this study is to shore up this idea by resorting to a case study of a Tunisian firm in which the setting of the environmental management system turned failed in part because of the resistance of the personnel. We will defend the idea that practices of sustainable development and corporate social responsibilities couldn’t be correctly adopted by firms without taking into consideration to some organizational

  14. le des acteurs dans le processus de conservation et de valorisation du patrimoine local du village berbère de Chenini (Sud-est Tunisien), analyse des jeux d'acteurs par la méthode MACTOR

    OpenAIRE

    Khattali, H.; Sghaier, M.; Sandron, Frédéric

    2016-01-01

    Le village de Chenini dispose d'un potentiel patrimonial d'une richesse exceptionnelle. Aujourd'hui, plusieurs menaces inquiétantes ont été identifiées dans le village risquent d'endommager la valeur culturelle et le développement local durable. Le présent travail a pour objectif de mettre en exergue l'importance du patrimoine local existant et d'analyser l'implication des acteurs dans le processus de sa conservation et de sa valorisation. L'approche méthodologique repose sur l'analyse de jeu...

  15. Le Grand Inquisiteur : Âme et corpsQu’est-ce qu’une conversion sans adhésion de l’âme ?

    Directory of Open Access Journals (Sweden)

    Caroline Julliot

    2012-02-01

    Full Text Available Cet article vise à replacer dans le contexte philosophique et métaphysique général du romantisme la forme particulière de conversion figurée à travers le personnage du Grand Inquisiteur - en montrant en quoi elle se constitue en rupture totale avec la vérité historique.This article aims to replace in the general philosophical and metaphysical context of the romanticism the particular shape of conversion represented through the character of the Great inquisitor - by showing in what it is constituted in total break with the historical truth.

  16. Archéologie des monastères du premier millénaire dans le Centre-Est de la France. Conditions d’implantation et de diffusion, topographie historique et organisation

    Directory of Open Access Journals (Sweden)

    Sébastien Bully

    2009-12-01

    Full Text Available Lorsqu’en 1997 le Conseil national de la recherche archéologique publiait le bilan 1990-1994 de la recherche en France et sa nouvelle programmation, figurait parmi les thèmes prioritaires : « Les origines et les fonctions des premiers bâtiments monastiques : églises et organisation des bâtiments communautaires, relations entre architecture et règle monastique » . Il était alors rappelé que l’on ne savait rien des fondations colombaniennes et très peu des abbayes carolingiennes. Depuis lors, d...

  17. Nanostructures pour le développement de vaccins contre le virus de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Institut national de la recherche agronomique (France). Ce projet est financé par le fonds d'innovation en vaccins pour le bétail, un partenariat entre la fondation Bill et Melinda Gates, Affaires Mondiales Canada et le Centre de recherches pour le ...

  18. GeneXpert MTB/RIF dans le dépistage de la tuberculose pulmonaire à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo: quelles leçons tirées après 10 mois d’utilisation?

    Science.gov (United States)

    Lupande, David; Kaishusha, David; Mihigo, Carine; Itongwa, Moise; Yenga, Gustave; Katchunga, Philippe

    2017-01-01

    Introduction En Afrique subsaharienne, les méthodes de diagnostic de la tuberculose sont insuffisantes et reposent essentiellement sur la microscopie. Elles constituent un réel frein pour le contrôle de la tuberculose. La présente étude voudrait évaluer les performances du GeneXpert MTB/RIF vis à vis de la microscopie classique de Ziehl-Neelsen à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo après 10 mois d’utilisation. Méthodes Les résultats de la coloration au Ziehl-Neelsen et de la biologie moléculaire sur GeneXpert MTB/RIF de 452 patients suspects de tuberculose ont été colligés. La validité d’un test par rapport à l’autre dans la détection de la tuberculose a été étudiée. Résultats Dans le groupe entier, la fréquence de la tuberculose pulmonaire était de 16.3%. La positivité était significativement plus élevée pour le GeneXpert MTB/RIF que pour le Ziehl-Neelsen dans le groupe entier (15.9% vs 9.3%, p= 0.03) et chez les séropositifs pour le VIH (52.0% vs 24.0%; p = 0.007). Cependant, la sensibilité de GeneXpert MTB/RIF comparé au Ziehl-Neelsen n’était pas maximale (95.2%). Enfin, GeneXpert MTB/RIF a détecté 20.8% de résistance à la rifampicine. Conclusion La présente étude confirme la supériorité de GeneXpert MTB/RIF sur la coloration de Ziehl-Neelsen dans la détection de la tuberculose et dans la prédiction de la multi résistance. Son utilisation systématique couplée au Ziehl-Neelsen permettrait de mieux contrôler la tuberculose en Afrique subSaharienne. PMID:29187929

  19. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le droit civil en matière de mariage est la Loi spéciale sur le mariage, qui permet aux parties de différentes religions de se marier sans changer de religion. Elle exige le consentement explicite des deux partenaires pour que le mariage soit possible. Le consentement demeure le point central de la loi sur le mariage; ...

  20. Sur le chaos Lagrangien dans une cuve elliptique

    Science.gov (United States)

    Saatdjian, E.; Chassaing, M. I.; Midoux, N.; André, J. C.

    1995-02-01

    A viscous fluid is introduced into the annular space between two concentric, confocal ellipses. The inner and outer walls can be displaced along their circumference. A small quantity of fluorescent dye is introduced into the fluid and deformation and mixing are studied for the case of periodic boundary movement. An analytical solution in elliptical coordinates has been previously derived for creeping flow conditions. Poincaré sections for a given set of parameters indicate that counter-rotation leads to a more chaotic behaviour than co-rotation, this result is confirmed experimentally. This geometry can also be used as a heat exchanger. By a suitable choice of the parameters, the heat transfer for steady boundary motion can be increased by more than 50% with respect to the concentric cylinder system. If the inner and outer walls are displaced time-periodically, the heat transfer rate obtained can be more than double the rate obtained between concentric cylinders. Un fluide visqueux est introduit dans une cuve de géométrie elliptique, les parois interne et externe de cette cuve tournent suivant le périmètre de l'ellipse. Une petite quantité de traceur fluorescent est introduite dans le fluide et la déformation de l'élément marqué, lorsque le mouvement des deux parois est périodique, est étudiée. Pour cet écoulement où le nombre de Reynolds est très inférieur à 1 (régime de Stokes) et à partir d'une solution analytique récemmnent obtenue pour le cas stationnaire, des sections de Poincaré ont été tracées pour le cas d'une contra-rotation et d'une co-rotation. Les résultats expérimentaux montrent que, pour un protocole de mélange discontinu approprié, cette géométrie mène vers un mélange chaotique après un petit nombre de périodes. Par ailleurs, il est préférable de faire tourner les ellipses en contra-rotation. Ce résultat, en contradiction avec ceux déjà obtenus dans l'espace annulaire entre cylindres excentrés tournants, est

  1. Sur le genre Apoleon, Gorh

    NARCIS (Netherlands)

    Fairmaire, L.

    1887-01-01

    Dans les »Notes from the Leyden Museum”, vol. VII (1885) p. 51, Mr. Gorham a décrit sous le nom d’ ’Apoleon un nouveau genre de Bostrychide, créé pour un insecte de Malacca, rencontré aussi au Laos, à Bornéo et à Sumatra, A. edax. Ce genre est identique avec le genre Dysides Perty, dont le type, D.

  2. Un nouvel habitat du Bronze final IIIb dans le Val d’Orléans et ses traces de métallurgie du fer : Bonnée, Les Terres à l’Est du Bourg (Centre, Loiret A new settlement from late Bronze IIIb in the val d’Orléans: Bonnée, Les Terres à l’Est du Bourg (lands to the east of the town (Centre, Loiret

    Directory of Open Access Journals (Sweden)

    Stéphane Joly

    2011-12-01

    Full Text Available La multiplication récente des diagnostics archéologiques autour du petit bourg actuel de Bonnée a permis la détection d’une occupation du Bronze final IIIb (circa 900-750 av. n.-e. sur environ un hectare aux Terres à l’Est du Bourg. Les limites inhérentes à ce type d’intervention réduisent l’interprétation des structures et toute approche spatiale de ce probable habitat repéré. L’étude conjointe des différents mobiliers en particulier céramique et métallurgique, mais aussi le torchis et la faune, atteste de sa culture matérielle et de son intérêt. Ces scories pourraient être parmi les plus anciennes traces en région Centre d’activité métallurgique du fer. Des activités de post-réduction sont avérées et certaines opérations de forgeage sont supposées.La découverte de cet habitat dans ce secteur du lit majeur de la Loire, apporte de nouvelles données concernant l’occupation du sol et ses problématiques évolutives dans le Val d’Orléans sur ces périodes de transition avec le Hallstatt ancien.The recent increase in the archaeological evaluations around the village of Bonnée has enabled the discovery of a final Bronze Age IIIb settlement (circa 900-750 BP on about a hectare of the Terres à l’Est du Bourg. The limits inherent in this type of work restrict the interpretation of structures and all spatial approaches to this likely dwelling. The joint study of the different furnishings, in particular ceramics and metal, but also the cob and fauna, attests to its material culture and its interest. The slag could be amongst the oldest iron metallurgy remains from the Centre region. Some activities of post-forging are proven and certain operations are guessed at. The discovery of this settlement in this sector of the major bed of the Loire, has produced new data concerning the occupation of the land and its evolutionary problems in the valley of Orleans over these periods of transition in the early

  3. Un oiseau "sabote" le CERN

    CERN Multimedia

    Colson, Sébastien

    2009-01-01

    Un oiseau, un simple oiseau, est parvenu à bloquer à lui tout seul l'accélérateur à particules à 3,7 milliards d'euros. UNe histoire quasiment bulresque qui a toutefois impacté le fonctionnement de la machine durant près de cinq jours, puisque c'est le système de refroidissement qui a été affecté. (1 page)

  4. Rock Permeability and Fluid Pressure At the Ktb. Implications from Laboratory-And Drill Hole-Measurements Perméabilité des roches et pression dans le KTB : enseignements tirés des mesures de laboratoire et des mesures en puits

    Directory of Open Access Journals (Sweden)

    Zimmermann G.

    2006-12-01

    Full Text Available Rock permeability and the fluid pressure were investigated at different scales at the two drill holes of the Continental Deep Drilling Program (KTB. Drill hole tests and fluid inclusion investigations both implicate the existence of hydrostatic fluid pressure in situ with respect to salinity of the formation fluid. Matrix permeability and in situ values from hydraulic tests differ up to three decades with higher values in situ. Further on, the pressure dependence of core permeability and in situ determined values differ significantly. All these observed effects support the well known theory of scale variance. This conclusion is supported by observations of hydraulic communications between both drill holes. These scale effects implicate a pronounced hydraulic heterogeneity of the KTB surroundings. Therefore, stochastic network modelling with parameters derived from structural borehole measurements and under the consideration of the observed permeabilities were performed. Under the presumption of existing driving forces fluid transport takes place dominantly on discrete connected pathways characterised by fracture width, fracture length and fracture orientation and is subordinate in the rock matrix. La perméabilité des roches et la pression des fluides ont été étudiées à différentes échelles sur les deux forages du Programme continental de forage profond - Continental Deep Drilling Program (KTB. Les essais de puits et les recherches d'inclusions de fluides impliquent l'existence d'une pression de fluide fonction de la salinité du fluide de formation. Les valeurs déduites des essais de puits dépassent largement les perméabilités matricielles, l'écart allant jusqu'à trois ordres de grandeur. De plus, l'évolution de la perméabilité mesurée sur échantillon en fonction de la pression et celle déterminée in situ diffèrent largement. Ces observations renforcent la théorie bien connue des effets d'échelle. Cette conclusion est

  5. Le stockage inertiel

    OpenAIRE

    KAUV, J; BONAL, J

    2010-01-01

    La fourniture d'une énergie propre et abondante à une population mondiale largement appelée à croître va être un défi considérable pour le XXIe siècle. Aujourd'hui nous dépendons encore considérablement des énergies fossiles, certes très énergétiques et d'utilisation commode, mais épuisables et productrices de CO2 responsable du réchauffement climatique. Le stockage d'énergie électrique et de chaleur est un domaine technique difficile et délicat, mais dont le développement est indispensable p...

  6. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Office 2004 Test Drive User

    31 déc. 2016 ... Lʼinformation et les divulgations contenues dans le Rapport annuel 2015-2016 sʼappliquent au trimestre sur lequel porte le présent rapport trimestriel, sauf indication contraire. Budget 2016-2017 révisé. Le Conseil des gouverneurs a approuvé le budget 2016-2017 avant le début de lʼexercice. Cʼest.

  7. Le LHC, priorité absolue

    CERN Multimedia

    Huet, S

    2002-01-01

    Le LHC, sa mise en est repoussee a 2007 quand les physiciens esperaient 2006. Le CERN a sous-estime les couts, environ 11% pour les 1 200 aimants supraconducteurs. Les Etats membres n'augmenteront pas leurs subventions, il propose donc cette semaine un plan drastique : tout pour le LHC (1/2 page).

  8. A New Model to Calculate Three-Phase Relative Permeabilities: Application and Validation for a Sandstone Un nouveau modèle pour le calcul des perméabilités relatives en écoulement triphasique : application et validation dans le cas d'un grès

    Directory of Open Access Journals (Sweden)

    Moulu J. C.

    2006-12-01

    Full Text Available Three-phase flow in a porous medium is usually described by the Stone model (1970. This model is based on two-phase data and relies on empirical correlations. It is valid only under strong water wettability and recognized as being a poor predictor. The goal of the present study is to develop a mathematical model for three-phase flow avoiding any empirical correlations. In this paper, only strong water-wet and spreading conditions are considered. However the model could be relatively easily extended to oil-wet or even mixed-wet conditions. The model is based on a physically relevant description of phase distribution and flow mechanisms at the pore scale. The porous medium is described as a set of fractal pores, whose linear fractal dimension and size distributions are derived from a mercury intrusion capillary pressure curve. The fluids are allowed to flow together in the same fractal pore, gas in the center, water near the walls and oil in an intermediate phase. The relative permeabilities are evaluated by calculating the flow of each fluid applying Poiseuille's law. The model results are compared to relative permeabilities obtained by history matching of gas injection experiments. The same experiments are also simulated using Stone's model and laboratory measured two-phase data. Les écoulements triphasiques en milieu poreux sont généralement décrits par le modèle de Stone (1970. Ce modèle est basé sur des corrélations empiriques appliquées à des résultats d'écoulements diphasiques. Il n'est valable que dans le cas de mouillabilité franche à l'eau et ne peut pas être utilisé comme outil de prédiction. L'objectif de la présente étude est de développer un modèle mathématique d'écoulement triphasique en évitant toute corrélation empirique. Dans cet article, les conditions de mouillabilité franche à l'eau et d'étalement sont seules étudiées, mais le modèle pourrait être aisément étendu aux cas de mouillabilité à l

  9. Peut-on voyager dans le temps ?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    La possibilité de voyager dans le temps est régulièrement évoquée par les magazines scientifiques (et parfois même par les scientifiques). Elle est également le sujet de nombreux romans de science-fiction. Nous discuterons d’abord du sens qu’on peut donner à l’expression « voyager dans le temps », puis nous expliciterons ce que la physique contemporaine dit à ce propos.

  10. Le profil entrepreneurial : Facteur discriminant du developpement ...

    African Journals Online (AJOL)

    Le développement économique est un objectif majeur pour tout pays. Selon le classement établi par le Forum économique mondial, le développement économique dépend du niveau du PIB per capita et de la part des exportations des biens minéraux dans l'exportation totale. A partir de la base de données GEM Algérie, ...

  11. Le beau et le vrai

    Directory of Open Access Journals (Sweden)

    Létitia Mouze

    2006-05-01

    Full Text Available La vie des abeilles de Maeterlinck est un ouvrage à la fois scientifique et littéraire, non pas parce qu’il appartiendrait à la science par son exactitude et à la littérature par son style, mais en ce qu’il invite à penser l’unité des deux domaines. Les aspects littéraires de l’ouvrage (beauté de l’écriture, usage des images, de l’analogie, etc. ne sont pas des accessoires, mais des outils indispensables à l’élaboration d’un authentique savoir sur les abeilles, c’est-à-dire un savoir qui reconnaît la part d’inconnu et le mystère qui subsistent en dépit de toutes les explications physiques et mécaniques que l’on peut par ailleurs donner des phénomènes observés. Etre scientifique, dans cette perspective, c’est-à-dire donner à connaître, c’est donc être littéraire. Cette conception de la science repose en dernière instance sur une conception philosophique de l’univers comme un tout où toutes choses sont reliées, unies, par des relations d’analogies, ce qui fonde et justifie l’emploi d’un style symboliste.The life of bees, one of Maeterlinck’s works, is together a scientific and literary book, not because of it scientific exactness and its literary style, but for the reason it suggests the unity of both these domains. Literay’s aspects of this work (writing’s beauty, use of images, analogy, etc. are not secondary but necessary to elaborate an authentic knowledge about bees, that means a knowledge which admit the unknown part and the mistery that subsist despite all the physical and mechanical explanations we can give moreover about the observed phenomenons. Be a scientist, in this sense, that is give something to know, therefore means be literary. Finally, this conception of science consist in a philosophiacl conception of Universe as a whole where everything links together, and is united by analogical relations, that base and justify the use of a symbolist style.

  12. Comparaison n'est pas raison…

    Directory of Open Access Journals (Sweden)

    Yves Guermond

    2004-11-01

    Full Text Available Dans le contexte très politisé de la question palestinienne il est difficile de séparer l’analyse scientifique des réactions passionnelles, et l’utilisation de l’apartheid comme repoussoir peut donner l’impression de dédouaner le gouvernement israélien. C’est d’ailleurs un peu semble-t-il l’intention de Frédéric Giraut quand il écrit que « l’usage radical et systématique de l’analogie vise à condamner l’Etat d’Israël et le sionisme dans leur nature même ». « Cette approche infondée » serait ,...

  13. Tabagisme et dysfonction erectile chez les personnes vivant avec le ...

    African Journals Online (AJOL)

    La dysfonction erectile (DE) est un probleme de sante publique qui altere la qualite de vie des patients. Chez les personnes infectees par le VIH, le tabagisme en association ii d'autres facteurs pourrait accroitre le risque de survenue de ce trouble. L'objectif de cette etude est de determiner la prevalence de laDE, les ...

  14. Initiative Think tank | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ITT est le fruit d'un partenariat regroupant cinq bailleurs de fonds. Lancée en 2008, l'ITT est administrée par le Centre de Recherches pour le Développement International (CRDI), un organisme canadien.

  15. Le faussaire roman

    CERN Document Server

    D'Anna, Gianfranco

    2016-01-01

    À l'aube du XXIe siècle, le monde de la science est sur le point de vivre une révolution. Le jeune physicien allemand Albert Hendrick Thebell, des célèbres laboratoires de recherche B-Labs, à Summit, dans le New Jersey, publie, dans les plus grandes revues scientifiques internationales, une série d'articles dans lesquels il prétend avoir obtenu des résultats extraordinaires qui pourraient révolutionner les bases mêmes de la technologie. Rapidement, la communauté scientifique puis les médias saluent en lui un futur prix Nobel; on compare même son génie à celui d'Albert Einstein. Le progrès scientifique semble avoir franchi une étape décisive, susceptible d'amener un futur meilleur. Mais ces découvertes sont-elles authentiques ? Car pendant ce temps, dans les mêmeslaboratoires, des voix s'élèvent pour contester non seulement les théories de Thebell mais aussi la légitimité même de ses expériences ; certains le soupçonnent d'avoir combiné la plus grande fraude scientifique de tous l...

  16. Le surpoids, l'obésité et le contrôle glycémique chez les diabétiques ...

    African Journals Online (AJOL)

    utilisation et du stockage des sucres apportés par l'alimentation, sa prise en charge est assurée par le suivi du surpoids et l'obésité et le contrôle glycémique régulier. L'objectif de ce travail était l'étude du surpoids, l'obésité et le contrôle glycémique ...

  17. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  18. Le métalangage comme procédé discursif structurant du récit dans Allah n’est pas obligé d’Ahmadou Kourouma

    Directory of Open Access Journals (Sweden)

    Yayo Vincent DANHO

    2014-07-01

    Full Text Available The refusal to admit the formalistic principle of the closing of the meaning in Allah n’est pas obligé is tangible evidence of the authority of the metalanguage in this narrative. This study shows how the language used to refer to itself, is part of a speech in the second degree. To do this, this analysis seeks to show that the narrative in metalinguistic discourse is made possible by the interrogative system and reformulation in indirect speech. The narrative, based on equational formula A = A ', hints at the reflexive dimension of novel writing and translation operation that is performed there. This form of translatology, which is not without influence on the story, reveals two types of augmentation: extension and expansion, which are at the origin of the African genrologique reactivation of new type.

  19. Le vieillard et le chevalier

    Directory of Open Access Journals (Sweden)

    Mélanie JECKER

    2010-05-01

    Full Text Available La fin du Moyen Âge fascine. Deux facteurs principaux expliquent l’attraction qu’exerce cette période : elle apparaît d’une part comme un moment historique riche car double, phase de transition entre le Moyen Âge et la Renaissance, où se mêlent des cadres de représentation anciens et nouveaux. L’insinuation d’une pensée humaniste balbutiante s’y traduirait notamment par l’émergence de la notion d’individu, qui constitue l’un des objets de ce travail. Il faut invoquer, d’autre part, l’image macabre d’un bas Moyen Âge hanté par l’idée de la maladie et de la mort depuis l’épidémie de peste noire de 1348, obsédé par la brièveté de la vie humaine. Ces deux facettes de « l’automne du Moyen Âge » tel que l’évoque avec poésie Joan Huizinga sont-elles autre chose qu’une plaisante image d’Epinal? Cette étude cherche précisément à déterminer le degré de validité de ces deux topiques, à travers l’analyse de la représentation des âges de la vie dans un corpus bien défini, celui de la biographie chevaleresque castillane du XVe siècle. L’intérêt porté à l’individu, la conscience de la singularité impliquent en effet celle du caractère mouvant de la personne, or quel thème mieux que celui des âges permet de confirmer ou d’infirmer l’hypothèse du surgissement d’une nouvelle manière de concevoir l’homme, proprement « renaissante », en ce siècle de transition , La nature même du corpus retenu – des récits biographiques – suggère en effet une mutation dans l’appréhension de la personne, une attention prêtée à sa progressive transformation. L’étude de la représentation de la vieillesse, en particulier, révèle non seulement à quel point était alors réelle cette prétendue obsession de la déchéance physique et de la mortalité, mais aussi dans quelle mesure étaient soulignés et valorisés les changements individuels parallèles à l

  20. Le monde quantique

    CERN Document Server

    Aspect, A; Bensaude-Vincent, B; Castiel, A; Chevalley, C; Darrigol, O; Deligeorges, S; D'Espagnat, B; Laloë, F; Lévy-Leblond, J-M; Messiah, A; Paty, M; Vuillemin, J; Wheaton, B R

    1984-01-01

    Le monde quantique La physique quantique, après trois quarts de siècle, n'en finit pas d'être moderne. Elle est présente quotidiennement dans les laboratoires où les physiciens étudient atomes, noyaux et particules. Elle est entrée dans l'industrie où lasers, transistors et supraconducteurs lui doivent d'exister. Et elle continue à alimenter le débat philosophique sur la nature de la réalité dont elle montre la non-séparabilité fondamentale. Ses concepts de base, son développement, ses applications, ses controverses sont ici présentés par une pléiade de physiciens, d'historiens et de philosophes.

  1. Les subsidences provoquées par la production des fluides souterrains Subsidence Induced by the Production of Fluids

    Directory of Open Access Journals (Sweden)

    Bouteca M.

    2006-11-01

    Full Text Available Cet article est consacré à l'étude de l'affaissement de la surface du sol provoqué par la production de fluides (eau, hydrocarbures. On présente d'abord les méthodes disponibles pour mesurer cette subsidence, qui atteignent aujourd'hui une grande précision. A partir des cas répertoriés dans la littérature, on met en évidence les mécanismes qui sont à l'origine de la subsidence : compaction du réservoir et compaction des aquitards en relation avec la déplétion, mécanismes liés à l'injection de fluides dans certains cas particuliers (fluage thermique, action de l'eau sur la craie. Ces mécanismes doivent être pris en compte par des modèles progressivement enrichis par la description géologique, pétrophysique et mécanique confrontée aux mesures en place. Le contrôle de la subsidence repose sur le contrôle de la pression en place, maintenue par un fluide compatible avec la formation. Si ce contrôle est mis en oeuvre assez tôt le risque de subsidence est pratiquement nul. This article is devoted to the investigation of soil surface subsidence caused by the production of fluids (water, oil and gas. It first describes the methods available for measuring this subsidence, methods that have become extremely accurate today. Cases are selected from the literature to identify the mechanisms causing subsidence: reservoir and aquifer compaction associated with depletion, mechanisms connected with fluid injections in specific cases (thermal creep, action of water on chalk. These mechanisms must be taken into account by models progressively enriched with geological, petrophysical and mechanical descriptions, substantiated by in situ measurements. Subsidence control demands the control of the in situ pressure, maintained by a fluid compatible with the formation. If this control is applied early enough, the risk of subsidence is virtually nil.

  2. Lecture actentielle dans Trop c'est trop de Protais Asseng | IKANGA ...

    African Journals Online (AJOL)

    La naissance de cet enfant lui conférait le titre de "Papa national" Bakony symbolise la recherche de bonheur sur le dos d'un humain. C'est de l'exploitation de la femme par l'homme. Mais la multipare Bissabey, son épouse, n'est pas de son avis. Cette instrumentalisation est alors la pomme de discorde entre le couple et ...

  3. Travailler le vison

    OpenAIRE

    Gorre, Jean-François

    2007-01-01

    Dans notre société, la fourrure est porteuse de valeurs symboliques. D'autres travaux ont montré comment elle est l'expression du jeu entre nature et culture : investissement de la force de l'animal, expression du sauvage, marque de la domestication de la nature (Delort 1973, Pouchelle 1981). Notre propos sera différent. Nous étudierons dans le cadre du métier de fourreur, à travers une technique particulière, l'« allonge », la teneur de l'affrontement entre deux groupes socio-professionnels....

  4. La Turquie face à la globalisation. Convergence d’intérêts entre les acteurs religieux particularistes : le cas du sud-est européen dans les années 1990 Turkey and Globalisation. Convergence of Interests between Particularists Religious Actors. The South-East Europe during the ’90s

    Directory of Open Access Journals (Sweden)

    Nikolaos Raptopoulos

    2011-03-01

    Full Text Available La globalisation, en favorisant l’interaction des idées et des hommes, est de ces facteurs qui sont capables de mettre en cause des systèmes sociopolitiques rigi­des. Cette contribution s’intéresse plus précisément au cas de figure du système kémaliste turc. L’islam turc, composante incontestée de l’identité nationale, est de plus en plus impliqué dans le système sociopolitique contemporain en tant qu’idéologie globalisante promue par certains acteurs. Cette situation, prévisi­ble pour la scène interne, se confirme aussi dans l’action et l’interaction des protagonistes au niveau international. En Turquie, l’islam, religion monothéiste, est devenu un véhicule d’interaction : d’une part entre l’État (laïc et nationa­liste et les acteurs sociaux islamiques ; d’autre part, entre ces mêmes acteurs et les communautés turques et musulmanes des régions de l’aire ottomane, no­tamment du sud-est de l’Europe.By fostering interaction globalization can question socio-political rigidity. This was the case with kemalist Turkey. Part and parcel of national identity, Turkish Islam is increasingly involved in the socio-political set up in the form of a global ideology. Recognizable locally, this process also carries international weight. Monotheistic Islam has acted in Turkey as a go-between : between the nationalistic, lay State and Islamic actors, between these latter and Islamic elements in regions of the former ottoman empire, notably in south-eastern Europe

  5. Le dernier Wittgenstein et le dernier Husserl sur le langage

    Directory of Open Access Journals (Sweden)

    Paul Ricoeur

    2014-07-01

    Full Text Available This article presents an edited version of lectures given by Paul Ricœur at Johns Hopkins University in April 1966. Ricœur offers a comparative analysis of Wittgenstein’s and Husserl’s late works, taking the problem of language as the common ground of investigation for these two central figures of phenomenology and analytic philosophy. Ricœur develops his study in two parts. The first part considers Husserl’s approach to language after the Logical Investigations and concentrates on Formal and Transcendental Logic; leaving a transcendental reflection on language behind it re-examines a phenomenological conception, according to which the sphere of logic is not separable from that of experience. The main focus of the second part is Wittgenstein’s later philosophy as it moved on from the conception of an isomorphic relation between language and the world, as set out in the picture theory in the Tractatus Logico-Philosophicus, to the more pragmatic notion of a language-game in the Philosophical Investigations. In order to get beyond the irrevocable differences between the two philosophies and the unresolved theoretical issues on both sides, Ricœur suggests turning to a semiological paradigm based on the Saussurean distinction between “language” and “speaking.” Keyword: Analytic Philosophy, Husserl, Phenomenology, Semiology, Wittgenstein.  Résumé Cet article est une version éditée de conférences données par Paul Ricœur à la Johns Hopkins University en avril 1966. Ricœur propose une analyse comparée des dernières œuvres de Wittgenstein et Husserl, avec le problème du langage comme sol commun d’investigations pour ces deux figures centrales de la phénoménologie et la philosophie analytique. Cette analyse de Ricœur se joue à travers deux parties. La première partie revient sur l'approche du langage chez Husserl depuis Recherches logiques avec une attention particulière aux développements de Logique formelle et

  6. Le modèle basque

    Directory of Open Access Journals (Sweden)

    Juan-Angel PORTUGAL

    1986-12-01

    Full Text Available À l'intérieur du quadrilatère basque se dessine un sous-espace triangulaire dont les sommets sont les capitales provinciales; les côtés délimitent une aire prospère. La localisation de ces trois noyaux résulte d'une décision politico-économique et d'une diffusion de l'industrialisation. Ce triangle est un espace dynamique et attractif, autant dans le domaine de la démographie que du développement économique et industriel.

  7. “La vida está fuera del tiempo”. León Tolstói entre la práctica vital y la predicación moral

    Directory of Open Access Journals (Sweden)

    Rabe, Ana María

    2010-10-01

    Full Text Available At the turn of the 20th century, Leo Tolstoy was considered an important ethical figure in Russia as well as in other cultural spheres. He was idolized as a moral example who preached life and work in the countryside in harmony with nature, charity, simplicity and denial of property; values that the aristocratic writer seemed to realize himself. At the same time, the public and ecclesiastic authorities of Russia feared the big influence emanating from the severe criticism and denunciations by which Tolstoy unveiled injustice, violence and hypocrisy of the Russian institutions. As the article shows, Tolstoyan ideas about love thas is realized here and now, denial of any recompense, nonviolent resistance, decease as a decline in everyday life and vital practice that is integrated in present played an important role in the intellectual circles of that time, e. g. in Bunin, Gorki, Heidegger, Gandhi, Nietzsche or Lukács. Tolstoy’s conception of life as pure present, as being “beyond” time and thus gaining felicity and eternity –an idea suggested by Saint Augustine–, impressed especially the young Wittgenstein. The article presents these ethical, religious and existential ideas as they appear in the Tolstoyan religio-theoretical writings and narrations while showing at the same time the contrary positions of Tolstoy’s thought and character on which they are built.

    A finales del XIX y principios del XX León Tolstói fue considerado un importante modelo ético dentro y fuera de Rusia. La gente del pueblo lo veneraba como ejemplo moral que predicaba la vida y el trabajo en el campo en concordancia con la naturaleza, el amor al prójimo, la sencillez y renuncia a la propiedad, valores que el escritor aristócrata parecía llevar él mismo a la práctica. A la vez, las autoridades estatales y eclesiásticas de Rusia temían la gran influencia que ejercían las severas críticas y acusaciones con las que el famoso novelista y

  8. Le Projet d’Ole Lando sur les Contrats

    DEFF Research Database (Denmark)

    Holle, Marie-Louise

    2017-01-01

    En 2016 le projet de recherche le plus important jusqu’à présent sur le droit nordique des contrats a pris fin et un livre, de presque 400 pages, en a marqué l’aboutissement. Le résultat du projet est un « restatement » tel qu’il existe aux États-Unis. Le Restatement porte sur les règles et les...

  9. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  10. Le LHC, un tunnel cosmique

    CERN Document Server

    CERN. Geneva

    2009-01-01

    Et si la lumière au bout du tunnel du LHC était cosmique ? En d’autres termes, qu’est-ce que le LHC peut nous apporter dans la connaissance de l’Univers ? Car la montée en énergie des accélérateurs de particules nous permet de mieux appréhender l’univers primordial, chaud et dense. Mais dans quel sens dit-on que le LHC reproduit des conditions proches du Big bang ? Quelles informations nous apporte-t-il sur le contenu de l’Univers ? La matière noire est-elle détectable au LHC ? L’énergie noire ? Pourquoi l’antimatière accumulée au CERN est-elle si rare dans l’Univers ? Et si le CERN a bâti sa réputation sur l’exploration des forces faibles et fortes qui opèrent au sein des atomes et de leurs noyaux, est-ce que le LHC peut nous apporter des informations sur la force gravitationnelle qui gouverne l’évolution cosmique ? Depuis une trentaine d’années, notre compréhension de l’univers dans ses plus grandes dimensions et l’appréhension de son comportement aux plus peti...

  11. Le livre sur le livre traité de documentation

    CERN Document Server

    Otlet, Paul

    2015-01-01

    Paul Otlet est considéré comme le père des sciences de l'information. Ouvrage fondateur et fondamental, le Traité de documentation. Le livre sur le livre (1934) est l'aboutissement de son travail inlassable pour rassembler, classer et partager les connaissances. Otlet y propose une remarquable synthèse du savoir sur le livre et le document en même temps qu'il anticipe Internet et l'hypertexte. La réédition du Traité de documentation, 70 ans après la disparition de son auteur, coïncide avec la réouverture du Mundaneum à Mons, où le fabuleux héritage documentaire légué par Paul Otlet et Henri La Fontaine est conservé. « Ici, la table de travail n'est plus chargée d'aucun livre. À leur place se dresse un écran et à portée un téléphone. Là-bas, au loin, dans un édifice immense, sont tous les livres et tous les renseignements. De là, on fait apparaître sur l'écran la page à lire pour connaître la réponse aux questions posées par téléphone. » Préfaces de Benoît Peeters (éc...

  12. LE SECTEUR INFORMEL EN ALGERIE : APPROCHES, ACTEURS ...

    African Journals Online (AJOL)

    du respect des lois et des règlements et de l'Etat de droit de façon générale. 1.4. L'approche du secteur informel selon le Bureau International du Travail (BIT) ... qui ne tiennent pas une comptabilité complète et dont la person- l'importation…) mais également dans le secteur immobilier dont le fonctionnement est informel.

  13. Oser le corps

    Directory of Open Access Journals (Sweden)

    Alex Cormanski

    2015-05-01

    Full Text Available Le corps est la voie primordiale dans le processus d’énonciation, mais reste encore (trop souvent corps étranger dans le processus d’enseignement/apprentissage des langues étrangères. Or entrer dans une langue étrangère, se l’approprier physiquement, sonner juste dans une autre langue, précisément pour qu’elle ne soit plus étrangère, implique un travail sur le corps, peut impliquer un transfert de corporéité. Oser les pratiques de corps dans la classe de langue : voie incontournable pour éviter les voix dissonantes. Dare the body voice Abstract: Focusing and working on the body is inescapable in the process of enunciation, but unfortunately not sufficiently put into practice in language learning. Speaking a foreign language, being attuned in that target language, i.e. to sound as close as possible to a native speaker, implies to work on the body physically as well as mentally, which means dealing with representation because of the transfer of identity the user may experience. Dare the body voice for a body change when switching from a language to another is a necessary direction the teacher ought to lead the learners to work on.

  14. Transparence | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La transparence est un élément clé de l'engagement du gouvernement du Canada envers le gouvernement ouvert, dont l'objectif est d'améliorer l'accès aux données, aux renseignements et aux échanges. Le CRDI s'emploie à la transparence en fournissant des renseignements sur son site Web, dans ses publications, ...

  15. Le modèle spatial de la capitale allemande

    Directory of Open Access Journals (Sweden)

    Antoine Laporte

    2013-06-01

    Full Text Available En Allemagne, en 1999, le Chancelier fédéral et son gouvernement ont quitté Bonn pour Berlin. Ce transfert du pouvoir est accompagné de celui d’une grande partie de l’appareil d’État et de la haute administration, et des fonctions qui leur sont traditionnellement attribuées comme la presse, les lobbys ou encore la diplomatie. Le déplacement du statut de capitale effective de l’Allemagne de Bonn à Berlin est le résultat des évolutions géopolitiques d’un pays ayant recouvré son unité et sa pleine et entière souveraineté. Installer le pouvoir exécutif et législatif à Berlin était une démarche hautement symbolique, visant à normaliser la position de l’ancienne capitale de la RDA et du IIIe Reich comme véritable centre politique de l’Allemagne. Or le déplacement des institutions fédérales n’est pas qu’un acte symbolique. Il entraîne également à l’échelle intra-urbaine des dynamiques très concrètes sur le tissu urbain et participe à la mise en place de nouvelles centralités dans la ville. En effet, le statut de capitale d’État prédestine l’agglomération à la coprésence de nombreuses fonctions urbaines spécifiques plus ou moins directement liées à l’exercice ou à la symbolique du pouvoir.

  16. EST-SSRs

    African Journals Online (AJOL)

    user1

    2012-09-04

    Sep 4, 2012 ... sequence repeats (EST-SSRs) for Musa and their applicability in authentication of a Musa ... understanding of Musa genetics, in marker-trait associations, thereby enhancing the effectiveness of breeding programs. Key words: EST ...... antioxidant, in cavendish banana. J. Agric. Food Chem. 48(3):844-. 848.

  17. Le contrôle de gestion environnementale d'une entreprise

    OpenAIRE

    Marquet-Pondeville, Sophie

    2001-01-01

    Dans cette recherche, nous étudions comment s’opère le contrôle de gestion environnementale. Cette problématique est abordée dans une perspective contingente et nous proposons un modèle théorique qui met en évidence l’impact de certaines variables sur les systèmes de contrôle de la gestion environnementale. Certains liens présents dans ce modèle sont discutés à travers une étude de cas.

  18. Sur le chemin de Buchenwald

    OpenAIRE

    Bessière, Bernard

    2017-01-01

    En 1963, âgé de 37 ans, l’activiste communiste Jorge Semprún publie en français le roman Le Grand Voyage dans lequel il raconte le périple de 800 km qui l’avait conduit en train de Compiègne jusqu’à Buchenwald en septembre 1943. Il avait alors 19 ans. C’est dans ce camp de la mort situé près de Weimar – cité de Goethe, que Semprún admirait – qu’il sera interné jusqu’à sa libération par les troupes américaines en avril  1945. Pendant les quatre jours et cinq nuits de ce « grand voyage », le dé...

  19. Sexospécificités | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le développement des pays les plus pauvres. – fiche d'information « Qu'est-ce que le paludisme ? » de l'OMS.

  20. Publications | Page 227 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... au Togo" (open access). Le projet Savoirs locaux et gestion de la biodiversité : Habitudes alimentaires et utilisation des plantes alimentaires mineures ou menacées de disparition au Togo est financé par le Centre de Recherche et de Développement International (CRDI) et exécuté par le Laboratoire de Botanique et.

  1. Publications | Page 33 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la recherche en ...

  2. Publications | Page 34 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la recherche en ...

  3. Eau, terre et vie : Communication participative pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 févr. 2007 ... Eau, terre et vie : Communication participative pour le développement et gestion des ressources naturelles ... Le CRDI investit dans des solutions locales aux problèmes auxquels l'Inde est confrontée, comme le stress thermique, la gestion de l'eau et les migrations liées aux changements climatiques.

  4. Recherche | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion des risques climatiques pour la planification de l'agriculture ... La province du Cap-Occidental est le secteur le plus rentable sur le plan de l' agriculture en Afrique du Sud et contribue de manière importante à la balance des .

  5. José Antonio Ocampo : l'inclusion sociale et économique est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    14 oct. 2015 ... Le développement rural est essentiel à la paix en Colombie, compte tenu du fait que le conflit qui perdure est principalement à caractère rural, a déclaré l'éminent économiste du développement, José Antonio Ocampo, lors d'une allocution qui a attiré un grand nombre de personnes, à Ottawa, le 25 ...

  6. Profil lipidique des personnes vivant avec le VIH sous antirétroviral ...

    African Journals Online (AJOL)

    Au regard des connaissances actuelles, aucune étude n'est disponible au Bénin sur le profil lipidique des personnes vivant avec le VIH. L'objectif de la présente étude est de décrire le profil lipidique des personnes vivant avec le VIH sous antirétroviral suivies au CHU-O/P de Porto-Novo. Il s'est agi d'une étude ...

  7. Kenya | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Kenya est depuis longtemps le centre économique de l'Afrique de l'Est. Cependant, malgré des progrès économiques considérables au cours de la dernière décennie, la pauvreté et des inégalités persistent. Le bureau du CRDI à Nairobi est le point central des efforts du Centre en Afrique subsaharienne et il supervise ...

  8. Le vase de Pandore

    Directory of Open Access Journals (Sweden)

    Nicola Panichi

    2000-06-01

    Full Text Available Il s’agit ici de suivre les stratégies discursives par lesquelles Érasme situe sa Lingua sous le patronage symbolique de deux mythes des plus opératoires à la Renaissance : le vase de Pandore et la tour de Babel, tous deux verrouillant le texte, l’un en guise d’incipit, l’autre d’explicit, dans un dialogue où chacun use de l’autre pour renforcer les significations et instaurer le régime sémantique du texte, tant linguistique qu’éthique. Ce sont ces jeux complexes entre différents niveaux de discours dont dépend le sens ultime de l’œuvre que cet article s’attache à saisir.Se trata de seguir aquí las estrategias discursivas mediante las cuales Erasmo sitúa su Lingua bajo el dominio simbólico de dos de los mitos más funcionales del Renacimiento: el vaso de Pandora y la torre de Babel, los cuales limitan el texto, uno a modo de íncipit, otro de excipit, en un diálogo en el que se valen el uno del otro para reforzar los significados y establecer el régimen semántico del texto, tanto lingüístico como ético. Son esos juegos complejos entre diferentes niveles de discurso, de los que depende el sentido último de la obra, que este artículo intenta captar.

  9. Le réseau GEOHealth d'Afrique orientale pour la prévention des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est mis en oeuvre dans le cadre de l'initiative Global Environmental and Occupational Health, sous la direction du Fogarty International Center des National Institutes for Health des États-Unis, en collaboration avec le Centre de recherches pour le développement international. Le volet de recherche générale est ...

  10. Prévalence du tabagisme chez le personnel de l'Hôpital Général de ...

    African Journals Online (AJOL)

    Les personnes pensent que c'est leur devoir de questionner sur le tabac et de prendre en charge les fumeurs, mais ils sont presque un sur deux à ignorer la loi Camerounaise. Conclusion: Le tabagisme chez le personnel hospitalier est une réalité au Cameroun ; le personnel soignant et les pouvoirs publics devraient ...

  11. 3. Le moraliste, le sociologue et le juge : objectivation et production de la connaissance

    OpenAIRE

    Noreau, Pierre

    2018-01-01

    Commedia del diritto Œuvre spécialement réalisée pour cet ouvrage par Maya Pankalla Le rapport qu’entretiennent les sciences sociales et le monde des valeurs est traversé par l’ambiguïté. Ce que nous pourrions appeler ici l’« engagement sociologique » de Guy Rocher témoigne de cette tension continue ; il exemplifie les relations complexes qui lient le mouvement de la pensée au monde de l’action. Comme il le rappelle lui-même dans ses entretiens avec Georges Khal, à la fin d’u...

  12. L’Association du personnel, le TREF, le Comité des Finances et le Conseil du CERN

    CERN Multimedia

    Staff Association

    2016-01-01

    L’Association du personnel, forte de son approche participative et consensuelle, recherche toujours le meilleur accord possible pour l’Organisation et son personnel. Pour ce faire, discussions et concertation avec la Direction, travail d’explication et de persuasion au TREF et ailleurs auprès des délégués des États membres sont nos principaux atouts. TREF (Tripartite Employment Conditions Forum), un Forum d’échanges, de discussions « L’objectif du Forum est d’améliorer le processus de prise de décision  en donnant aux personnes concernées la possibilité et le temps de comprendre pleinement la position de tous les participants. » (CERN/RTG/8) Le Forum tripartite sur les conditions d’emploi (TREF), créé par le Conseil du CERN en juin 1994, est composé de r...

  13. Good Morning Babilonia … le patrimoine « immatériel » des universités est-il un acte manqué ? Brèves réflexions sur le cas de l’Université libre de Bruxelles

    Directory of Open Access Journals (Sweden)

    Didier Devriese

    2012-03-01

    Full Text Available La situation institutionnelle de l’Université libre de Bruxelles, comme de la plupart des Universités belges, suppose la possession en propre d’un patrimoine et une autonomie de gestion complète en la matière. Cette situation appelle indubitablement de nombreuses questions. Il s’agit notamment de s’interroger sur la conscience de l’existence de ce patrimoine chez les membres de la communauté, sur son existence – ou non - comme élément de construction de l’identité collective de l’Université et sur une valorisation ad hoc, tant vis-à-vis des membres de la communauté universitaire qu’à l’extérieur de celle-ci. Par-delà le contexte institutionnel, légal et réglementaire, on évoquera ici quelques étapes de l’histoire des unités patrimoniales (Archives, musées, Réserve précieuse … et on s’interrogera sur les intentions qui président à la constitution d’un patrimoine raisonné.As an institution, the Free Brussels University, like any other Belgian University, has its own cultural patrimony and has the right to manage it by itself. This obviously gives rise to a number of questions. What is the awareness of this patrimony among University members? How does it help establishing a collective identity? How can it be used and promoted inside and outside the University? Beyond the legal, institutional and regulatory contexts, here will be brought up a few steps in the History of patrimonial units (Archives, museums, Réserve précieuse…, as well as a reflection about the purpose behind the establishment of a reasoned patrimony.

  14. Le marketing : quelle contribution au bien commun ?

    OpenAIRE

    Béji-Bécheur, Amina

    2015-01-01

    National audience; Partons d'un constat : le marketing est né pour servir l'entreprise capitaliste et le développement de ses marchés. Le but ultime étant la création de richesses et par ricochet le bien-être des populations. Un ensemble d'outils marketing ont été créés pour accompagner les enjeux de performance économique des entreprises. Reprenant les travaux de Jean-Claude Moisdon (Du mode d'existence des outils de gestion, les instruments de gestion à l'épreuve de l'organisation 1), ces o...

  15. Pompe de chaleur fonctionnant avec un mélange de fluides Heat Pump Operating with a Fluid Mixture

    Directory of Open Access Journals (Sweden)

    Vidal J.

    2006-11-01

    Full Text Available Lorsqu'une pompe de chaleur échange de la chaleur avec des fluides extérieurs, dont la température évolue au cours de l'échange, il est possible d'augmenter le coefficient de performance en utilisant comme fluide de travail un mélange non-azéotropique qui se vaporise et se condense suivant une évolution de température parallèle à celle du fluide extérieur avec lequel s'effectue cet échange. L'utilisation de mélanges dans les pompes de chaleur a été étudiée, d'une part, au moyen de modèles de simulation sur ordinateur et, d'autre part, au moyen d'essais expérimentaux. Différentes applications ont été examinées à la fois dans le domaine du chauffage résidentiel et dans le domaine industriel. Whenever heat is recovered and delivered, the coefficient of performance of a heat pump can be increased by using a fluid mixture selected to have a temperature variation, during the vaporization and condensation stages, parallel to that of the outside fluid with which the heat exchange takes place. Such a solution was investigated both theoretically and experimentally. It has been shown that significant savings can be expected, ranging up to 50% of the energy consumption of conventional heat pumps in some cases. Various applications for home and industrial heating have been examined, and the economic prospects have been found to be satisfactory. Further work is needed to develop such heat pumps on a commercial basis.

  16. Infarctus du myocarde chez le Togolais : Facteurs de risque eyt ...

    African Journals Online (AJOL)

    Le diagnostic de l'infarctus du myocarde (IDM) chez les noirs n'est pas aisé. Effet l'électrocardiographie (ECG) présente souvent chez ces derniers, des atypies de repolarisation. Le dosage des enzymes cardiaques devient donc incontournable. Notre objectif est d'évaluer les facteurs de risque chez les malades Togolais ...

  17. Case Report - Le kyste hydatique du cordon spermatique: Une ...

    African Journals Online (AJOL)

    L' hydatidose est une anthropo-zoonose due au développement chez l'homme de la forme larvaire du taenia Echinococcus granulosis. La plupart des kystes hydatiques se localisent dans le foie et les poumons. Le kyste hydatique du cordon spermatique est extrêmement rare avec seulement 4 cas rapportés dans la ...

  18. Prevalence du cancer de la prostate a l'autopsie chez le noir africain ...

    African Journals Online (AJOL)

    Objectifs : Le cancer de la prostate est le cancer le plus fréquent de l'homme de plus de 50 ans dans les pays occidentaux. En Afrique le bas niveau de médicalisation et les difficultés à l'accès des services de santé rendent cette affection moins connue et le diagnostic tardif, parfois même non diagnostiquée. Le but de cette ...

  19. Vers une plus grande collaboration régionale — le CRDI appuie le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Bien qu'ils aient souvent de la difficulté à se démarquer face à la véritable dynamo économique qu'est la Chine, des pays tels que le Laos, le Cambodge et le Vietnam, qui tentaient d'échapper à la guerre il y a à peine 25 ans, connaissent une croissance explosive encore plus remarquable. Renaissance ...

  20. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sophie Comeau

    31 déc. 2011 ... Le Centre de recherches pour le développement international. CRDI , qui est un élément clé de l'aide internationale du. Canada depuis 1970, appuie des travaux de recherche dans les pays en développement afin d'y favoriser la croissance et le développement. Il veille aussi à promouvoir la diffusion.

  1. Le « modèle germanique » Français

    OpenAIRE

    Lefebvre , Armelle

    2009-01-01

    Resume Le concept d?Allemagne permet de reveler, selon une approche , l?ampleur des desaccords ayant preside a la definition du concept d?Etat en France. De ce dernier, l?on aborde divers emplois qu?illustrent des modeles d?Etat. Le opere ainsi dans un debat qui est le creuset de la connaissance politique moderne, avec ses apories: celles de la souverainete externe, de l?ordre interetatique, de la confederation. L?article expose alo...

  2. 205 Le Role de la Litterature dans le Developpement de la Nation ...

    African Journals Online (AJOL)

    Ike Odimegwu

    du plaisir en même temps qu'il le moralise. Elle fait naître dans ses lecteurs ou dans son audience des .... développement de l'esprit>>(319)Par cette définition nous comprenons que le développement signale qu'il du progrès ... qu'elle est une œuvre de l'imagination qui aide l'homme à transcender le monde physique.

  3. LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...

    African Journals Online (AJOL)

    Après chirurgie, les récidives sont fréquentes. Lele de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...

  4. Le monde virtuel: Miroir des changements reels en Algerie | Nafa ...

    African Journals Online (AJOL)

    Virtuel: ce mot dénote plusieurs sens. Dans un premier temps, le mot virtuel fait référence à Internet qui est le lieu de notre recherche. Deuxièmement, la philosophie explique le mot virtuel en termes de ce qui est possible. Nous en arrivons à l'objet de notre article : une réflexion sur les futurs possibles des nouveaux ...

  5. Une nouvelle ouverture sur le monde pour les femmes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'appellent ailleurs dans le dédale d'étals et d'allées serrés. En plus de son travail sur le marché, Jertrudes est également secrétaire de l'association des femmes qui vendent sur ce marché. Le groupe est un endroit où elles ...

  6. : Le cancer du col de l'utérus, nouvelles stratégies de dépistage ?

    OpenAIRE

    Heard , Isabelle; Costagliola , Dominique

    2008-01-01

    National audience; Le cancer du col de l'utérus reste le deuxième cancer le plus fréquent chez les femmes dans le monde, alors que son dépistage, par le frottis, existe depuis plus de 50 ans. En France, le cancer du col de l'utérus est le huitième cancer féminin avec 3 387 nouveaux cas estimés en 2000

  7. Le grand inventaire

    Directory of Open Access Journals (Sweden)

    Michel Melot

    2012-05-01

    Full Text Available Depuis quarante ans qu’il existe, l’Inventaire général des monuments et des richesses artistiques de la France n’a pas seulement progressé, couvrant près de dix mille communes, documentant plus de vingt mille dans cinq millions de pages, trois millions de photographies, et cent mille dessins. Il est devenu ce que ses fondateurs désiraient qu’il fût. Il n’est pas une liste d’objets plus ou moins singuliers qu’on aurait oubliés, mais l’observation méthodique de l’émergence dans le monde de l’ar...

  8. Publications | Page 179 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lele de l'énergie dans le développement rural. Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une ... Enterrer la hache de guerre : le CRDI appuie un processus de paix inédit. La plupart des gens pensent que la paix est un état dans lequel soit il « ne se produit rien de ...

  9. Publications | Page 177 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lele de l'énergie dans le développement rural. Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une ... Enterrer la hache de guerre : le CRDI appuie un processus de paix inédit. La plupart des gens pensent que la paix est un état dans lequel soit il « ne se produit rien de ...

  10. Plaidoyer pour le lavage de nez dans les pathologies naso ...

    African Journals Online (AJOL)

    Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

  11. Publications | Page 59 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le rapport régional de 2012 du projet Global Entrepreneurship Monitor (GEM), qui porte sur l'Afrique subsaharienne, est le premier à examiner les dynamiques d'entrepreneuriat dans la région. Il a été lancé à Lusaka, en Zambie, le 19 novembre 2013. Les données recueillies par le Zimbabwe sur la pauvreté : un apport ...

  12. Gestion du Centre | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Comité de gestion du Centre (CGC) est composé des membres de la haute direction du CRDI, notamment les directeurs de nos quatre bureaux régionaux et de nos principaux secteurs de programme. Le CGC travaille en collaboration avec le président afin de soutenir la recherche pour le développement, lui fournissant ...

  13. Le paludisme, le tsunami silencieux d'Afrique | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  14. Le théâtre de la politique

    Directory of Open Access Journals (Sweden)

    Michel Contat

    2007-06-01

    Full Text Available Chacun aujourd’hui choisit son Sartre, comme on choisissait son Marx dans les lointaines années 1960, celui des Grundrisse, celui des manuscrits de 1848 ou celui du Capital. Une citation : 'De toute façon, l’ordre social repose aujourd’hui sur la mystification des consciences, comme aussi le désordre. Le nazisme était une mystification et le gaullisme en est une autre, le catholicisme en est une troisième ; il est hors de doute, à présent, que le communisme français en est une quatrième.' C’est Sartre qui parle, le Sartre 1947, celui de Qu’est‐ce que la littérature ? – le Sartre que l’on a peut‐être aujourd’hui le plus de satisfaction à suivre. (Situations II, p. 306. Cité par Julia Kristeva. Le centenaire de 2005 a révélé que Sartre reste toujours l’objet vivant d’une polémique, que ce nom recouvre un homme et une pensée à attaquer, parce que, finalement, comme il le disait, « l’intelligence offense ».

  15. Changer le travail des animaux, pour changer le travail des humains

    OpenAIRE

    Porcher, Jocelyne

    2016-01-01

    Animaux et hommes construisent des liens par le travail, explique l’auteure de cette tribune. Il existe même un « travailler » de l’animal, où celui-ci s’investit et recherche du sens. Réfléchir au travail des animaux, c’est aussi s’interroger sur le travail humain.

  16. Quand le dentier devient danger!

    Science.gov (United States)

    Sadak, Nouzha; Herrak, Laila; Achachi, Leila; El Ftouh, Mustapha

    2017-01-01

    Bien que rare chez l'adulte, l'inhalation de corps étranger (CE) est un accident grave pouvant mettre en jeu le pronostic vital ou entrainer des séquelles importantes. Nous rapportons l'observation d'un patient de 50 ans, sans antécédents pathologiques particuliers, qui s'est présentée aux urgences pour douleur thoracique, toux intermittente et dyspnée d'effort, six jours après avoir inhalé, accidentellement, sa prothèse dentaire en plastique lors d'un repas. L'examen clinique était sans particularités. La radiographie thoracique ainsi que l'ASP ne montraient pas d'anomalie. Une bronchoscopie souple sous anesthésie générale a permis de visualiser le CE au niveau du tronc intermédiaire et l'extraction a été réalisée avec succès évitant ainsi le recours à un geste beaucoup plus invasif. La radiographie standard peut s'avérer utile en visualisant les CE radio-opaque ou par des signes indirects évoquant la présence d'un CE, mais le recours à la bronchoscopie à visée diagnostique et thérapeutique est primordial. PMID:28904706

  17. Le recueil littéraire

    OpenAIRE

    Alduy, Cécile; Asselin, Isabelle; Audet, René; Baetens, Jan; Beaudet, Marie-Andrée; Bissonnette, Thierry; Bonenfant, Luc; Bouchet, André du; Brault, Jacques; Brouillette, Marc André; Clément, Anne-Marie; Denis, Benoît; Doucet, Isabelle; Dumont, François; Dupont, Frances Fortier et Caroline

    2016-01-01

    Architecte d'une œuvre plurielle, le recueil est de toutes nos lectures. Puzzle ou série, cycle ou mélange, il se feuillette, se reprend, se quadrille ou se picore. Mais qu'est-ce donc qu'un recueil ?

  18. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  19. EST Vocabulary Instruction

    Directory of Open Access Journals (Sweden)

    Célia D.S. Bell

    2012-05-01

    Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.

  20. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Recherche visant à améliorer les possibilités pour les femmes. En Inde, les lois sur le mariage varient selon les religions. Le droit civil en matière de mariage est la Loi spéciale sur le mariage, qui permet aux parties de différentes religions de se marier sans changer de religion. Elle exige le consentement explicite des deux ...

  1. Lele des petites villes dans la poursuite de meilleurs résultats en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La population et le produit intérieur brut (PIB) de ces petites villes connaissent une croissance impressionnante. Cette tendance devrait s'intensifier au cours des prochaines décennies. Recherche sur les petites villes en vue de meilleurs résultats. Lele des petites villes dans le développement socio-économique est mal ...

  2. : tous les projets | Page 476 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le peuple autochtone Mapuche est établi sur ce qui est aujourd'hui le sud-ouest de l'Argentine et le sud du Chili. Date de début : 31 juillet 2008. End Date: 31 janvier 2011. Sujet: INDIGENOUS POPULATION, PROTECTED AREAS, Natural Resources, RESOURCES MANAGEMENT. Région: Argentina, South America, ...

  3. : tous les projets | Page 475 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le peuple autochtone Mapuche est établi sur ce qui est aujourd'hui le sud-ouest de l'Argentine et le sud du Chili. Date de début : 31 juillet 2008. End Date: 31 janvier 2011. Sujet: INDIGENOUS POPULATION, PROTECTED AREAS, Natural Resources, RESOURCES MANAGEMENT. Région: Argentina, South America, ...

  4. Le regard anachronique

    Directory of Open Access Journals (Sweden)

    Jean-Paul Aubert

    2011-01-01

    Full Text Available Cet article a pour objet l’anachronisme dans le film historique. Il s’appuie sur l’étude du long métrage Goya à Bordeaux, réalisé en 1999 par le cinéaste espagnol Carlos Saura. Cette biographie filmée du peintre Francisco de Goya fait mieux que composer avec l’anachronisme inhérent à toute reconstitution historique. Il l’assume et le revendique. La mise en cause de la chronologie et l’effacement de l’Histoire prennent sens dans la perspective d’une réflexion originale sur l’Histoire de l’art conçue comme un dialogue entre les œuvres et entre les époques.Este artículo está dedicado al problema del anacronismo en las películas históricas. Se basa en el estudio de Goya en Burdeos, un largo metraje rodado en 1999 por el director de cine español Carlos Saura. Esta biografía de Goya no sólo se acomoda con el anacronismo propio de la reconstitución histórica sino que lo asume y lo reivindica. El cuestionamiento de la cronología y el desinterés por la Historia cobran un nuevo sentido en el marco de una reflexión original sobre la Historia del arte concebida como un diálogo entre las obras y entre las épocas.

  5. Implicit upwind schemes for computational fluid dynamics. Solution by domain decomposition; Etude des schemas decentres implicites pour le calcul numerique en mecanique des fluides. Resolution par decomposition de domaine

    Energy Technology Data Exchange (ETDEWEB)

    Clerc, S

    1998-07-01

    In this work, the numerical simulation of fluid dynamics equations is addressed. Implicit upwind schemes of finite volume type are used for this purpose. The first part of the dissertation deals with the improvement of the computational precision in unfavourable situations. A non-conservative treatment of some source terms is studied in order to correct some shortcomings of the usual operator-splitting method. Besides, finite volume schemes based on Godunov's approach are unsuited to compute low Mach number flows. A modification of the up-winding by preconditioning is introduced to correct this defect. The second part deals with the solution of steady-state problems arising from an implicit discretization of the equations. A well-posed linearized boundary value problem is formulated. We prove the convergence of a domain decomposition algorithm of Schwartz type for this problem. This algorithm is implemented either directly, or in a Schur complement framework. Finally, another approach is proposed, which consists in decomposing the non-linear steady state problem. (author)

  6. Le barde et le bouffon

    OpenAIRE

    Fasquel, Samuel

    2013-01-01

    La Gatomaquia de Lope de Vega, La Moschea de Villaviciosa et le Poema heroico de las necedades y locuras de Orlando el enamorado de Quevedo constituent un corpus poétique qui réunit les meilleurs fruits produits par la geste burlesque dans l’Espagne du Siècle d’or. Cet article analyse les profondes différences esthétiques qui caractérisent ces œuvres dans le but de montrer que, malgré ces différences et en dépit de l’importance des éléments carnavalesques et grotesques, ces trois poèmes ne pr...

  7. Le travail … c’est la santé : la santé au travail … une pratique en question Work… is health : health at work … a practice in question La salud laboral… una práctica en cuestionamiento

    Directory of Open Access Journals (Sweden)

    Paul Frimat

    2010-02-01

    Full Text Available C’est en 1946 qu’est née cette institution originale qu’est la médecine du travail. Au départ, principalement basée sur une approche essentiellement individuelle, la notion d’aptitude y occupait une place centrale au sein du système de santé. Ce système a connu des évolutions où l’approche individuelle s’est peu à peu couplée à une dimension plus collective, laissant cependant encore un système largement perfectible. Dans ces évolutions, la décision d’aptitude s’est, quant à elle, complexifiée. De nombreux rapports ont d’ailleurs été écrits ces cinq dernières années afin de mettre en débat à la fois la légitimité de pérenniser un tel concept, mais également son efficacité en ce qui a trait à la prévention des pathologies liées au travail. Une loi sera sans doute prévue fin 2009, 2010… Mais qu’en sera-t-il de la pratique, quelle réalité perdurera ? Apte/inapte ? Comment peut-on aider à la compatibilité entre droit à la santé et droit au travail ? En quoi le système français de l’aptitude et de l’inaptitude a pu offrir des garanties pour l’employeur, le salarié, la société ? Tel sera l’objet de cette intervention.It was in 1946 that this new original institution, occupational medicine, was created in France. At the beginning, based mainly on an essentially individual approach, the concept of medical ability held a central place in the health system. This system has changed and the individual approach is now paired with a more collective vision, leaving the system still largely perfectible. Among these evolutions, the medical ability decision has become increasingly complex. Numerous reports have been written in the last five years to debate the legitimacy of maintaining such a concept, as well as its efficiency as far as the prevention of work-related pathologies is concerned. A law will certainly be expected at the end of 2009/beginning of 2010. But, what about

  8. Etude thermo-hydraulique de l'ecoulement du moderateur dans le reacteur CANDU-6

    Science.gov (United States)

    Mehdi Zadeh, Foad

    Etant donne la taille (6,0 m x 7,6 m) ainsi que le domaine multiplement connexe qui caracterisent la cuve des reacteurs CANDU-6 (380 canaux dans la cuve), la physique qui gouverne le comportement du fluide moderateur est encore mal connue de nos jours. L'echantillonnage de donnees dans un reacteur en fonction necessite d'apporter des changements a la configuration de la cuve du reacteur afin d'y inserer des sondes. De plus, la presence d'une zone intense de radiations empeche l'utilisation des capteurs courants d'echantillonnage. En consequence, l'ecoulement du moderateur doit necessairement etre etudie a l'aide d'un modele experimental ou d'un modele numerique. Pour ce qui est du modele experimental, la fabrication et la mise en fonction de telles installations coutent tres cher. De plus, les parametres de la mise a l'echelle du systeme pour fabriquer un modele experimental a l'echelle reduite sont en contradiction. En consequence, la modelisation numerique reste une alternative importante. Actuellement, l'industrie nucleaire utilise une approche numerique, dite de milieu poreux, qui approxime le domaine par un milieu continu ou le reseau des tubes est remplace par des resistances hydrauliques distribuees. Ce modele est capable de decrire les phenomenes macroscopiques de l'ecoulement, mais ne tient pas compte des effets locaux ayant un impact sur l'ecoulement global, tel que les distributions de temperatures et de vitesses a proximite des tubes ainsi que des instabilites hydrodynamiques. Dans le contexte de la surete nucleaire, on s'interesse aux effets locaux autour des tubes de calandre. En effet, des simulations faites par cette approche predisent que l'ecoulement peut prendre plusieurs configurations hydrodynamiques dont, pour certaines, l'ecoulement montre un comportement asymetrique au sein de la cuve. Ceci peut provoquer une ebullition du moderateur sur la paroi des canaux. Dans de telles conditions, le coefficient de reactivite peut varier de maniere

  9. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Office 2004 Test Drive User

    31 déc. 2015 ... Budget 2015-2016 révisé. Le Conseil a approuvé le budget 2015-2016 avant le début de lʼexercice. Cʼest sur ce budget que sont fondées les sommes budgétaires qui ont été présentés dans le Rapport annuel. 2014-2015. En octobre, on a revu les prévisions budgétaires initiales en tenant compte des.

  10. Le modèle de l’erreur humaine de James Reason

    OpenAIRE

    Larouzée, Justin; Guarnieri, Franck; Besnard, Denis

    2014-01-01

    Ce papier de recherche a pour objet de revenir en détail sur les travaux de recherche du psychologue anglais James Reason, mondialement célèbre pour sa taxonomie de l’erreur humaine et son modèle étiologique de l’accident immensément connu sous le nom de Swiss Cheese Model (SCM) ou Modèle du Fromage Suisse. Ce papier de recherche est une synthèse du parcours scientifique de Reason, il revient aussi sur la conception du modèle et ses évolutions, il traite de ses usages, apports et limites. Il ...

  11. Le Fleix – Bourg Ouest

    OpenAIRE

    Gineste, Marie-Christine

    2013-01-01

    Date de l'opération : 2009 (EX) Le projet d’extension d’une cantine scolaire est à l’origine de cette prescription. Il concerne une parcelle de 1 438 m2 située sur un replat de la terrasse holocène, en bordure d’un affluent de la Dordogne ; le Lasolle du Bost, dans le périmètre supposé de l’agglomération antique appelée « ville de Meille ». L’assiette du projet correspond au XIXe siècle à un secteur agricole non bâti. Deux tranchées ont été réalisées, occasionnant la découverte, surtout au no...

  12. Le futur du travail | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 juin 2017 ... Une base de données probantes est nécessaire afin de trouver des solutions stratégiques et sociales appropriées aux divers défis que posent ces nouveaux modes de travail. La recherche sur l'innovation en matière d'éducation et le renforcement des capacités seront également essentiels pour assurer la ...

  13. Le principe non bis in idem et le droit communautaire

    OpenAIRE

    Hedabou, Aziz

    2018-01-01

    Le principe non bis in idem est une garantie fondamentale qui interdit que les mêmes faits soit poursuivi et puni deux fois. Il est reconnu par tous les droits internes et “appartient aux droit universel des nations”. Dès lors, sa lettre et son esprit ne sont plus cantonnés au droit interne et ont tendance à s’internationaliser. En droit communautaire, l’étude du principe non bis in idem peut être envisagée sous trois angles différents. D’abord en droit pénal international unilatéral où chaqu...

  14. Le glaive de la parole

    Directory of Open Access Journals (Sweden)

    Luce Marchal-Albert

    2006-09-01

    Full Text Available Chacun sait, selon le mot de Pierre Viret, « en quelle confusion est la Chrestienté » au xvie siècle en Europe. C’est le deuxième quart du siècle qui nous intéressera ici, et en particulier l’année 1545, qui constitue une année charnière qui voit vaciller l’Église romaine, flamber et culminer la chasse aux hérétiques en même temps qu’elle voit la jeune Église réformée se renforcer et se positionner avec succès dans un champ religieux plus que chaotique. Les ouvrages polémiques réformés écrits...

  15. Aharon Appelfeld et Philip Roth : le réel, l’imaginaire, le double et le fantastique

    OpenAIRE

    Toren, Orly

    2014-01-01

    C’est la marge étroite entre « le réel et l’imaginaire » selon le titre de l’essai de Masha Itzhaki sur Appelfeld que nous souhaiterions explorer à partir de la relation entre Le Temps des prodiges d’Appelfeld et Opération Shylock de Philip Roth. Si la vrai/fausse « confession » de Roth se présente comme le détournement vertigineux des codes du fantastique, de l’autobiographie et de l’autofiction, le roman d’Appelfeld pousse les limites du réalisme par l’interrogation que suscite son titre én...

  16. Leïomyosarcome de la prostate: Neoplasie rare

    Directory of Open Access Journals (Sweden)

    D. Basraoui

    2012-03-01

    La TDM et surtout l'IRM jouent un rôle primordial dans le bilan d'extension locale et à distance du léïomyosarcome prostatique et le seul moyen pour affirmer le diagnostic est l'histologie complétée par une étude immuno-histochimique. Leur prise en charge thérapeutique n'est pas codifiée à l'heure actuelle et leur pronostic reste très sombre.

  17. Abeilles et agriculture : Le tumultueux mariage entre abeilles et agriculture

    OpenAIRE

    Requier, Fabrice; Le Feon, Violette

    2016-01-01

    Le miel est la première image qui vient en tête à l’écoute du mot « abeille ». Pourtant, le miel que nous consommons est produit par une seule espèce, l’abeille mellifère (Apis mellifera), tandis que le mot « abeille » cache en réalité une multitude d’autres espèces très diversifiées et indispensables pour garantir le fonctionnement des écosystèmes et les rendements agricoles.

  18. Le CRDI au Sri Lanka

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie la recherche au Sri. Lanka depuis 1973. Il s'est d'abord concentré sur l'amélioration des pratiques agricoles. Par exemple, grâce à la mise au point d'un système de rizi - culture permettant d'exploiter les pluies de mousson, les riziculteurs ont triplé leurs rendements en quatre ans. Ils ont été nombreux à ...

  19. Kyste hydatique du foie rompu dans la paroi abdominale et dans le ...

    African Journals Online (AJOL)

    Le kyste hydatique du foie est une parasitose qui sévit à l´état endémique au maroc. La rupture dans la paroi abdominale et dans le psoas est une complication exceptionnelle. Nous rapportons un cas de kyste hydatique du foie rompu dans la paroi et dans le muscle psoas. Le diagnostic a été établi sur les données de ...

  20. Stimuler le tourisme dans les cantons de l'Afrique du Sud | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 juil. 2011 ... J'ai vite compris qu'on perd le client si l'on ne répond pas rapidement à un message électronique », affirme-t-elle. Le tourisme dans les cantons. Le Cap est en voie de devenir une destination touristique de choix. Elle se situe au troisième rang en Afrique, après Johannesburg et Le Caire, pour ce qui est du ...

  1. qu'île d'Ampasindava : transformations du paysage et système

    African Journals Online (AJOL)

    France, of an important territory including the peninsula (August ... images satellite montre que le rythme auquel le tavy est pratiqué .... Ce qui est paradoxal, c'est que d'importantes surfaces de zones carto- graphiées comme des forêts humides secondaires par Humbert et Cours Darne (1965) correspondent à des zones ...

  2. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  3. Le déficit de filles

    International Development Research Centre (IDRC) Digital Library (Canada)

    qui veulent former un couple idéal. D'autre part, les chercheuses indiquent que le céli- bat des femmes est perçu comme une « aberration totale ». Tous les répondants ont fait, à ce sujet, des remarques semblables : même la personne la plus riche du monde, disent-ils, ne peut assumer le far- deau financier qu'impose une ...

  4. Quand la musique donne le ton

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2017-01-01

    Le lycée Sainte-Anne de Copenhague est un établissement réputé pour les résultats de ses élèves et pour être le foyer d’une intense tradition chorale et musicologique. L’article interroge les parcours de 32 élèves d’une même classe, tous reçus au baccalauréat 2014 avec une option musique et...

  5. Le cas de l'Inde

    International Development Research Centre (IDRC) Digital Library (Canada)

    pwust

    le développement, l'Inde doit réduire la proportion de personnes vivant en deçà du seuil de pauvreté de 37,5 %, en. 1990, à 18,75 % ... exemple, à la suite du tsunami en Asie, en 2004, c'est le premier ministre qui a décidé de porter assistance. Pour ces types d'opérations, les forces militaires et paramilitaires indiennes.

  6. Les ERP changent-ils le contrôle de gestion ?

    OpenAIRE

    Meyssonnier, François; Pourtier, Frédéric

    2005-01-01

    L'intégration de l'information de gestion dans le cadre d'ERP se généralise et le contrôle de gestion s'effectue maintenant la plupart du temps en environnement ERP dans les grandes entreprises. Un état de l'art est effectué relativement à l'impact des ERP aussi bien sur les concepts et les outils du contrôle de gestion que sur la fonction et lele des contrôleurs de gestion. La démarche de recherche, fondée sur dix études de cas dans une approche intermédiaire entre les monographies qualit...

  7. Dimensionnement et performances d'un stockage d'énergie thermique fluide/solides

    OpenAIRE

    Salagnac, J.L.; Ayoub, J.A.

    1980-01-01

    Le stockage d'énergie thermique est un élément essentiel d'une boucle thermodynamique solaire. Tant que le niveau de température atteint dans une chaudière solaire à concentration reste inférieure à 300 °C environ, on fait appel à des fluides organiques à point d'ébullition élevé comme milieu de stockage. Ces fluides étant coûteux, on étudie ici un moyen d'en réduire la quantité en les stockant dans les interstices d'un lit fixe d'agrégats de faible coût. Les dimensions et les performances d'...

  8. Effet du stress salin sur le comportement physiologique et ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2013 ... rapidement dans les feuilles à partir de 25 mmol de NaCl. Le rapport de sélectivité K+/Na+ a été plus discriminant entre les variétés : Midass a présenté le rapport de sélectivité le plus élevé et Nabeul le rapport de sélectivité le plus faible. Conclusion et application : La variété Nabeul qui est de type piment ...

  9. Le patrimoine et ses outils de gestion

    CERN Document Server

    Garcin, J

    2001-01-01

    Les principale taches de gestion du Patrimoine immobilier du CERN sont la saisie des données, leur mise à jour, l'archivage et la mise à disposition des informations. Les outils de gestion actuels : Le Système de Gestion de Base de Données Relationnelles alphanumérique ORACLE permet de gérer toutes les informations du Patrimoine, sur le réseau du CERN. Le logiciel de dessin Graphique MICROSTATION (Bentley) a été installé dans la division ST depuis fin 1991. Les plans de situation des sites, des bâtiments et locaux, des espaces confinés ont été réalisés avec ce logiciel. Les outils de demain : La mise en place du SIG (Système d'Information Graphique) STAR a été réalisée en 1993. Le transfert des plans de locaux de MICROSTATION vers STAR est en cours depuis une année environ. Le dessin de la cartographie des réseaux de canalisations Eaux Usées et Eaux Pluviales est en cours de réalisation. Le Web est l'outil de consultation de l'information par les utilisateurs.

  10. Le risque fiscal réinventé

    OpenAIRE

    Loore, Frédéric

    2016-01-01

    En 2016, le risque fiscal est un concept à réinventer. Pour ce faire, il est utile de l’aborder selon deux questions: 1) Pourquoi le risque fiscal est-il réinventé? La crise financière de 2008 engendre une conscientisation des différents acteurs du monde fiscal. En effet, de nouveaux standards d'évaluation de la responsabilité sociétale des multinationales émergent. L'éthique, par le biais des considérations de l'opinion publique, s'immisce dans les réflexions politiques et influence les diff...

  11. Le Baratze (ou

    Directory of Open Access Journals (Sweden)

    Jacques Blot

    1998-01-01

    Full Text Available El círculo de piedras Mendizabal 7, de 8 metros de diámetro,   presenta una corona externa constituida de grandes bloques   hincados en la tierra, y otra interna y tangente, de elementos idénticos sólo puestos en el suelo. El cajón central está compuesto de cuatro losas y una tapa. No hay depósito de huesos ni de carbón de leña ; sólo se encuentran dos herraduras, entre las cuales una completa de tipo medieval, que podrían permitir de pensar en una construcción del círculo en el periodo histórico.

  12. Le tournoi des ombres

    CERN Document Server

    Treille, Daniel

    2017-01-01

    Le lecteur, transporté avec le narrateur dans une région hors norme, est invité à partager sa fascination pour la beauté du lieu, à découvrir la chronique de son passé, rude et pittoresque. Il va côtoyer une galerie de personnages très attachants, mais aux destinées bousculées par l histoire, et assister à l agitation montante du présent dans un contexte d une actualité brûlante. Ce quatrième roman de Daniel Treille, mêlant hardiment les genres, du quotidien trivial au récit épique, de considérations géopolitiques à quelques avancées de la science moderne, confirme son talent à mener, d une écriture très aboutie, une histoire complexe, peuplée de héros singuliers

  13. Lele de paysans mieux informés au Bénin | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 déc. 2010 ... Selon une simulation réalisée par des chercheurs béninois en 2003, si rien n'est tenté pour faire face aux changements climatiques, le rendement de cultures telles que le maïs, l'arachide, le manioc, le niébé et le riz baisserait de 6 %, et celui du coton, de près de 30 %, et ce, d'ici 2025. Alors, comment les ...

  14. Le potager n'est pas plus vert chez le voisin | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 sept. 2016 ... Il y avait aussi un problème d'usage, car les gens ignoraient comment les préparer. Et, finalement, un problème d'ordre ... «Ils disaient: “Vous, les scientifiques, vous voulez que nous produisions quelque chose que nous ne connaissons pas, mais qui l'achètera?”» raconteM. Adebooye. Les chercheurs ont ...

  15. L'apport de l'imagerie dans le diagnostic de la tuberculose uro ...

    African Journals Online (AJOL)

    La tuberculose uro-génitale (TUG) est une localisation secondaire de la maladie. Son diagnostic est bactériologique, mais la probabilité de mettre en évidence le bacille de Koch (BK) dans les urines est faible. D'où le concours de l'imagerie dans le diagnostic et la mise en route du traitement médical. Nous rapportons 4 ...

  16. Biodiversité et écologie des mousses au Nord-Est Algérien : cas du ...

    African Journals Online (AJOL)

    Le parc national d'El-Kala est situé à l'extrême Nord-est de l'Algérie, Il renferme un ensemble d'écosystèmes naturels allant de l'aquatique maritime au forestier en passant par le type aquatique lacustre. Le bassin versant du lac Tonga fait partie de cet ensemble de paysages. Compte tenu de la diversité des bryophytes et ...

  17. La pisciculture en cage est prisée au Népal | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 oct. 2010 ... Des chercheurs du Nepal Agricultural Research Council ont constaté que l'eau du réservoir créé par le barrage se prêtait exceptionnellement bien à l'élevage des poissons, en particulier des carpes, dans de grandes cages flottantes. Le milieu est idéal pour les poissons car le plancton y abonde.

  18. Pays en transition : pour que les sociétés se transforment, il est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Conscient du fait que les périodes de transformation risquent de provoquer le chaos, mais qu'elles sont également porteuses de rapides progrès sur le plan social et économique, le CRDI est intervenu dans quelque 25 pays ayant amorcé une transition de la guerre à la paix, de la dictature à la démocratie ou d'une ...

  19. Le continu contre l'espace

    Science.gov (United States)

    Salanskis, Jean-Michel

    Disons pour conclure que, en tout état de cause, la façon de concevoir philosophiquement le conflit du continu et de l'espace que nous avons trouvée chez Hegel n'est pas homogène avec le style et les modalités de la pensée mathématique: 1) d'une part, le lien classique, le lien de référence entre continu et espace en mathématiques n'est pas que l'espace serait premier et privé de pensée, et le continu second, venant dissoudre l'espace en apportant la qualité, l'infini et la pensée, mais tout au contraire, il consiste en ce que l'espace est fondé sur l'abîme infinitaire du continu ; 2) d'autre part, l'éventuel divorce entre l'espace et le continu dans l'aire mathématique n'est pas celui d'une réflexivité purement conceptuelle du continu avec un positivisme géométrique, n'équivaut pas à une rupture disciplinaire ; il est plutôt le symptôme de la dérive d'une herméneutique à l'égard d'une autre, au sein d'un continent juridique commun définissant la discipline (la mathématique ensembliste), cette dérive pouvant, à la limite, induire une refonte de ce sol juridique, sans que jamais il soit question pour autant de nier l'unité des mathématiques, à comprendre ici comme l'unité ultime de responsabilité de la communauté mathématique à l'égard des trois questions Qu'est-ce que l'espace?”, “Qu'est-ce que le continu?” et “Qu'est-ce que l'infini?”.

  20. , TOUCHE PAS À MA TERRE, I ! ' C'EST MA VIE !

    International Development Research Centre (IDRC) Digital Library (Canada)

    .interpares.ca. Fondée en 1975, Inter Pares, dont le nom signifie « entre égaux », est une organisation canadienne de justice sociale œuvrant au Canada et dans le Sud globalisé. Inter Pares s'attache à faire connaître les causes et les effets ...

  1. Reformulation à l’oral et dans le forum Web

    Directory of Open Access Journals (Sweden)

    Eshkol-Taravella Iris

    2016-01-01

    Full Text Available Le cadre du travail réalisé entre dans le domaine de la linguistique de corpus et du Traitement Automatique des Langues (TAL. Les recherches sont fondées sur trois corpus : deux corpus oraux (ESLO1 et ESLO2 et un corpus composé de discussions collectées sur un forum de Doctissimo. Le travail vise à détecter, analyser et comparer la reformulation introduite par trois marqueurs (c’est-à-dire, je veux dire et disons dans le discours oral et le corpus écrit dialogique du Web. L’objectif est d’étudier la raison pour laquelle le locuteur décide de modifier un segment par un autre et de repérer un lien formel entre les deux segments reformulés aux différents niveaux linguistiques (morphologique, lexical, syntaxique, etc..

  2. Le sacré sauvage

    Directory of Open Access Journals (Sweden)

    Roger Bastide

    2010-09-01

    Full Text Available Conférence prononcée le 13 septembre 1973 dans le cadre des Rencontres Internationales de Genève qui avaient pour thème cette année-là « Le besoin religieux ». Cette conférence figure dans les Actes de cette rencontre (Le Besoin religieux, Éditions de la Baconnière, Neuchâtel, 1974, pp. 123-145. Elle a été republiée dans un ouvrage posthume dont elle est l’éponyme, ouvrage édité par Henri Desroche (Paris, éditions Stock, 1975. Nous reproduisons ici le texte intégral original, avec l’aimable autorisation des Rencontres Internationales de Genève auxquelles SociologieS adresse ses remerciements.The wild sacredText of a lecture taken on November the 13th 1973 during the Rencontres Internationales de Genève whom theme was "The religious need". This lecture was first published in: Le Besoin religieux (La Baconnière Editions, Neuchâtel, 1974, pp. 123-145, and published once again in a posthumous book: Le sacré sauvage ("The wild sacred" edited by Henri Desroche (Paris, Stock Editions, 1975. It is reproduced here with the kind authorization of the Rencontres Internationales de Genève. SociologieS gives them sincere thanks.Le Sacré sauvage (Lo sagrado en el mundo primitivoConferencia efectuada el 13 de septiembre de 1973 en el marco de las Rencontres Internationales de Genève (Encuentros Internacionales de Ginebra que tenia como tema general la necesidad de la experiencia religiosa (“Le besoin religieux”, Éditions de la Baconnière, Neuchâtel, 1974, pp. 123-145. Esta conferencia fue publicada de nuevo en un trabajo póstumo que lleva el mismo título, editado por Henri Desroche (Paris, Éditions Stock, 1975. Reproducimos aquí la integralidad del texto original con la amable autorización de las Rencontres Internationales de Genève, a las cuales la revista SociologieS expresa su agradecimiento.

  3. La construction de la matière le modèle Standard

    CERN Document Server

    Léon, Jacques

    2016-01-01

    Qu'est-ce que la matière ? Voilà une question à laquelle il pourrait sembler facile de répondre car il n'est rien de plus concret que la matière. Et pourtant, la réponse qu'en donne la physique contemporaine est pour le moins déconcertante ! Le concept-même de particules, briques élémentaires de la matière, s'est volatilisé, dissout dans des objets mathématiques abstraits et abscons pour les non-initiés. Plus nos théories sont précises et plus l'image qu'elles nous renvoient est insaisissable. En un siècle, la représentation des particules s'est métamorphosée en nuages de probabilité portés par des champs quantiques régis par des symétries confinées dans des espaces abstraits. Mais dans un même temps, nous avons réussi le tour de force d'expliquer toute cette complexité avec seulement 16 particules… et une seule théorie, véritable construction de notre conception de la matière : le modèle standard. Ce livre tente de guider le lecteur dans le dédale de la physique des particu...

  4. Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Ce projet tentera de résoudre le problème en menant des recherches sur la façon dont les politiques peuvent favoriser des ...

  5. Origin, age and physico-chemical processes of fluid circulations in fractures: example of under-cover basement (Vienne) and of clay-rich formations (Gard, East); Origine, age et processus physico-chimiques des circulations de fluides dans les fractures: exemple de socle sous couverture (Vienne) et de formations riches en argiles (Gard, Est)

    Energy Technology Data Exchange (ETDEWEB)

    Buschaert, St

    2001-10-01

    The study of minerals sealing the discontinuities and the cavities by past to recent fluid circulations is the only method to assess the paleo -hydrological and -hydrogeochemical behavior of both sedimentary or granitic systems. Petrographic, mineralogic, isotopic (C, O, H) and geochemical (K/Ar) tools provide the opportunity: i) to identify the source and the nature of sealing (carbonates and quartz) -forming waters and ii) to precise the physical and chemical mechanisms occurring during fluid circulations. This study is focused on 3 sites selected in the framework of a survey managed by Andra for the feasibility of an underground laboratory: in the covered plutonites of Charroux Civray (Vienne), 3 major fluid circulations (Hercynian fluids, Mesozoic brines, diagenetic waters) have been identified. The carbonates deposited in discontinuities or pervasively inside the granitic rocks have been formed from an unique C source ({delta}{sup 13}C ranging from -9 and -14 0/00). C stock has been early introduced during retrograde metamorphism, and afterwards, re-mobilized by successive fluid inputs. This confers on the Ca-rich plutonic rocks an efficient self-sealing capacity during later fracturing and fluid flow. In Cretaceous siltstones and surrounding limestones and sandstones of Marcoule (South-eastern Basin), calcites from fracture formed during Eocene compression and/or Oligocene extension have been deposited under low temperature conditions (T <50-55 deg C). C and O sources of fracture calcites differ as a function of stratigraphical levels. Fracture sealing occurs: i) either in close system, by redistribution of the nearby host-rock cements, or ii) in open system with introduction of C and O from external sources. These late events have contributed to reduce the global permeability of the rocks trough the sealing of the fractures. In the Eastern part of the Paris basin, circulations of meteoric fluids have occurred at a regional scale during Tertiary, both in the

  6. Le thallium dans les sols et les végétaux supérieurs. I. Le thallium dans les sols

    OpenAIRE

    Tremel, A.; Mench, M.

    1997-01-01

    Le thallium est un métal trace non essentiel qui, malgré sa forte toxicité pour tous les organismes, a peu intéressé jusqu’à ce jour la communauté scientifique. Le but de cette synthèse est de faire le point des connaissances récentes disponibles et les plus significatives concernant les concentrations et le comportement de ce métal dans le sol, ainsi que les aspects réglementaires et les problèmes de réhabilitation qui se rattachent à sa présence dans celui-ci.

  7. Publications | Page 96 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... La lutte antitabac en Afrique du Sud : une stratégie gagnante. L'Afrique du Sud, où l'usage du tabac est le deuxième facteur en importance après le VIH/sida en ...

  8. Sophie D'Amours | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le 1er juin 2017, Mme Sophie D'Amours est devenue la première femme à occuper le poste de rectrice à l'Université Laval. Professeure au sein du département de génie mécanique depuis 1995, elle a également occupé le poste de vice-rectrice à la recherche et à la création de 2012 à 2015.

  9. Publications | Page 94 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, ... Le syndrome... Diamants de guerre — pour en finir. L'important accord international sur les diamants conclu cette année ne portera pas fruits s'il n'est pas ...

  10. Le CRDI au Cambodge

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI a été l'un des premiers bailleurs de fonds à établir des relations avec le Cambodge au début des années 1990, alors que le pays progres- sait vers la paix. Depuis, le Centre aide à reconstruire le Cambodge, qui se remet du régime inhumain des Khmers rouges et de décennies de conflits régionaux. Un État ...

  11. 1910 - Le mouchoir

    NARCIS (Netherlands)

    Winkler, M.F.; Cohen, Nadja; Reverseau, Anne

    2015-01-01

    Une histoire littéraire buissonnière. Ainsi pourrait-on qualifier le parcours original auquel nous convie cet ouvrage, qui propose une lecture insolente et insolite de cinquante années de littérature – de 1900 à 1950 – par le prisme des objets. Objets de tous les jours comme le tabac, le vélo ou le

  12. La science, la littérature, le rituel: le vrai dire et le plus que mentir

    Directory of Open Access Journals (Sweden)

    Panagiotis Christias

    2005-03-01

    Full Text Available Le scientifique promet la vérité sans être en mesure d'accomplir sa promesse tandis que l'écrivain promet de mentir mais par son mensonge, il fait plus que mentir. Il ne dit certainement pas la vérité, car la vérité n'est pas sa préoccupation première. Voilà comment nous pouvons résumer les deux attitudes, condamnées à un antagonisme stérile par l'attitude positiviste moderne. Compte tenu donc de l'intention fondatrice de la science, de sa promesse donc originaire et fondatrice, la science doit dire la vérité et rien que la vérité. Ce qui, de l'aveu même de cette même science, est impossible. [...] La littérature se permet de reconstruire des mondes par-delà le vrai et le faux. [...] Un récit littéraire ne demande pas la consécration de la vérité, ne demande pas à être suivi parce que vrai, n'impose rien et n'attend rien. Sa vraie destinée est l'errance et sa vraie conscience est celle de sa dissémination. Celui qui renonce à la prétention de vérité renonce en même temps à la volonté de dominer. Dominer signifie créer un espace de vérité dans lequel celui qui énonce la vérité est le maître légitime de ceux qui sont dans le champ de la conception du monde dont cette vérité est la pierre angulaire.

  13. Le déficit de filles — Le déséquilibre du ratio hommes-femmes en Inde

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans une « société normale », la proportion de femmes est égale ou un peu supérieure à celle des hommes. Or, ce n'est pas le cas en Inde, où le ratio hommes-femmes – le nombre de femmes par rapport au nombre d'hommes – est l'un des plus déséquilibrés au monde. Bien que la Chine soit aujourd'hui le pays où il ...

  14. Georges et le big bang

    CERN Document Server

    Hawking, Lucy; Parsons, Gary

    2011-01-01

    Georges et Annie, sa meilleure amie, sont sur le point d'assister à l'une des plus importantes expériences scientifiques de tous les temps : explorer les premiers instants de l'Univers, le Big Bang ! Grâce à Cosmos, leur super ordinateur, et au Grand Collisionneur de hadrons créé par Éric, le père d'Annie, ils vont enfin pouvoir répondre à cette question essentielle : pourquoi existons nous ? Mais Georges et Annie découvrent qu'un complot diabolique se trame. Pire, c'est toute la recherche scientifique qui est en péril ! Entraîné dans d'incroyables aventures, Georges ira jusqu'aux confins de la galaxie pour sauver ses amis...Une plongée passionnante au coeur du Big Bang. Les toutes dernières théories de Stephen Hawking et des plus grands scientifiques actuels.

  15. le pommier de cayor, espece emblematique du dallol bosso

    African Journals Online (AJOL)

    usage alimentaire le plus répandu est la consommation crue de la pulpe des fruits frais. Les amandes sont soit consommées crues, soit pilées et utilisées en sauce comme condiments, soit utilisées pour l'extraction traditionnelle d'huile. Le bois de ...

  16. Tanzanie | Page 9 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Salaam, le ronflement des 50 machines à coudre est aussi tenace que le vrombissement d'insectes. Les ouvriers cousent des filets bleus, verts et blancs qui ont été tissés sur les métiers de la manufacture. Ces hommes et ces femmes font partie ...

  17. La lutte contre le tabagisme en Afrique : Peuples, politique et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 déc. 2011 ... Le tabagisme se répand rapidement en Afrique subsaharienne sous l'impulsion d'une forte croissance économique et des tactiques publicitaires agressives des multinationales du tabac ; bien que les interventions politiques y soient bien comprises, l'économie politique du contrôle du tabagisme ne l'est ...

  18. Etude sur le Latin dus codex Bobiensis (k) des evangiles

    NARCIS (Netherlands)

    Hoogterp, Pieter Willem

    1930-01-01

    Le manuscrit dus texte, dont nous allons entreprendre l'étude, se trouve à la Biblioteca Nazionale de Turin (G VII 15). Il est universellement connu sous le nom de Codex Bobiensis (k d'après Tischendorf) et contient des parties de l'évangile selon S. Matthieu (I, 1-III, 10; IV, 2-XIV, 17; XV, 20-36)

  19. Recherche | Page 8 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Économiser l'eau en choisissant les bonnes cultures en Tunisie ... La Tunisie est un pays aux ressources limitées en eau. Bien que l'agriculture ait toujours joué un rôle important dans le développement social et économique du .

  20. Publications | Page 24 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cependant, il est couramment utilisé comme combustible, dans les régions rurales, pour faire cuire le pain dans un four traditionnel. Objectif du Vietnam : taille optimale pour les entreprises émergentes. La croissance impressionnante du Vietnam depuis les années 1990 lui a permis d'acquérir le statut de pays à revenu ...

  1. Livres | Page 18 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  2. Publications | Page 175 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualitatifs.

  3. Livres | Page 16 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  4. Dans le grand collisionneur du CERN

    CERN Document Server

    AUTHOR|(CDS)2051256

    2014-01-01

    Ce livre fait pénétrer le lecteur non initié dans l’instrument scientifique le plus grand du monde. D’ailleurs, le web fut précisément inventé à Genève en vue d’une collaboration aussi gigantesque. Résultat de vingt ans de recherche, le LHC, Grand collisionneur de hadrons, est l’anneau de 26,7 km creusé sous la frontière francosuisse, où sont accélérés, en sens opposés, des paquets de particules jusqu’à des vitesses et des énergies extrêmes. Ainsi la physique s’est-elle engagée dans une étape nouvelle de nos connaissances. Après les grandes découvertes de l’univers et de la réalité microscopique du siècle dernier, le collisionneur nous fait progresser aujourd’hui dans un «nuage de probabilités» aux frontières de l’antimatière. Dans une bousculade de particules, voici le champ convoité du boson de Higgs. Mario Campanelli, professeur associé à l’Université de Londres et collaborateur au projet ATLAS du LHC, propose, dans cet ouvrage, de s’introduire pas �...

  5. Le corpus lexicographique dans les langues à tradition orale: le cas ...

    African Journals Online (AJOL)

    rbr

    Par le truchement de la production orale libre, l'auteur base ses hypothèses de recherche sur une expérience en dialecte fang-mekè, ..... point d'appui dans la recherche des mots dont les définitions ou les portées sémantiques ne figurent pas ..... cet outil indispensable qu'est le dictionnaire. Je pense que ces langues ont.

  6. Le partenariat mondial sur les données ouvertes pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet aidera les gouvernements de pays en développement à élaborer et à gérer des politiques et des pratiques en matière de données ouvertes. .... Le CRDI investit dans des solutions locales aux problèmes auxquels l'Inde est confrontée, comme le stress thermique, la gestion de l'eau et les migrations liées aux ...

  7. LE CHOLESTÉATOME DE L'OREILLE MOYENNE

    African Journals Online (AJOL)

    une forme particulièrement agressive d'otite moyenne chronique dont le traitement est exclusivement chirurgical. Le but de cet article est de présenter une mise au point sur la prise en charge de ..... une éventuelle reprise de la maladie après un geste chi- rurgical d'exérèse quelle que soit la technique opératoire adoptée.

  8. Case Report - Le noeud ileosigmoidien: à propos de 2 cas ...

    African Journals Online (AJOL)

    Le noeud iléosigmoïdien ou l'ileosigmoid knot (ISK), est une entité clinique exceptionnelle, c'est une urgence chirurgicale caractérisée par une strangulation du grêle en formant un noeud autour de la base du colon sigmoïde avec risque de nécrose rapide du grêle et du colon. Nous rapportons deux cas dans le service des ...

  9. Le CRDI et Cancer Research UK lancent une nouvelle initiative ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2017 ... Politiques de lutte contre l'usage nocif de l'alcool et de réduction de ses méfaits au Liban. L'alcool est le troisième plus important facteur de risque de maladies et d'invalidité dans le monde; il est un facteur de premier plan dans plus d'une soixantaine de maladies. Voir davantagePolitiques de lutte contre ...

  10. Adoption d'innovations agricoles par le truchement de services ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'agriculture est le fer de lance de nombreuses économies en développement, mais la capacité des petits agriculteurs privés de ressources à adopter des innovations agricoles est freinée par le manque d'accès à des services financiers adéquats. Des experts internationaux estiment qu'il existe un manque à gagner ...

  11. Vers une appropriation par le Maroc de son droit des étrangers ?

    OpenAIRE

    Khrouz, Nadia

    2016-01-01

    Le 9 septembre 2013, le Cabinet royal publie un communiqué de soutien aux recommandations émises le jour même par le Conseil national des droits de l’homme (CNDH). Alors que le Royaume est indexé depuis plusieurs années pour le non-respect de ses engagements formels – nationaux et internationaux – concernant le traitement accordé aux étrangers, en particulier subsahariens et en situation administrative irrégulière sur le territoire, l’une de ces recommandations consiste à régulariser la situa...

  12. Le modèle judiciaire libéral mis à l’épreuve : la surveillance des juges sous le Directoire

    OpenAIRE

    Berger, Emmanuel

    2007-01-01

    La justice du Directoire est principalement identifiée aux différentes violations infligées par le gouvernement afin de contrôler le pouvoir judiciaire et durcir la répression criminelle. Cette représentation est, en réalité, partiale. L’auteur tente de le prouver à travers l’analyse d’un aspect essentiel du système judiciaire directorial : la surveillance des juges. L’étude des normes et des pratiques montre que le mode de surveillance établi par le code des délits et des peines respecte la ...

  13. LE LIEN ENTRE FINANCE ET ECONOMIE ISLAMIQUES VIA LE MODELE PRINCIPIEL "ZR"

    OpenAIRE

    BELABES, ABDERRAZAK

    2010-01-01

    A l'heure où certains évoquent l'intégration de la finance islamique à la finance globale, et d'autres rattachent la finance islamique à des thèmes en vogue telles que la finance éthique, la finance participative ou la finance socialement responsable, le présent papier explore le lien entre finance et économie islamiques à partir du modèle principiel "ZR", c’est-à-dire "Zakât" et "Ribâ". Ce modèle montre que les principes invariants de Zakât et Ribâ jouent un rôle central dans l’établissement...

  14. L’entrepreneur, éléments d’une analyse parallèle Léon Walras / joseph alois Schumpeter (The entrepreneur, elements for a paralell analysis Leon Walras / joseph alois Schumpeter)

    OpenAIRE

    Sophie BOUTILLIER

    2010-01-01

    L. Walras, comme J. A. Schumpeter, avaient la même ambition : révolutionner la théorie économique. Ils atteignent cet objectif par des voies différentes (le premier par les mathématiques, le second par l’analyse sociohistorique). Ils formulent ainsi deux théories différentes de l’entrepreneur, agent économique central du capitalisme. Le modèle de Walras est statique. L’entrepreneur est rationnel par son comportement maximisateur. Le modèle de Schumpeter est dynamique. L’entrepreneur est le mo...

  15. Prendre le pli des techniques

    OpenAIRE

    Latour, Bruno

    1983-01-01

    À partir de la notion de mode d’existence développée par Gilbert Simondon et surtout par Etienne Souriau, il est possible d’aborder la question de la technique sans se laisser arrêter par la présence excessive de l’un de ses résultats : les objets techniques. On peut alors essayer de définir le mode propre de la technique comme un mouvement, un projet, un plissage, une forme très particulière de transcendance, qui n’a pas reçu en philosophie le traitement que mérite son importance et son ubiq...

  16. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  17. Les Brulures Chimiques Par Le Laurier Rose

    OpenAIRE

    Bakkali, H.; Ababou, M.; Nassim Sabah, T.; Moussaoui, A.; Ennouhi, A.; Fouadi, F.Z.; Siah, S.; Ihrai, H.

    2010-01-01

    Le laurier rose ou Nerium oleander est un arbuste qui pousse naturellement dans les régions méditerranéennes. Au Maroc on le trouve dans les lieux humides. Il est réputé par ses risques de toxicité systémique en cas d'empoisonnement à cause de la présence de deux alcaloïdes, surtout l'oléandrine. La littérature illustre des cas d'utilisation locale des feuilles de cette plante contre la gale, les hémorroïdes et les furoncles. Nous rapportons deux cas de brûlures chimiques par le laurier rose ...

  18. Le Peer to Peer: Vers un Nouveau Modèle de Civilization

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu'il s'agit d'une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d'un nouvel imaginaire social, et possède le potentiel de devenir le pilier d'un nouveau mode d'économie politique, voire d'un nouveau type de civilisation. Pour cela, nous allons d'abord définir le P2P, décrire en bref ces manifestations, et le différencier d'autres modalités d'échange intersubjectif tel que le marché, la hiérarchie, l'économie du don.Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n'est ni géré par un mode hiérarchique ou par l'état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun.Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l'échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding.En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants.

  19. Savoir gérer le mal

    Directory of Open Access Journals (Sweden)

    Michel Maffesoli

    2015-09-01

    Full Text Available Le sens commun, conservatoire immémorial de la sagesse humaine « sait », de savoir incorporé, que le mal, l’ombre, la mort, la douleur sont des caractéristiques essentielles de l’existence en son entièreté. Dès lors les créatures quelles qu’elles soient, sont des manifestations de la vie et, dès lors, méritent une attitude « compassionnelle », fraternelle, parce qu’ensemble elles constituent le flux vital. C’est ainsi que l’on peut comprendre l’utilité sociale de ces divers « mondes intermédiaires » que sont les croyances, religieuses ou philosophiques, au « double », au « daimon », aux esprits et autres figures tutélaires ou effrayantes. Elles aident à vivre, au jour le jour, la souffrance en la communalisant.

  20. Le tourisme alpin

    Directory of Open Access Journals (Sweden)

    Andrea Macchiavelli

    2009-06-01

    Full Text Available La forte croissance qu’ont connue les pays alpins dans les dernières décennies a surtout été fondée sur l’offre des activités du ski, avec comme conséquence, un massif développement immobilier, la multiplication d’infrastructures et l’extension des domaines. Aujourd’hui, le marché du ski semble arriver à saturation, la Convention alpine a mis un frein à la poursuite du développement des domaines skiables et on observe donc avec intérêt la diversification de l’offre soutenue par l’innovation. Après avoir rappelé les facteurs de changement en cours les plus significatifs dans le tourisme montagnard, l’article présente une grille interprétative de l’évolution des destinations touristiques alpines, identifiant les phases qui ont caractérisé son développement. Puis il propose une réflexion sur certaines conditions qui peuvent favoriser l’innovation dans le tourisme alpin, ainsi que sur les contradictions qui les accompagnent souvent. Dans la plupart des cas l’innovation est le résultat d’un processus qui a été lancé et qui s’est développé au sein de la communauté alpine, souvent favorisé et soutenu par des institutions nationales et internationales, et grâce auquel les difficultés structurelles qui ont déjà été abordées précédemment ont pu être surmontées avec succès.The spectacular increase in tourism in the Alps in recent decades has been founded mainly on the boom in skiing, resulting in both strong real estate development and an increasing array of infrastructures and ski runs. Today the ski market seems to have virtually reached saturation point and the winter sports sector needs to diversify its offer through innovation. After a review of the main factors of change in mountain tourism, the paper presents a grid for interpreting the life cycle of alpine destinations, identifying the phases that characterize their evolution. The conditions that may favour innovation in alpine

  1. Kyste hydatique du foie rompu dans la paroi abdominale et dans le muscle psoas: a propos d�une rare observation

    Directory of Open Access Journals (Sweden)

    Issam En-Nafaa

    2011-09-01

    Full Text Available Le kyste hydatique du foie est une parasitose qui sevit a l'etat endemique au maroc. La rupture dans la paroi abdominale et dans le psoas est une complication exceptionnelle. Nous rapportons un cas de kyste hydatique du foie rompu dans la paroi et dans le muscle psoas. Le diagnostic a ete etabli sur les donnees de l'echographie et surtout de la tomodensitometrie. Le patient a ete opere avec des suites simples.

  2. Le gouvernement Mansard

    OpenAIRE

    Curton, Émile de

    2013-01-01

    Le fait même de sa nomination au poste de Gouverneur allait donner au conflit qui opposait Mansard au docteur Alain toute sa dimension. Le Médecin-chef et ses complices avaient manqué leur premier objectif : remettre en cause le ralliement de la colonie avant le départ du Gouverneur de Géry. Toutefois, ils jugeaient toujours possible de saper l’autorité encore fragile du nouveau gouverneur en la contestant. Dans ce but, le chef du service de santé prenait, dès le 15 septembre, une double init...

  3. Le survivant sans le syndrome Schreber

    Directory of Open Access Journals (Sweden)

    Richard Figuier

    2006-09-01

    Full Text Available On a pensé la catastrophe, mais a-t-on suffisamment pensé la survivance et la figure du survivant ? Ce n'est pas un hasard si celle-ci est au centre de Masse et puissance, oeuvre dans laquelle Canetti interroge la « mauvaise » survivance responsable de la poursuite de la logique de guerre. Mais où trouver la « bonne » ? Revenir de la catastrophe ne suffit pas pour être un « survivant authentique », selon l'expression de Kafka. Il faut avoir dépassé, avec Primo Levi et Robert Antelme, l'opposition de la vie comme croissance continue et de la mort comme son horrible contraire, par le don, dans la pauvreté solidaire, de cette vie retrouvée.Hemos reflexionado acerca de la catástrofe, pero ¿hemos meditado lo suficiente sobre la supervivencia y el superviviente? No es una coincidencia si el superviviente es el tema principal de Masse et puissance, obra en la cual Canetti analiza la «mala» supervivencia responsable de la persistencia de la lógica de guerra ¿Dónde sin embargo podemos encontrar la «buena» supervivencia? Superar la catástrofe no es suficiente para ser un «auténtico superviviente», según Kafka. Es fundamental ir más allá, con Primo Levi y Robert Antelme, de la oposición entre la vida, como crecimiento continuo, y la muerte, como su espantoso contrario, mediante la donación de forma solidaria de esta vida reencontrada.Disaster is the theme of many studies, but what about survival and of the figure of the survivor? This issue is central in Mass and power, work in which Canetti questions the “bad” survival, responsible for the continuation of the logic of war. But is there any “good” survival? Coming back from the catastrophe is not enough to be an “authentic survivor”, according to Kafka’s expression. To achieve this, it is necessary to have exceeded, with PrimoLevi and Robert Antelme, the opposition of life as a continuous growth and of death as its horrible opposite, by the gift, in a

  4. Étude ethnobotanique des plantes médicinales utilisées dans le ...

    African Journals Online (AJOL)

    SARAH

    31 mai 2017 ... 2017 Étude ethnobotanique des plantes médicinales utilisées dans le traitement du diabète dans le Département de Zouénoula (Côte d'Ivoire). 11258. Keywords: Ethnobotanical survey, medicinal plants, diabetes, Zouenoula. INTRODUCTION. Le diabète est une affection chronique plurifactorielle.

  5. Liens entre le savoir et l'innovation dans les services de gestion des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Extrants. Documents. Linking knowledge to innovation in government services: the case of solid waste services in local government in Sri Lanka (K2I Project). Téléchargez le PDF. Rapports ... GrowInclusive : la plateforme tant attendue est en construction. Le CRDI, en partenariat avec le Forum économique mondial, ...

  6. : tous les projets | Page 112 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le programme de recherche Croissance de l'économie et débouchés économiques des femmes (CEDEF) est une initiative de collaboration entre le CRDI, le Department for International Development du Royaume-Uni et la Fondation William et Flora Hewlett. Région: South Asia, North of Sahara, South of Sahara, United ...

  7. Le coeur pulmonaire chronique. A propos de 35 cas colliges à la ...

    African Journals Online (AJOL)

    %), l'asthme (28,6%), la bronchite chronique (20,0%), le tabac (8,6%) et la tuberculose (14,3%). Conclusion : Le CPC est relativement peu fréquent dans notre milieu. La lutte contre l'obésité et le tabagisme, un suivi régulier des BPCO et un ...

  8. Le Programme de soutien à la formation envisage la création de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 mai 2016 ... Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la ...

  9. Le modèle fédéral dans le sport français, un principe fondateur dépassé ?

    Directory of Open Access Journals (Sweden)

    Béatrice Barbusse

    2009-06-01

    Full Text Available Dans le sport français, le fédéralisme s’est installé comme une évidence institutionnelle dès la fin du 19e siècle et le début du 20e siècle dans un pays qui pourtant ne se pense pas fédéral. En outre, si son apparition est liée à l’émergence du sport comme nouvelle pratique sociale à côté d’autres pratiques physiques plus traditionnelles, il s’est rapidement imposé comme la pierre angulaire de l’ordre sportif français. Près d’un siècle plus tard, son monopole institutionnel est bousculé voire «concurrencé». Ces constats d’ensemble nous amènent à nous interroger sur les raisons pour lesquelles le sport a épousé le modèle fédéral dans un pays non fédéral, mais aussi sur ses limites actuelles. Est-il encore le modèle approprié aux circonstances contemporaines ? A-t-il toujours sa place dans le système de gouvernance du sport ? Ou bien, a contrario, reste-t-il le dernier rempart légitime face aux excès du sport contemporain (dopage, violence, corruptions, déficits… ? À partir d’une approche socio-historique, il s’est agi dans cet article de reconstruire le fil de la généalogie du fédéralisme sportif tout en s’interrogeant sur ses perspectives. Au delà de la question du fédéralisme, c’est bien celle de la gouvernance du sport contemporain qui est posée.

  10. La lipogenèse chez le lapin. Importance pour le contrôle de la teneur en lipides de la viande

    OpenAIRE

    Gondret, Florence

    1999-01-01

    La teneur en lipides d’un tissu est la résultante de plusieurs flux métaboliques (dépôt, synthèse, utilisation). Cet article présente les principales caractéristiques de la synthèse des lipides chez le lapin, dans le muscle comparativement aux tissus adipeux visibles et au foie. Le potentiel de synthèse de novo exprimé par le muscle augmente avec l’âge de l’animal, en parallèle à l’accumulation des triglycérides dans les adipocytes intramusculaires. L’activité des enzymes qui fournissent le N...

  11. AcEST: BP920592 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Pasteur... 36 0.14 sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE... 36 0.14 sp|P53352|INC...D 862 >sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE=3 SV=3 Le

  12. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  13. AcEST: DK949890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le

  14. AcEST: DK947961 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria

  15. Le pilotage du changement dans le secteur bancaire Cas pratique banque de l'agriculture et développement rural BADR/BANK

    OpenAIRE

    Touami, Zouaoui

    2014-01-01

    Notre projet s'articule sur l'étude du pilotage de changement dans le secteur bancaire.Le premier chapitre détermine le rapport entre le changement et l'identité de l'entreprise, le deuxième chapitre portera sur le processus du changement.changement. A travers le troisième chapitre on va aborder la notion du pilotage stratégique du changement, le quatrième chapitre est réservé à l'étude du management opérationnel du changement.Le cinquième chapitre sera porté sur la définition du changement s...

  16. Le point de vue d’une historienne

    OpenAIRE

    Gavignaud-Fontaine, Geneviève

    2013-01-01

    Alors que le citoyen et le consommateur interrogent les modes de production agricole, l’agronome est confronté, à travers ses engagements et ses responsabilités, au sens de sa mission. Or l’histoire de sa discipline révèle la permanence des confrontations et la virulence des engagements. Mais comment peut-il faire face à cette histoire ? L’agriculture biologique, en refusant d’utiliser des intrants chimiques, est un exemple d’actualité qui trouve ses racines dans un débat beaucoup plus ancie...

  17. galaxieEST: addressing EST identity through automated phylogenetic analysis.

    Science.gov (United States)

    Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M

    2004-07-05

    Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and

  18. Publications | Page 118 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'argent fait peut-être tourner le monde, mais c'est le café qui le fait démarrer. En 2003, quelque 6 millions de tonnes de café ont été récoltées, torréfiées et consommées dans le... L'agrobiodiversité au Népal, une assurance judicieuse. Hors du champ de l'appareil photo, des voix la taquinent, mais, une main sur la hanche ...

  19. Florencia Ballarino | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    J'ai toujours été très curieuse. Depuis mon enfance, j'aime lire sur les sujets scientifiques. Mais lorsqu'est venu le temps de choisir un domaine d'étude, j'ai opté pour la littérature et le journalisme. Mes parents travaillaient tous deux dans le domaine scientifique, alors j'ai voulu me démarquer. Peu après le début de mes ...

  20. Michaux, «Le Jardin Exalté»

    OpenAIRE

    Vera Lúcia de Carvalho Casa Nova

    2011-01-01

    Resumo: Esse ensaio resulta de uma leitura do texto de H. Michaux, focalizando a relação entre as artes na escritura desse autor.Palavras-chave: Literatura francesa; Henri Michaux; Le Jardin Exalté; artes.Résumé: Cet essai est le résultat d’une lecture qui montre les relations entre les arts dans l’écriture Henri Michaux.Mots-clés: Littérature française; Henri Michaux; Le Jardin Exalté; arts.Keywords: French literature; Henri Michaux; Le Jardin Exalté; arts.

  1. Michaux, «Le Jardin Exalté»

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Carvalho Casa Nova

    2011-10-01

    Full Text Available Resumo: Esse ensaio resulta de uma leitura do texto de H. Michaux, focalizando a relação entre as artes na escritura desse autor.Palavras-chave: Literatura francesa; Henri Michaux; Le Jardin Exalté; artes.Résumé: Cet essai est le résultat d’une lecture qui montre les relations entre les arts dans l’écriture Henri Michaux.Mots-clés: Littérature française; Henri Michaux; Le Jardin Exalté; arts.Keywords: French literature; Henri Michaux; Le Jardin Exalté; arts.

  2. Le marketing cherche ses marques

    OpenAIRE

    Hentschel, Dieter

    2018-01-01

    Voici maintenant dix ans que, dans le cadre d’une politique continue de diversification des formations offertes aux germanistes, l’IAA a mis en place un enseignement de marketing. Cette innovation n’est pas restée sans suite, puisqu’elle a abouti au repositionnement du DESS « économie et Société dans les pays de langue allemande » qui s’appelle désormais « Gestion et marketing franco-allemands ». L’objectif a été de proposer aux étudiants une formation professionnalisante qui corresponde aux ...

  3. L'hepcidine, le chef d'orchestre de l'homéostasie du fer

    OpenAIRE

    Nicolas, Gaël

    2009-01-01

    Dans un organisme en bonne santé le fer est en mouvement permanent entre les sites où il est absorbé (le duodénum), où il est utilisé (principalement la moelle osseuse) et où il est stocké (le foie et la rate). L'homéostasie de ces mouvements de fer repose sur le contrôle strict de plusieurs paramètres tels que l'absorption intestinale du fer, son utilisation pour l'érythropoïèse, le recyclage du fer à partir des globules rouges défecteux ou en fin de vie et enfin la bonne gestion des stocks ...

  4. Le voyageur et le touriste

    Directory of Open Access Journals (Sweden)

    André Rauch

    2011-06-01

    Full Text Available Les guides qui paraissent dans la première moitié du XIXe siècle, en langue allemande, anglaise et française, ont introduit des usages. Ils ont défini une manière de voyager, arrêté les itinéraires et indiqué les sites ou les lieux qu’il convenait de visiter. Lorsque paraissent les guides pour automobilistes au début du XXe siècle, la route permet d’autres formes de vagabondage, dont la gastronomie est un exemple illustratif. Dans les années soixante-dix, les nouveaux guides ont suscité d’autres curiosités, ils ont aussi indiqué au touriste les budgets qui leur permettraient de s’orienter dans la consommation touristique.Guides published during the first half of 19th century, in German, English and French languages have introduced some customs. They have defined a way of travelling, made up the routes and indicated the places and settings one has to visit. When guides for motorists are published at the beginning of the 20th century, the road allows other forms of wandering, among which gastronomy is an illustrative example. During the seventies, the new guides aroused other curiosities, they also indicated to the tourists the budgets that would allow them to find their way inside tourist consuming.

  5. Le vide univers du tout et du rien

    CERN Document Server

    Diner, Simon

    1997-01-01

    Pourquoi l'Univers plutôt que le vide ? Le temps et l'espace existent-ils en l'absence de l'Univers ? Que reste-t-il quand tout est enlevé ? Pourquoi quelque chose plutôt que rien ? Depuis des siècles, ces interrogations mobilisent philosophes et physiciens. Mais aujourd'hui, le vide n'est pas le rien. Il serait même l'acteur central de l'histoire de la matière et de l'Univers, le partenaire privilégié de la physique. Vide et matière ne sont plus deux manifestations séparées de la nature, mais deux aspects d'une même réalité. Le vide est l'état de base dont la matière émerge, sans couper son cordon ombilical Le vide comme Univers du rien cède la place au vide comme Univers du tout. Que le vide puisse être conçu par les physiciens comme réservoir potentiel d'univers, voici qui ne devrait laisser personne indifférent. Ce livre ouvre un débat et nous convie à une réflexion surprenante.

  6. Lele médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines et le roulement du personnel

    Directory of Open Access Journals (Sweden)

    Emmanuel Nwahanye

    2016-09-01

    Full Text Available Ce travail évalue empiriquement lele médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines (GRH et le roulement du personnel mis en évidence par de nombreux modèles de départ d’employés. Il est conduit sur un échantillon de 73 institutions financières en activité au Cameroun et fait appel à la méthode causale d’analyse des effets médiateurs adaptée du modèle de Baron & Kenny (1986. Les résultats assortis des régressions montrent, d’une part, que la satisfaction est un médiateur partiel dans le lien entre l’intensité de la GRH et le taux de roulement volontaire. D’autre part, elle est un médiateur parfait dans le lien entre l’intensité de la GRH et la propension à quitter. Il recommande aux dirigeants d’accorder une attention particulière à la satisfaction au travail en matière de rétention du personnel.

  7. Le limus rédempteur de Andrej Tarkovski

    Directory of Open Access Journals (Sweden)

    Paolo Mottana

    2015-04-01

    Full Text Available Le cinéma de Tarkovski est riche de présences symboliques. L'essai rend, à travers le contact prolongé et fidèle aux différentes oeuvres du metteur en scène russe, la constellation de ses éléments archetipiques et de ses figures les plus significatives. Le dialogue terre-eau, le travail du feu, la récurrence de l'arbre, du bois, de l'enfance, le flux lent du temps, la phenomenologie poétique de la maison. Dans le cinéma de Tarkovski on se perd, son oeuvre, un vrai opus magnus alchimique, est un voyage dans la survivance d'un halètement mystique profondément incarné dans la matière terrestre. Son parcours circulaire, de l'arbre brûlé d'Ivan à ce qui renaît à la fin du Sacrifice miraculeusement, c'est une cheville fondamentale pour pouvoir expérimenter la puissance de l'imagination créatrice quand encore elle est l' expression d'une sensibilité inspirée à l'âme du monde".

  8. Ouganda | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le taux de pauvreté en Ouganda est en baisse. Toutefois, cette tendance positive est ralentie par des sécheresses extrêmes, des conflits régionaux, une pauvreté croissante dans le nord du pays et la hausse des inégalités.

  9. Les enjeux du modèle standard

    CERN Document Server

    CERN. Geneva

    2008-01-01

    Toute la matière visible dans l'Univers est décrite par le « Modèle Standard ». Selon cette théorie, la matière est constituée d'atomes, qui contiennent des électrons orbitant autour de noyaux, dont les composants fondamentaux sont les quarks. Quatre forces fondamentales agissent entre ces particules élémentaires : les forces électromagnétique est gravitationnelle, et les interactions nucléaires forte et faible. La description fournie par le Modèle Standard de ces particules et de leurs interactions est en parfait accord avec les expériences. Néanmoins, des questions fondamentales restent sans réponse jusqu'à maintenant : d'où vient la masse des particules ? Pourquoi y a-t-il tant de types de particules ? Existe-t-il une théorie unifiée de toutes les interactions ? Quelle est la nature de la matière cachée prédite par les astrophysiciens ? Le LHC au CERN donnera des éléments de réponse à ces questions au-delà du Modèle Standard.

  10. La place de l'imagerie par résonance magnétique dans le ...

    African Journals Online (AJOL)

    Le diagnostic paraclinique est basée sur le couple écho-mammographie a la recherche de multifocalité, multicentricité ou bilatéralité, d'où l'intérêt de l'IRM qui est la technique la plus sensible pour la mise en évidence de ces lésions et qui est devenue un examen de pratique courante dans le carcinome lobulaire du sein.

  11. Bonheur et progrès : mesurer le bien-être au Bhoutan et au Canada ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    31 janv. 2011 ... Mesurer le bien-être. Au Bhoutan, ce tableau de bord porte un nom plein de charme. C'est le bonheur national brut (BNB). Le royaume est-himalayen, bouddhiste, compte environ 800 000 sujets. Enclavé entre les deux pays les plus populeux de la planète, il vient de mettre fin au long isolement qu'il s'était ...

  12. Économie | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Colour. #2C81B5. Le G8 (Allemagne, Angleterre, Canada, États-Unis, France, Italie, Japon, Russie et Union européenne) est aujourd'hui le principal vecteur politique de la mondialisation. Il est également la force politique qui soutient le plus fermement les institutions multilatérales façonnant la gouvernance économique ...

  13. Développement d'un nouveau modèle pour la simulation en continu ...

    African Journals Online (AJOL)

    Hamouda

    conformément à l'organigramme général de la figure 6. Enfin, pour des besoins de convergence du schéma explicite de résolution et d'adéquation avec les modèles d'hydrologie urbaine. (assainissement pluvial), le pas de temps pris, est le plus fin possible. En hydrologie urbaine, le pas de temps des simulations est de ...

  14. Processus de construction de la confiance et configuration de contrôle de gestion

    OpenAIRE

    Khlif, Wafa

    2000-01-01

    International audience; L'enrichissement de la compréhension du contrôle de gestion par une dimension plus “humaine” a conduit naturellement à l'émergence de concepts “qualitatifs”. La confiance fait partie de ces concepts ignorés dans un contexte instrumental. L'objectif de cette recherche est d'analyser le processus de construction de la confiance relativement aux éléments de contrôle de gestion. En premier lieu, ce travail discute le lien entre le contrôle de gestion et la confiance dans l...

  15. Le kyste de la vallecule : a propos de 2 observations | Hariga ...

    African Journals Online (AJOL)

    Le kyste de la vallecule : a propos de 2 observations. I Hariga, A Mardassi, S Zribi, A Charfeddine, M Amor, O Gamra, C Mbarek, A El Khedim. Abstract. Le kyste de la vallécule est une malformation laryngée rare pouvant parfois mettre en jeu le pronostic vital. Diagnostiqué et traité à temps, le risque de complications et de ...

  16. Le Cercle de vie : l'agriculture biologique au Mexique | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 juil. 2011 ... Le marché, Le Círculo de producción y consumo responsable [le Cercle de production et de consommation responsables] est un projet local du Collectif écologique du Jalisco créé il y a 15 ans. Le Círculo s'inspire des anciens tíanguis mexicains, ces lieux d'échange de produits alimentaires et d'idées ...

  17. Le commentaire de cartes et la «nouvelle géographie»

    Directory of Open Access Journals (Sweden)

    Alain REYNAUD

    1987-06-01

    Full Text Available Les cartes topographiques intéressent le public et attirent l'attention des penseurs, car elles constituent un support aussi bien pour le raisonnement et le rêve que pour l'action. Au même moment, le commentaire de cartes est remis en question parmi les géographes; mais il peut garder sa place à la condition d'affûter ses outils conceptuels et de diversifier ses thèmes.

  18. le des mitochondries dans les voies immunitaires innées | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet est dirigé au Canada par l'Institut neurologique de Montréal (Université McGill) en collaboration avec le Weizmann Institute (Israël), l'Universidad Andres Bello (Chili) et le National Institute of Biological Sciences (Chine). Ce projet et son financement ont été approuvés par le deuxième concours de recherche du ...

  19. Lele des associations  dans la médiation en archéologie

    OpenAIRE

    Sence, Christophe

    2014-01-01

    Le milieu associatif est connu en France pour son dynamisme et sa réactivité. Il en va de même en archéologie, notamment dans le domaine de la médiation. Si le public ignore bien souvent qu’une association se cache derrière le lieu qu’il vient de visiter, nombreux sont les sites archéologiques, toutes périodes confondues, dont la mise en valeur est entièrement assumée par une telle structure. Dans ce cadre, tout est envisageable, de la simple ouverture pendant les Journées européennes du patr...

  20. AcEST: DK956296 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PIRVV Pre-glycoprotein polyprotein GP complex OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) Align le...30 7.7 >sp|Q8B119|GLYC_PIRVV Pre-glycoprotein polyprotein GP complex OS=Pirital virus (isolate Rat/Venezue...la/VAV-488/1995) GN=GPC PE=3 SV=1 Length = 510 Score = 32.0 bits (71), Expect = 2.6

  1. Le citoyen rieur

    Directory of Open Access Journals (Sweden)

    Anna Rycman

    2009-11-01

    Full Text Available Dans la Pologne d’aujourd’hui, l’évolution des modèles d’engagement civique et politique s’opère plus particulièrement auprès des jeunes générations. Parmi les expériences nouvelles de participation politique, les nouvelles technologies de l’information et de la communication offrent des opportunités radicales de reconfigurer l’espace public. La jeunesse polonaise investit en masse le Web. Dans le flux de paroles affranchies circulant et dialoguant dans le cyberespace, nous nous intéressons ici au développement d’un discours qui emprunte au registre de la dérision et de la satire politiques. Une multitude de sites critiques, de nature apparemment contestataire, des sites d’opposition fondés sur le genre satirique, ont émergé comme réponse apportée à la situation politique. Cet espace public électronique représente une forme moderne de « folklore politique », contribuant au processus de socialisation des jeunes citoyens polonais.The laughing citizen. A modern form of civic commitment in democratic Poland?In present day Poland, the evolution of civic and political commitment models is above all the affaire of the younger generations. Among the current opportunities for political participation, the new information and communication technologies offer radical opportunities to reconfigure the public arena. Polish youth are flocking to the Web. Amongst the flux of frank points of views circulating and dialoguing in cyberspace, our interest here is the development of a discourse inspired by political and satirical derision. A multitude of critical, apparently anti-establishment, sites and general opposition sites using the satirical style have emerged as a response to the political situation. This public electronic space represents a modern form of « political folklore », contributing to the socialising processes of young polish citizens.El ciudadano que rie. ¿Nueva forma del compromiso cívico en la

  2. Le theatre d'Afrique noire francophone: un art tourne vers le ...

    African Journals Online (AJOL)

    Cette étude a pour objectif de porter un regard analytique sur le théâtre d'Afrique noire francophone, depuis les années d'indépendances jusqu'à nos jours, afin de mettre en relief sa contribution au développement du continent. Il est à remarquer, en effet, que ce théâtre, dans son cheminement, est essentiellement un ...

  3. Projet pilote pour le programme national de recherche et de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'idée d'un programme national de recherche et de formation (PRIDE en espagnol) est issue du projet Mise en place de systèmes d'apprentissage au Honduras (projet 100133), soutenu par le CRDI. La subvention est accordée pour appuyer une version pilote de PRIDE, reposant sur deux appels à propositions.

  4. Le cosmos et le lotus confessions d'un astrophysicien

    CERN Document Server

    Trinh, Xuan Thuan

    2011-01-01

    Que nous dit vraiment la science sur la nature de l'univers, sur son origine et son avenir ? Par quel mystère le langage mathématique, pure création de l'esprit humain, se révèle-t-il aussi performant pour nous décrire les phénomènes physiques, de l'infiniment petit à l'infiniment grand ? S'il existe un ordre du monde, ce que nous en disent la physique quantique et la théorie de la relativité est-il compatible avec ce qu'enseigne le bouddhisme ? Et que peut-on en conclure concernant notre propre vie ? A ces questions passionnantes et à beaucoup d'autres, le célèbre astrophysicien Trinh Xuan Thuan répond ici d'une façon personnelle, en s'appuyant sur son expérience. Son itinéraire l'a placé d'emblée à la confluence de trois cultures : issu d'une famille de lettrés vietnamiens imprégnée de traditions bouddhiste et confucéenne, il a reçu une éducation à la française puis une formation scientifique à l'américaine. Une telle richesse de points de vue lui permet d'apporter, non pas de...

  5. Le devenir actif du corps affectif

    Directory of Open Access Journals (Sweden)

    Pascal Séverac

    2005-09-01

    Full Text Available Le but de cet article est de saisir ce que signifie, pour le corps, être actif. À partir de la proposition 49 de la partie IV de l’Éthique, on propose de distinguer deux manières d’appréhender le corps – soit comme corps organique, soit comme corps affectif -, et l’on montre que la question éthique du devenir actif s’adresse à la dimension affective du corps. Il faut penser le devenir actif du corps affectif comme augmentation de son aptitude non seulement à affecter, mais aussi à être affecté. En effet, être affecté pour le corps n’est pas identique à pâtir : au contraire, plus est grande l’ouverture sensible d’un corps aux autres corps, plus est grande son activité éthique.The aim of this paper is to understand how the body can be active. With the proposition 49 of the fourth part of Ethics, two ways of conceiving of the body are distinguished : like an organic body or like an affective body. The ethics question of becoming active is about the affective body. This becoming active must be understood as increasing of the ability to affect, as well as to be affected. To be affected is different from to be passive. On the contrary, the more the body is able to be affected, the more he becomes active.

  6. L'astronomie dans le monde

    OpenAIRE

    Manfroid, Jean

    2004-01-01

    comètes en pagaille; Recherche d'astéroïdes; Voisinage galactique; Titan en X; Titan à haute résolution; Alignement parfait dans le Sagittaire; Où est la lune de Sedna; SgrA*; Première image d'une planète extrasolaire?; Deux Jupiter chauds; Cycles stellaires; Le trou noir de M87; Un nouveau bras pour la Voie LactÃée; L'étoile la plus massive jamais observée!

  7. Transport de particules massives dans un fluide turbulent: Application a l'erosion due au sable sur les parois d'une turbine hydraulique

    Science.gov (United States)

    Bergeron, Stephen

    Le transport de particules massives par un champ turbulent est un vaste domaine de la mécanique des fluides. Il possède de nombreuses applications comme par exemple le transport de sable dans une turbine hydraulique. En raison de la dureté des grains de quartz et des grandes vitesses de collision avec les parois métalliques, un phénomène d'érosion intensif se produit. Les dommages résultants peuvent diminuer le rendement de la turbine au cours des quelques mois suivant la mise en opération. L'objectif de cette thèse est de mettre au point un outil permettant de prédire ces zones d'érosion. Ce projet de recherche en contexte industriel a été réalisé en collaboration avec la compagnie General Electric Hydro du Canada. Dans un régime hautement turbulent, il est possible d'obtenir une expression suffisamment générale en utilisant une formulation partiellement empirique: l'équation de Basset- Boussinesq-Oseen modifiée. Ce choix de modèle tient compte du niveau de précision recherché et de la méthode numérique employée afin de résoudre la phase fluide. Il permet aussi d'éliminer plusieurs ambiguïtés fréquemment rencontrées dans la littérature et implementées dans certains codes commerciaux courants. La formulation mathématique du problème est effectuée dans un espace mixte Euler-Lagrange. Les paramètres dynamiques sont relies au type de particules et à l'intensité de la turbulence. Le code numérique résultant est le plus performant développé à ce jour (août 1998). Les trajectoires de plusieurs centaines de milliers de particules peuvent être simulées et visualisées de manière interactive sur une station de travail (SGI R4K, R8K et R10K). L'utilisateur du logiciel est libre de se déplacer dans l'espace à l'aide d'un environnement similaire a un ``simulateur de vol''. Il peut ainsi analyser les détails du processus d'érosion de même que l'écoulement du fluide dans la turbine. Les zones d'érosion obtenues à l

  8. Sur le volume élémentaire représentatif de la loi de perte de charge d'Ergun On the Representative Elementary Volume of the Ergun's Law

    Directory of Open Access Journals (Sweden)

    Herrmann H. J.

    2006-12-01

    Full Text Available Diverses expressions permettent de calculer la perte de charge occasionnée par le passage d'un fluide visqueux incompressible en écoulement à travers un milieu granulaire. Ces lois ont toutes une origine phénoménologique et sont obtenues à partir d'expériences réalisées à une échelle macroscopique. L'une d'entre elles, la loi d'Ergun, est couramment utilisée sous une forme locale dans des modèles de couplage fluide-solide pour réaliser le transfert de quantité de mouvement entre les deux phases sans réelle justification. Dans cet article, la simulation numérique directe des équations de Navier-Stokes est utilisée pour calculer les pertes de charge de fluide visqueux incompressible en écoulement à travers un milieu granulaire. Des simulations effectuées pour différents volumes de matériau granulaire permettent de retrouver la loi de perte de charge d'Ergun, de définir un volume élémentaire représentatif et de prouver le caractère local de cette loi. Several expressions can be used to predict the pressure drop caused by a viscous incompressible fluid flow through a granular media. These laws are empiricals and are obtained at macroscopic scale. One of these, Ergun's law, is currently used in a local form to modelling the momentum transfer between fluid and solid. There is not a real justification. In these study, the direct simulation of Navier-Stokes Equation is used to calculate pressure drop caused by viscous incompressible fluid flow through a granular media. Some simulations realised for different volume of granular media allow to find a representative elementary volume and prove the local character of the Ergun's law.

  9. Le rapport Coopération pour le développement de l'OCDE souligne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    est exclu, l'appel visant à combler la fracture des données est devenu le principal enjeu du Programme 2030. Les données et les statistiques sont essentielles pour éclairer les décisions relatives aux politiques, et l'adoption ...

  10. Samson le nazir : un mythe du jeune guerrier

    OpenAIRE

    Lemardelé, Christophe

    2010-01-01

    L’histoire de Samson reste énigmatique tant pour son origine que pour sa signification. Il apparaît que le récit doit être qualifié de récit héroïque ou de mythe. En effet, Samson est typique de la figure du héros, qu’il s’agisse d’Héraklès comme de Gilgamesh : c’est à l’origine un demi-dieu accumulant les fautes. Il est contestable d’affirmer que le récit est grec car on retrouve dans le texte des motifs propres aux guerriers du livre des Juges et des livres de Samuel. Parmi les titres du hé...

  11. Bruno Milly, Le travail dans le secteur public. Entre institutions, organisations et professions

    OpenAIRE

    Hély, Matthieu

    2012-01-01

    L’intérêt principal de l’ouvrage de Bruno Milly est de mettre en évidence les limites d’une analyse du travail dans le secteur public qui se limiterait à l’appréhender uniquement à partir de son cadre institutionnel et normatif, un peu à la manière de la « science administrative » qui essentialise certainement un peu trop le travail public par rapport au travail dans le secteur marchand. En effet, si la sociologie du travail et des organisations s’est intéressée aux métiers de l’État social, ...

  12. Le merveilleux dans le roman algérien de langue arabe

    OpenAIRE

    Daoud, Mohamed

    2013-01-01

    L’étude essaie de définir le merveilleux, en tant qu’aspect littéraire introduit dans le romanesque en passant par Freud, Todorov, Caillois, Caxtex, Steinmetz, qui donnent une définition très poussée du fantastique, qui est différent du merveilleux. Mais c’est à Todorov que l’étude consacre la plus grande partie de l’analyse du merveilleux ; elle essaie de compléter cette réflexion par d’autres apports théoriques. Et dans la perspective de l’étrangeté, du surnaturel qu’aborde l’étude, le text...

  13. Quel est l'impact de l'indice de masse corporelle pré-gestationnel insuffisant et d'une prise de poids gestationnelle inférieure à la norme, notamment chez les femmes souffrant d'anorexie, sur le poids de naissance de l'enfant et la prématurité: travail de Bachelor

    OpenAIRE

    De Freudenreich, Emilienne; Wicht, Aline; Kaiser, Barbara

    2014-01-01

    Introduction : Des préoccupations autours de poids sont présentes lors de grossesse chez beaucoup de femmes, notamment chez celle qui souffrent de troubles alimentaires. L’obésité et la prise de poids gestationnelle excessive sont aujourd’hui des problèmes de santé dont les conséquences sont bien connues tandis que les effets des phénomènes inverses restent ambigus. Objectif : le but de cette revue de littérature était de mettre en évidence les effets du souspoids pré-gestationel et de la fai...

  14. Intelligence artificielle et agents collectifs : le modèle EUROSIM

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    2007-07-01

    Full Text Available EUROSIM est un modèle multi-agents conçu pour simuler l’évolution à moyen terme du système des villes européennes. Les agents sont des entités collectives, les grandes villes caractérisées par leur taille et leur fonction dans le système des villes, et dont les interactions (échanges modulés par des relations de proximité ou de réseau déterminent la dynamique relative, tandis que la croissance d’ensemble dépend de l’innovation. Des outils d’analyse multiscalaire ont été développés afin d’interpréter les sorties du modèle et faciliter le calibrage.

  15. Luther contre le protocole de Kyoto ou le retour des « indulgences ».

    Directory of Open Access Journals (Sweden)

    Bernard Jouve

    2005-05-01

    Full Text Available Le 16 février 2005 a marqué la mise en œuvre du Protocole de Kyoto. En fait, depuis l’annonce par la Russie, le 25 octobre 2004, de sa décision de ratifier ce protocole, l’affaire était entendue. Menacé depuis le refus des États-Unis, l’un des plus grands pollueurs de la planète, de ne pas le ratifier pour des raisons purement économiques alors que ce pays produit à lui seul 40 % des gaz à effet de serre ( ges , l’accord survenu à Kyoto en 1997 est enfin entériné et ...

  16. Le corps dans l’espace architectural. Le Corbusier, Claude Parent et Henri Gaudin

    Directory of Open Access Journals (Sweden)

    Julie Cattant

    2016-12-01

    Full Text Available Le premier geste de l’espace architectural est d’accueillir nos corps humains. En leur offrant un espacement à habiter, il leur permet de s’abriter, de se mouvoir et de se rencontrer. L’homme et l’architecture s’affectent l’un l’autre. Nombreux sont les architectes qui interrogent cette coexistence car, renouveler la pensée de l’espace nécessite de reconsidérer le corps humain. L’étude des relations entre le corps et l’espace chez trois architectes français sera l’occasion d’évoquer les écarts et les convergences entre l’homme et l’architecture. L’œuvre de Le Corbusier, protagoniste du mouvement moderne, maintient ainsi une distance entre un corps machinisé et un espace idéal. Marquée par un mode de pensée dualiste, l’architecture de Le Corbusier annonce toutefois son propre dépassement, dépassement que Claude Parent et Henri Gaudin opèreront par la suite à leur manière, le premier en introduisant l’oblique et la déstabilisation du corps, le second en transgressant la limite de l’espace et du corps pour envisager leur porosité réciproque. Finalement, c’est la manière dont l’homme appréhende l’espace avec son corps qui est questionnée par ces trois architectes, de la prégnance du visuel à son évincement.

  17. AcEST: BP914262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|Q8LE43|DOF21_ARATH Dof zinc finger protein DOF2.1 OS=Arabidop... 31 4.7 sp|P18102|TLL_DROME Protein taille...RNA domain-cont... 32 2.7 sp|Q9LSL6|DOF57_ARATH Dof zinc finger protein DOF5.7 OS=Arabidop... 32 2.8 sp|O16845|TLL_DROVI Protein tail...less OS=Drosophila virilis GN=tl... 31 3.6 sp|Q96QE4|LR37B_HUMAN Leucine-rich repea

  18. AcEST: BP921082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B Pol polyprotein (Fragment) OS=Cas-Br-E murin... 52 1e-06 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 52 1e-06 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation muri...LLLPLALYRARN 431 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 Le...N Sbjct: 75 ADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARN 132 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiati...on murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 Length = 581 Score = 52.0

  19. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  20. J.-M.-G. Le Clézio et le récit poétique

    Directory of Open Access Journals (Sweden)

    Pascal Rannou

    2009-11-01

    Full Text Available Dans Le Récit poétique (1978, J.-Y. Tadié analyse les caractéristiques d’un genre un peu marginal, qui ne tient ni du roman, ni de la nouvelle, et se signale par une conception originale de l’espace, du temps et du personnage. Si Tadié évoque les œuvres de Limbour, Gracq ou Mandiargues, il ne mentionne pas celle de Le Clézio. Or, l’écriture de ce dernier correspond souvent aux critères formulés dans son essai. Les personnages de Le Clézio sont souvent des « êtres de fuite », prétextes à rêverie géographique, des anti-héros, peu actifs, contemplatifs. Ce sont souvent des marginaux en rupture de ban avec la société. Le lieu du récit poétique est pour Tadié un lieu de rêve, éloigné de la fureur urbaine, et c’est souvent le cas chez Le Clézio. Ce dernier a également tendance à diluer le temps pour le faire tendre au mythe, en négligeant les références précises. Le temps du récit poétique est souvent celui de l’enfance, ce que corrobore aussi Le Clézio, notamment dans Mondo et La Ronde, qui forment notre corpus. L’écriture de ce type de récit est proche du poème en prose. Elle cultive les parallélismes et le travail sur le signifiant. Mais les récits poétiques de Le Clézio s’éloignent aussi des critères définis par J.-Y. Tadié. Les personnages n’y sont pas que des prétextes à rêverie, mais les victimes de rouages sociaux qui les écrasent : voleurs, orphelins, mères célibataires, travailleurs immigrés. Le récit poétique leclézien s’éloigne, par sa dimension politique et sociale, du récit poétique défini par Tadié, qui se caractérise par une certaine gratuité.

  1. EST databases and web tools for EST projects.

    Science.gov (United States)

    Shen, Yao-Qing; O'Brien, Emmet; Koski, Liisa; Lang, B Franz; Burger, Gertraud

    2009-01-01

    This chapter outlines key considerations for constructing and implementing an EST database. Instead of showing the technological details step by step, emphasis is put on the design of an EST database suited to the specific needs of EST projects and how to choose the most suitable tools. Using TBestDB as an example, we illustrate the essential factors to be considered for database construction and the steps for data population and annotation. This process employs technologies such as PostgreSQL, Perl, and PHP to build the database and interface, and tools such as AutoFACT for data processing and annotation. We discuss these in comparison to other available technologies and tools, and explain the reasons for our choices.

  2. Effets du charbon actif dans le milieu de culture sur l'induction de la ...

    African Journals Online (AJOL)

    antioxydant. Il est devenu une nécessité pour régler le problème d'oxydation qui est particulièrement épineux lors de la phase d'initiation de culture, où une oxydation rapide des méristèmes mises en incubation sur le milieu d'initiation est constatée.

  3. Le CRDI au Vietnam

    International Development Research Centre (IDRC) Digital Library (Canada)

    des agriculteurs trouvent des solutions de rechange à la culture du tabac. □ des responsables de politiques agissent pour réduire la pauvreté. Soutien accordé par le CRDI depuis 1991. 111 activités d'une valeur de 30 millions cad. CRDI. Le CRDI au Vietnam centre de recherches pour le développement international ...

  4. Comment ameliorer la selection et le traitement des messages verbaux? (How to Improve the Selection and Processing of Verbal Messages)

    National Research Council Canada - National Science Library

    Rivenez, Marie; Darwin, Chris; Guillaume, Anne

    2005-01-01

    L'objectif de cette recherche est d'ameliorer la selection des messages verbaux. Nous cherchons a determiner les facteurs influencant le traitement d'un message verbal lorsque l'attention est portee sur un autre message...

  5. Lele de l'IL6 dans le cancer du foie lié à l'hépatopathie métabolique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le cancer du foie est souvent mortel. Il n'existe que très peu d'options de traitement, et il s'agit de l'un des cancers dont l'incidence augmente dans le monde entier. L'obésité ou les maladies métaboliques (comme le diabète et la stéatose hépatique) constituent des facteurs de risque du cancer du foie qui sont mal compris.

  6. Le mal et ses complots imaginaires

    OpenAIRE

    Frankfurter, David

    2012-01-01

    Les récits d’abus rituels sataniques que les médias ont largement diffusés, aux États-Unis et au Royaume-Uni, entre le début des années 1980 et la fin des années 1990, soutenaient le parallèle avec les allégations avancées, durant l’Antiquité et au début des Temps modernes, contre les chrétiens, les hérétiques, les juifs ou les sorcières. Quelle est la nature de ces parallèles ? Cet article examine plusieurs types de modèles convoqués lors de diverses occurrences historiques des peurs panique...

  7. Le catch, la domestication du risque

    Directory of Open Access Journals (Sweden)

    Jeremy Lacoste

    2015-09-01

    Full Text Available Cet article vise à questionner les logiques de gestion, réappropriation et détournement du risque à travers le catch. Il s’appuie sur la monographie d’un club de la région parisienne observée durant huit mois. Parce que la discipline est à mi-chemin entre la sportivité théâtrale et la scénarisation pugilistique, elle pioche dans le registre de la représentation. Ainsi, art de la surenchère et du pastiche, le catch constitue un terreau majeur pour déconstruire les figures du risque.

  8. Farid Ameur, Le Ku Klux Klan

    OpenAIRE

    Laberge, Yves

    2018-01-01

    S’il existe de nombreuses études en anglais sur le Ku Klux Klan, et notamment celles — percutantes — de Stetson Kennedy (1916-2011), qui avait réussi à infiltrer cette organisation, on en trouve relativement peu en langue française. De ce fait, la réédition de cette monographie de l’historien Farid Ameur tombe à point nommé. Mouvement social d’extrême-droite prônant le racisme et la suprématie blanche, le KKK a une histoire secrète qui est de ce fait difficile à raconter de manière exhaustive...

  9. Comment fonctionne l’Univers ? Ce que le LHC peut nous apprendre

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    L'Univers en son enfance était une "soupe" de particules, de plus en plus chaudes (de plus haute énergie) à mesure qu'on remonte vers sa naissance, le "big bang". C'est ainsi que les observations à des énergies de plus en plus élevées nous permettent, par exemple, de nous approcher de plus près de la prime jeunesse de l'Univers et, donc, de mieux le comprendre. L'étude du macro- et du micro-cosme sont une science unique dans laquelle, de façon surprenante, ce que nous comprenons le moins bien est le vide, qui ne semble pas l'être: il existe une différence fondamentale entre le vide et le néant. Le LHC pourrait nous permettre de voir les vibrations de la "substance" du vide, qu'on appelle les particules 'de Higgs'.

  10. Identification de Staphylococcus aureus : est-il possible de réduire ...

    African Journals Online (AJOL)

    Dans le contexte de pays moins avancé comme le Bénin, cela est un premier jet en vue de l'efficience des méthodes de diagnostic au laboratoire d'analyses biomédicales. Mots-clés : staphylocoagulase libre, plasma de lapin, efficience. ABSTRACT. Objective: The high cost of lyophilized rabbit's plasma, which is used for ...

  11. Le harcèlement organisationnel des relations sous emprise

    CERN Document Server

    Guhel, Cécile

    2014-01-01

    Le lien entre harcèlement et emprise professionnelle est bien réel. Il est aussi puissant que destructeur. L'aide extérieure est importante mais la prise de conscience du sujet et sa mise à distance sont primordiales pour le retour à Soi. Un facteur de risque organisationnel est un facteur qui relève de l'organisation et qui comporte le risque ou la probabilité qu'un tel comportement abusif voie le jour et qu'il ait des effets négatifs. Un tel facteur peut également contribuer à la persistance ou à l'aggravation du comportement. En abordant la relation d'emprise sous l'éclairage de différentes théories psychologiques, cela vous permettra d'observer les mécanismes intrapsychiques conscients et inconscients qui sous-tendent les comportements de l'instigateur de la relation d'emprise d'une part, et de sa victime d'autre part. Enfin, à travers trois témoignages, de salariées en poste, vous découvrirez combien la parole sur le travail est importante dans la prise de conscience du processus de de...

  12. La responsabilité de rendre compte : lele des médias dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    28 janv. 2011 ... Au Darfour, il se produit la même chose qu'au Rwanda, mais au ralenti, prévient Allan Thompson. Les médias ne sont pas là, ils n'ont pas - ou ne veulent pas affecter - les ressources nécessaires pour couvrir de façon systématique les événements qui s'y déroulent. C'est loin, c'est difficile, comme le sont ...

  13. Le stéréotype dans le roman policier

    Directory of Open Access Journals (Sweden)

    Marion François

    2009-12-01

    Full Text Available Le roman policier offre à l’étude du stéréotype une grande variété de redondances, lexicales et structurelles, qui permettent d’éclairer le concept même de genre, en fait issu du constat de stéréotypie. Il est également manifeste que contrairement aux idées reçues, les clichés font du texte policier un texte littéraire, parce qu’ils naissent d’images associées, distinctes de la réalité, qui révèlent d’ailleurs le cheminement même de l’écriture. Par ailleurs ces images jouent un rôle fondamental dans le plaisir du lecteur, comme dans les contes de fées de notre enfance. Les clichés ouvrent la porte des fantasmes : le stéréotype rejoignant l’archétype, les clichés policiers réactivent de nombreux mythes, le texte évoquant l’Autre Scène. Le constat de stéréotypie provoque l’écriture, en particulier parodique, et stimule le renouvellement et l’essaimage des clichés dans toutes sortes de textes, qui bénéficieront de la présence du déjà-lu, laquelle donne au lecteur une assise pour affronter l’inconnu et une expérience pour apprécier la nouveauté.

  14. APPLICATION DU MODELE "DEFECT POOL" POUR LA SIMULATION DE LA PHOTOCONDUCTIVITE TRANSITOIRE DANS LE a-Si:H INTRINSEQUE ET DOPE PAR LE PHOSPHORE

    Directory of Open Access Journals (Sweden)

    A.F MEFTAH

    2004-06-01

    Full Text Available Le profil d'énergie de la densité des états le long du gap du a-Si:H est déterminé conjointement par le modèle defect pool (MDP et la queue de bande de conduction (QBC calculée par la transformé de Fourier de la photoconductivité transitoire (PCT. La PCT obtenue par la simulation numérique est comparée avec les données expérimentales pour le cas du a-Si:H intrinsèque et le a-Si:H dopé par le phosphore. Les caractéristiques observées dans les courbes de la PCT à différentes températures permettent de calculer la fréquence d'émission au bord de la mobilité, le minimum de la queue de la QBC dans le a-Si:H intrinsèque et le pic de la bande des donneur dans le a-Si:H dopé .

  15. Mel Gibson contre le boulevard Raspail

    Directory of Open Access Journals (Sweden)

    Boris Jeanne

    2007-03-01

    Full Text Available Que peuvent faire les historiens et les anthropologues spécialistes de l’Amérique face à la puissance médiatique et commerciale d’Apocalypto, le dernier film de Mel Gibson, produit par Buena Vista (c'est-à-dire Disney et ayant déjà engrangé plus de 50 millions de dollars de recette avant même sa sortie en France ? Le cinéma est un art du présent, et quelle que soit l’exactitude de la reconstitution historique qu’il prétend parfois présenter, il demeure un puissant vecteur d’analyse de la soc...

  16. Acoustics on a Real Scale Model: Application to Fractured Media Diagraphies acoustiques sur modèle physique à l'échelle 1 : application aux milieux fracturés

    Directory of Open Access Journals (Sweden)

    Mari J. L.

    2006-11-01

    Full Text Available Fluid migration depends on the properties of the geological medium. It increases in fractured media. A better understanding of fractured media can be obtained by the full waveform acoustic technique only if the accuracy and the efficiency of the acoustic method can be correctly calibrated on a known medium. For this purpose, a real scale model made of concrete was built. The first part of the paper describes the real scale model, with its advantages and pitfalls. It illustrates the benefit of using data obtained on the model for tool development. The second part shows acoustic data recorded in the real scale model which represents a fractured medium. The open fracture is perpendicular to the borehole axis. The acoustic know-how acquired from the model has been used to develop an acoustic dipmeter method. This method is briefly described. Two field examples of full waveform acoustic data recorded in fractured media are shown in the third part. The first example shows open and cemented fractures observed on a constant offset section recorded in a vertical well. The second example shows both dipping reflectors and fractures observed in a highly deviated well. In both examples, the fractures and reflectors are confirmed by a core analysis. La migration de fluide après injection dépend du taux de fracturation du milieu géologique. La diagraphie acoustique en champ total est un outil d'investigation du milieu fracturé. Cet outil est d'autant plus performant qu'il est bien maîtrisé. Un modèle physique à l'échelle 1 permet l'utilisation d'outils acoustiques standards. Il permet d'acquérir des données sur milieu à géométrie connue et aux paramètres mécaniques connus. Il permet de juger de la complexité de la réponse acoustique à une hétérogénéité (fractures ouvertes, fractures cimentées. La première partie de l'article est consacrée à la description du modèle physique avec ses avantages et ses inconvénients. Elle montre

  17. Masse rénale avec image stellaire centrale: Quel est votre diagnostic?

    Directory of Open Access Journals (Sweden)

    A. Qarro

    2013-03-01

    Full Text Available Le carcinome chromophobe se voit essentiellement à la cinquième décennie et représente 5% des tumeurs rénales. Il existe deux sous types de cancer à cellules chromophobes: le type clair (70% et le type éosinophile. La variante à cellules éosinophiles doit être distinguée de l'oncocytome. Ce dernier se caractérise par une cicatrice fibreuse centrale d'aspect stellaire. Le carcinome chromophobe et l'oncocytome peuvent même coexister dans le cadre du syndrome de Birt-Hogg-Dubé. Certaines tumeurs appelées hybrides partagent des caractéristiques architecturales et cytologiques de ces deux tumeurs. Le pronostic du carcinome chromophobe est favorable. Il est le plus souvent limité au rein et de bas grade nucléaire. Il semblerait donc licite dans les cas ou un examen extemporané mettrait en évidence une tumeur chromophobe, de limiter l'intervention à une néphrectomie partielle si techniquement réalisable.

  18. Communiquer le changement climatique: un voyage dans les stratégies et plans d'adaption

    NARCIS (Netherlands)

    Stoverinck, F.; Dubois, G.; Amelung, B.

    2013-01-01

    Les stratégies d’adaptation au changement climatique devraient normalement s’appuyer sur la meilleure information climatique disponible. Or le constat scientifique initial est souvent transformé, interprété, mis en forme par le processus de politique publique. Le message original s’en trouve

  19. Le style modal de la science-fiction

    Directory of Open Access Journals (Sweden)

    Emmanuel Boisset

    2013-04-01

    Full Text Available La faiblesse de style dont souffrirait la science-fiction est en fait le signe que la science y est davantage discours du possible que description du réel. Un « style modal » va suspendre la valeur de vérité, et le style de la possibilité va décontextualiser les métaphores disponibles. En science-fiction, le processus métaphorique génère et structure la diégèse. Un exemple chez Iain M. Banks montre un dialogue quasi incompréhensible mettre à l’épreuve la signification comme possibilité. Les métaphores figées sont revitalisées par la décontextualisation de la fiction, dont le texte peut exploiter l’impertinence.

  20. 1. Le Soleil, une étoile dans notre Galaxie

    OpenAIRE

    Vial, Jean-Claude

    2017-01-01

    Par une belle nuit sans Lune (et sans nuages), levons les yeux vers le ciel. L’œil est immédiatement attiré par le cortège d’étoiles brillantes qui a donné son nom à la Voie lactée. Il s’agit en fait d’une galaxie de près de 200 milliards d’étoiles qui abrite notre Soleil et ses planètes, c’est notre galaxie, « la » Galaxie, comme une île dans le vaste cosmos. La Galaxie : ses 150 à 200 milliards d’étoiles sont réparties selon des bras spiraux autour d’un noyau central et pour la plupart conf...

  1. Le nu au service de la santé

    OpenAIRE

    Andrieu, Gilbert

    2010-01-01

    Le nu à la fin du XIXe siècle et au début du XXe siècle fait son apparition dans de nombreux ouvrages consacrés à l'éducation physique et à la culture physique. Son utilisation est essentiellement pédagogique et esthétique. Le nu devient acceptable car il est avant tout démonstratif de la santé, d'une santé presque naturelle ou du moins associée à la nature. Le corps nu témoigne d'un homme non déformé 'et trahi par le progrès matériel. L'analyse de l'iconographie d'ouvrages de vulgarisation d...

  2. Le Service Accueil et Contrôle d'Accès

    CERN Document Server

    Ducastel, C

    1999-01-01

    L'utilisateur qui vient au CERN pour la première fois, est accueilli généralement par les membres du service 'Accueil et Contrôle d'Accès'. Cet utilisateur sera tout d'abord orienté vers un des postes d'hôtesses d'accueil en charge de l'enregistrement et de la délivrance de cartes CERN. Les informations seront saisies et immédiatement disponibles et transmises, via le système AMS, aux équipements de contrôle d'accès et à la Centrale de Surveillance des accès, chargée de la supervision de tout le dispositif de contrôle d'accès au domaine. Ces contrôles aux entrées et accueil des visiteurs individuels sont complétés par des missions de surveillance à l'intérieur du Domaine pour les agents, et par des travaux de gestions de dossiers administratifs (service enregistrement) pour les hôtesses. Un contrat commun assure une uniformité de formation des agents et hôtesses. Ce contrat est assorti d'une clause de Bonus Malus afin de tendre vers une optimisation des performances.

  3. LE MARCHE FINANCIER EN ALGERIE : SITUATION ET ...

    African Journals Online (AJOL)

    Administrateur

    Dans les pays en transition, la performance du marché financier apparaît loin des espérances suscitées. ... la création et de la croissance des entreprises, conditions objectives du développement économique. ... L'emprise de ce marché est telle que même certaines entreprises activant dans le secteur formel y recourent, ...

  4. Le CRDI en Indonésie

    International Development Research Centre (IDRC) Digital Library (Canada)

    défricher les terres. Autre exemple : la carte de la vulnérabilité aux changements clima- tiques en Asie du Sud-Est réalisée par le programme, qui attire l'attention sur les risques associés aux changements climatiques et a aidé les responsables des politiques et les bailleurs de fonds à établir un plan d'action à cet égard. B.

  5. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D05. BP9184...28 CL2013Contig1 Show BP918428 Clone id YMU001_000113_D05 Library YMU01 Length 431 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D05. Accession BP918428 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_00...c Acids Res. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D05. (431 le

  6. AcEST: BP918426 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D03 504 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D03. BP9184...26 CL2Contig2 Show BP918426 Clone id YMU001_000113_D03 Library YMU01 Length 504 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000113_D03. Accession BP918426 Tissue type prothallium Developmental stage -...c Acids Res. 25:3389-3402. Query= BP918426|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D03. (504 le...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  7. AcEST: DK954060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954060 CL412Contig1 Show DK954060 Clone id TST39A01NGRL0019_G24 Library TST39 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G24. 5' end sequence. Accession DK95406...s Res. 25:3389-3402. Query= DK954060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_G24, 5' (626 le...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954060|Adiantum ca...TST39A01NGRL0019_G24 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G2

  8. AcEST: DK949897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available P29425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer Align length 50 Score (bit) 32.7 E-value 1.9 Re...9425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer ... 33 1.9 sp|Q10MN8|C...honeutria nigrivente... 30 9.3 >sp|P29425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer PE=2 SV=2 Le...C+ GVG A G+PS Sbjct: 147 GGFPSLPWASSLERLLTSPSSCVSDSRGVGNADGFPS 183 >sp|O76198|TX21A_PHONI Neurotoxin Pn2-1A OS=Phoneutria nigriventer

  9. AcEST: DK953467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK953467 - Show DK953467 Clone id TST39A01NGRL0017_N13 Library TST39 Length 578 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_N13. 5' end sequence. Accession DK953467 Tissue t...s Res. 25:3389-3402. Query= DK953467|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_N13, 5' (578 le...eic Acids Res. 25:3389-3402. Query= DK953467|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_N13, 5'...TST39A01NGRL0017_N13 578 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_N1

  10. Le Minh Duc

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Le Minh Duc. Articles written in Bulletin of Materials Science. Volume 36 Issue 5 October 2013 pp 779-788. Study on photocatalysis of TiO2 nanotubes prepared by methanol-thermal synthesis at low temperature · Chau Thanh Nam Wein-Duo Yang Le Minh Duc · More Details ...

  11. Le Bon, Gustave

    DEFF Research Database (Denmark)

    Borch, Christian

    2017-01-01

    Gustave Le Bon (1841–1931) was a French physician and crowd psychologist who published extensively on themes such as crowds, war, race, revolution, socialism, and war. His work on crowd psychology in particular was highly influential, including beyond scholarly circles. Le Bon argued that crowds ...

  12. Le Recul de la Forêt au Viet Nam

    International Development Research Centre (IDRC) Digital Library (Canada)

    La voie de recherche et les outils d'analyse utilisés dans le cadre de ce projet étaient nouveaux pour les Vietnamiens, et les conditions sur le terrain étaient nouvelles pour les Canadiens; c'est donc dire que tous les participants ont réalisé un apprentissage important. L'expérience a démontré l'efficacité et l'utilité de telles ...

  13. Publications | Page 19 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La Méditerranée est un endroit du monde ou les effets des changements climatiques se font particulièrement sentir. Transfert de responsabilités (2009). Au cours des deux dernières décennies, le Centre de recherches pour le développement international (CRDI) a participé à la mise sur pied et à la fermeture ou au transfert ...

  14. Publications | Page 51 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... Aux fins de l'élaboration de sa prochaine stratégie quinquennale, le CRDI a organisé... Agents de changement : la philanthropie dans certains pays d'Asie du Sud-Est.

  15. Quand le cerveau joue avec les notes | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 janv. 2018 ... La musique nous rend-elle plus performants en calcul ? C'est ... Autrement dit, en osant le raccourci, faire du piano rend-il meilleur en calcul mental, par exemple ? ... Le groupe assigné à la tâche simple devait comparer deux mélodies comportant d'infimes variations de tons pour déterminer si elles étaient ...

  16. Publications | Page 153 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Quelle part véritable ont la science et la technologie (S-T) dans la satisfaction des besoins humains essentiels ? Leur rôle dans le développement est assurément une des questions les plus complexes et délicates auxquelles soient confrontés aujourd'hui les décideurs et les professionnels... Human Security and Mutual ...

  17. Publications | Page 222 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transport et réduction de la pauvreté : étude de cas sur la contribution du secteur des transports à la réalisation des Objectifs du Millénaire pour le Développement (Burkina Faso) (restricted access). Le Burkina Faso, comme la plupart des pays en développement, est confronté à des problèmes liés à l''aggravation de la ...

  18. le traitement de la tuberculose ganglionnaire cervicale a propos de ...

    African Journals Online (AJOL)

    Introduction : La tuberculose ganglionnaire cervicale représente la localisation extra pulmonaire la plus fréquemment observée. Cependant, le traitement d'une affection aussi répandue dans le monde ne fait pas consensus. L'objectif de cette étude est de préciser, à travers une revue de la littérature, les différents moyens ...

  19. Le Projet hippocampe devient un important protagoniste de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Projet hippocampe devient un important protagoniste de la conservation de la faune marine. 29 octobre 2012. Image. Stephen Dale. Des effets durables. Pour certains, le Projet hippocampe est un organisme qui a mobilisé des collectivités de pêcheurs pauvres des Philippines pour créer des dizaines d'aires protégées ...

  20. Afrique subsaharienne | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... d'approvisionnement en eau surchargés sont de plus en plus éprouvés par la croissance galopante des zones urbaines sans compter l'érosion des sols, le rétrécissement des forêts, la désertification et la dégradation des zones humides. Qui plus est, l'épidémie de VIH fait le plus de dégâts en Afrique subsaharienne.

  1. Publications | Page 56 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cap sur l'Ouest : les Prairies canadiennes, élément essentiel de la lutte contre la faim dans le monde. Il y a plus de vingt ans, Charlie Mayer, exploitant d'un ranch dans le sud du Manitoba et également ministre fédéral de l'Agriculture, est rentré au Canada troublé par ce qu'il avait entendu.

  2. Le processus entrepreneurial en algerie une adaptation du modele ...

    African Journals Online (AJOL)

    De ce fait, notre ambition, à travers cette recherche est, d'étudier le processus entrepreneurial en Algérie inspire du modèle de Gartner qui permet une meilleure analyse à travers une démarche qualitative (les entretiens semi directifs) sur un échantillon de 30 entrepreneurs de Tlemcen qui répondront aux questionnements ...

  3. Publications | Page 145 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative régionale concernant la demande d'eau (WADImena), que finance le CRDI, aide les pays de la région aride du Moyen-Orient et de l'Afrique du Nord à ... urtant, bien que la GDE gagne du terrain auprès des responsables des politiques, elle n'est pas encore assez ancrée sur le plan politique pour être mise en ...

  4. Publications | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... produits et de services financiers à l'intention des jeunes. Revitalizing Health for All : Case Studies of the Struggle for Comprehensive Primary Health Care. Le concept de soins de santé primaires complets (SSPC) est axé sur les efforts déployés par le système de santé pour améliorer l'égalité d'accès aux soins de santé, ...

  5. Publications | Page 15 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet Cultiver l'avenir de l'Afrique (CultivAf) du CRDI et l'Australian Centre for International Agricultural Research (ACIAR), organisme collaborateur, ont organisé l'activité parallèle « Science and Innovation to Transform ... Depuis quelques années cependant, c'est avec plus d'optimisme que l'on parle de ce continent.

  6. Publications | Page 20 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cependant, il est couramment utilisé comme combustible, dans les régions rurales, pour faire cuire le pain dans un four traditionnel. Des chercheurs insistent sur l'importance de favoriser la résilience aux changements climatiques des producteurs de maïs d'Afrique du Sud. Des recherches ont démontré que le rendement ...

  7. colombia : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Financement total : CA$ 650,800.00. Prévenir les maladies liées au virus Zika avec de nouvelles approches de lutte antivectorielle. Projet. Ces dernières années, c'est en Amérique latine qu'on a observé le nombre le plus élevé de cas de dengue, soit au Brésil, en Colombie et au Mexique. Région: Brazil, Colombia, Mexico.

  8. A Fully Analytical Solution of the Wellbore Stability Problem under Undrained Conditions Using a Linearised Cam-Clay Model Solution analytique au problème de stabilité de puits en conditions non drainées utilisant un modèle de Cam-Clay linéarisé

    Directory of Open Access Journals (Sweden)

    Charlez P. A.

    2006-12-01

    Full Text Available This paper presents a linearised version of the Cam-Clay model fully integrated in the scope of the general theory of poroplasticity. The constitutive law which is developed in the scope of the effective plastic stress concept, only contains two plastic parameters (hardening modulus and slope of the critical state line. To be validated, the model is integrated over homogeneous stress paths (hydrostatic, drained triaxial and undrained triaxal then compared with experimental data issued from conventional laboratory triaxial tests. In the second part, a simplified version of the model is applied to the wellbore boundary problem (vertical well in an axisymmetric horizontal stress field and under undrained conditions. Given the linearity of the constitutive law and the a priori knowledge of the shape of the plastic region, the solution (stress, strain and pore pressure is fully analytical. The solution shows that for an overconsolidated material (overconsolidation degree less than 2 the hoop stress is strongly relaxed in the plastic zone. The higher the compressibility of the saturating fluid, the larger the relaxation of the hoop stress. In terms of stability, the more compressible the fluid saturating the porous medium is, the more stable the well will be. Finally the larger the overconsolidation ratio is, the less stable the well will be. Cet article présente une version linéarisée du modèle de Cam-Clay intégré dans le cadre général de la théorie de la poroplasticité isotherme. La loi de comportement développée à partir du concept des contraintes effectives plastiques ne contient que deux paramètres plastiques (module d'écrouissage et pente de la droite critique. Le modèle est validé sur des chemins de contrainte homogènes (hydrostatique, triaxial drainé et triaxial non drainé et comparé à des essais expérimentaux obtenus à partir d'essais conventionnels de laboratoire. Ensuite, une version simplifiée du modèle est

  9. Le massacre de la mariée

    Directory of Open Access Journals (Sweden)

    Bastiaan van der Velden

    2016-06-01

    Full Text Available Le Massacre des innocents a été pour Marcel Duchamp l’une de ses sources en composant Le Grand Verre. Ce ‘massacre’ est dans ce cas plus précisément une attraction foraine. D’autre part l’infanticide à Bethlehem constitue un sujet maintes fois représenté par différents peintres. Pour Alfred Jarry, auteur littéraire et de théâtre qui a plus particulièrement inspiré Duchamp, le tableau Le Massacre des innocents de Breughel l’Ancien était une pièce clé qui lui permettait de démontrer pourquoi il rejetait l’art historisant en peinture et dans le théâtre.

  10. Physique ou leçons sur les principes généraux de la nature I

    CERN Document Server

    Aristote

    2015-01-01

    Extrait : ""Or il n'en est pas dans la nature de plus certain ni de plus évident que le mouvement sous toutes ses formes ; et voilà comment la Physique d'Aristote n'est au fond qu'une théorie du mouvement. C'est une étude sur le principe le plus général et le plus important de la nature ; car sans ce principe, ainsi qu'Aristote l'a dit bien des fois, la nature n'existe pas ; elle s'identifie en quelque sorte avec lui.""

  11. Aiutare le vittime della mafia a ribellarsi

    Directory of Open Access Journals (Sweden)

    Roberto Riccardi

    2007-09-01

    Full Text Available Nino Miceli is a Sicilian man, owner of a small business: at the beginning of 1990s he is concessionnaire of cars in Gela, an quite big town in Sicily. He works hard and soon he starts to earn a lot. Business is very good, and customers are satisfied and everything seems to go on successfully. But the mafia keeps an eye on him and, at a certain point, he was asked to pay them what in Italy is called “pizzo”. Nino Miceli does not want to pay it, he does not want to surrender to the mafia coercion. However, at the beginning he pays the “pizzo” but then he starts to record the conversation he has with those men (the “mafiosi”, in order to prove and demonstrate the crime. He also looks for protection at the local station of Carabinieri; finally, he decides to report the extortion but, from that time on, he starts to experience more and more serious threats.Helped by an officer of Carabinieri, he becomes a witness of justice and, for that reason, he must change his identity. He leaves Sicily along with his family and move into a different region of Italy, far from his town, where nobody knows him. In 2007 he decides to write a book of memories, titled “Io, il fu Nino Miceli” (in English it could sound like “I was Nino Miceli”. This article tells his story, speaking also about the role played by the Arma of Carabinieri in supporting victims of racket and usury.Nino Miceli est un entrepreneur sicilien originaire de Realmonte, une ville en province d'Agrigento. Au début des années 90, il est proprietaire du garage Lancia à Gela. Il s'engage beaucoup dans son travail et les résultats ne tardent pas à arriver. La clientèle augmente, les affaires vont bon train, mais c'est justement quand l'entreprise est en train de prospérer que la mafia lui demande des comptes. Il doit payer le pot-de-vin comme tous les commerçants du quartier. Nino Miceli n'est pas d'accord avec cela. Au début il subit, mais il commence bientôt

  12. Participation active, innovation sociale et résilience : Lele des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est axé sur la mise en oeuvre d'activités socioéconomiques par des jeunes au Zimbabwe en réponse aux défis sociaux et économiques dans leur milieu, à l'exclusion politique et ... Un numéro spécial de la revue met en lumière les conclusions d'une étude financée par le CRDI sur le travail rémunéré des femmes.

  13. Le paludisme, le tsunami silencieux d'Afrique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  14. Le développement de projets en Bolivie

    OpenAIRE

    Maes, Sandrine; Maes, Jeremy; Rey, Jean-Charles

    2007-01-01

    Ce mémoire traite des projets, de leur développement. Qu’est-ce qu’un projet ? Comment est-il créé ? Le développement de projet est un domaine complexe. Au fil des pages, nous présentons une définition du projet, ainsi que deux manières différentes de le conduire. Ce mémoire parle également de la Bolivie. Nous y découvrirons une autre culture, une autre manière de penser, d’agir, de vivre. Dans ce travail, nous tentons de mettre en évidence comment le développement de projet s’insère da...

  15. L'accès au savoir en Afrique : lele du droit d'auteur

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il existe en outre très peu de témoignages démontrant le véritable impact de certains droits d'auteur en particulier, ni d'ailleurs d'autres lois ou politiques de ...... Le mouvement en faveur de la protection du droit d'auteur est soutenu par de grandes entreprises des secteurs de l'industrie cinématographique et musicale ...

  16. Walter Benjamin et le surréalisme

    OpenAIRE

    Löwy, Michael

    2014-01-01

    Cet article interprète le matérialisme anthropologique comme l’expression d’un imaginaire contestataire propre au romantisme anticapitaliste. Chez Walter Benjamin, il s’articule avec le matérialisme dialectique, y introduisant la critique du désenchantement du monde et la revalorisation de l’utopie. Parsemé d’« illuminations profanes », le programme politique du surréalisme est paradigmatique d’une telle alliance. This article interprets anthropological materialism as the expression of a c...

  17. Publications | Page 163 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En Afrique cependant, plus particulièrement pour les femmes vivant en milieu rural, l'accès à l'information est limité. Les nouvelles technologies de l'information et des... Le laboratoire, le temple et le marché : Réflexions à la croisée de la science, de la religion et du développement. Il s'agit là d'un ouvrage fascinant et très ...

  18. Le confort thermique en climat tempéré

    OpenAIRE

    Deval , J.-C.

    1984-01-01

    Le confort thermique de l'être humain en climat tempéré résulte du bilan des divers échanges avec l'environnement. Cet article s'appuie sur des travaux effectués les 45 dernières années, et plus particulièrement des travaux récents dans le domaine de la physiologie de la thermorégulation. Un modèle est construit à partir duquel sont établis des diagrammes pour les situations de confort.

  19. Rapports annuels | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapports annuels. Le CRDI publie un rapport annuel dans lequel il présente ses états financiers et ses résultats. Ce rapport met en outre en évidence des chercheurs bénéficiaires de subventions du CRDI et en décrit les projets et les réalisations clés. C'est le principal outil par lequel le Centre rend compte de ses activités ...

  20. Piste infectieuse à Escherichia coli toxinogènes dans le cancer colorectal

    OpenAIRE

    Raisch, Jennifer

    2014-01-01

    No abstract available; Le cancer colorectal (CCR) est au 3ème rang des cancers les plus répandus dans le monde. Il est bien établi que l'inflammation est un acteur clé de la carcinogenèse colorectale. Parmi les cellules de l'infiltrat inflammatoire tumoral, les macrophages jouent un rôle moteur dans la carcinogenèse en sécrétant un arsenal de cytokines/chimiokines et facteurs protumoraux tels que la prostaglandine E2 (PGE2), produit enzymatique de la cyclo-oxygénase 2 (COX-2). Des dysbioses d...

  1. Un développement urbain durable et socialement inclusif est-il possible dans le contexte de fragmentation socio-spatiale des métropoles des pays émergents? Réflexions à partir des cas de Recife (Brésil et de Chennai (Inde

    Directory of Open Access Journals (Sweden)

    Carrière Jean-Paul

    2016-12-01

    Full Text Available Dans un contexte globalisé, le développement de villes socialement durables et inclusives implique de nombreux défis contradictoires. L’analyse comparée des cas de Chennai, en Inde, et de Recife, au Brésil, montre qu’au-delà des spécificités de ces métropoles, nous retrouvons des processus de fragmentation socio-spatiale comparables et un réel décalage entre un discours sur l’insertion sociale et des pratiques urbanistiques orientées par la quête d’attractivité, qui se soldent par l’accentuation des inégalités. Ces contradictions renvoient à des conflits entre planification stratégique, jeu des forces des marchés immobilier et foncier, et attentes des populations. L’analyse de ces contradictions invite à repenser l’articulation de la dialectique local/global et à s’interroger sur l’effectivité du « droit à la ville » dans les sociétés de pays émergents. La comparaison développée dans cet article s’appuie sur des recherches menées à Recife dans un premier temps au début de la décennie en cours, puis plus récemment à Chennai.

  2. Lele des chefs traditionnels au Ghana : un modèle inspirant ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Avec ses partenaires du Sud, avec aussi le soutien du Centre de recherches pour le développement international ( CRDI ), organisme canadien, Ray a étudié lele des chefs traditionnels au Ghana dans la lutte contre le VIH et le sida. Les collectivités politiques antérieures au colonialisme sont une ...

  3. Le lien retrouvé

    Directory of Open Access Journals (Sweden)

    Luis Antonio Bittar Venturi

    2009-06-01

    Full Text Available Les ressources naturelles sont les principales médiatrices de la relation homme-nature, se situant à l´interface entre les dimensions sociale et naturelle. Cette thématique favorise donc la ré-intégration entre la géographie physique et humaine, dans la mesure où elle amène le chercheur à une vraie analyse géographique, celle qui considère, en même temps, les aspects humains et naturels pour la compréhension du territoire ou, si l’on préfère, de l´espace géographique. C´est dans ce contexte i...

  4. Le Squatteur, le Gentrifieur et le Promoteur. Une leçon de la géographie

    Directory of Open Access Journals (Sweden)

    Laurent Matthey

    2005-03-01

    Full Text Available Posées sur mon bureau : deux photos. Je les regarde. Silencieusement, je les décris et les commente. La première a été prise en novembre 1997. Angle rue Jean-Violette, rue Prévost-Martin, à Genève. On y voit un immeuble, ancien, des échafaudages. Entre cet immeuble et celui qui lui fait face, on a tendu des fanions verts, bleus, orange. Son rez-de-chaussée a été repeint dans une teinte un peu brique. La seconde date d’avril 2005. C’est le même immeuble, presque dix ans plus tard, rénové. Jaun...

  5. Fluid Flow in Low Permeable, Porous Media Écoulements fluides dans un milieu poreux peu perméable

    Directory of Open Access Journals (Sweden)

    Dutta N. C.

    2006-11-01

    kinetic theory of chemical reaction in which the time-temperature history is provided by the solution of an appropriate heat conduction equation. This model of geopressure has a practical application since it deals with the generation and maintenance of abnormally high fluid pressures over geologic time and impacts the hydrocarbon migration in clastic basins. La migration des hydrocarbures traite du déplacement du pétrole consécutif à l'expulsion des roches mères vers les réservoirs saturés en eau ou à travers des zones perméables créées par des fractures ou des failles. Bien que les principes sous-jacents contrôlant les mouvements de fluides dans les milieux poreux (réservoirs soient bien compris des ingénieurs de réservoir, on connaît moins de choses sur les caractéristiques des écoulements dans les milieux poreux peu perméables, comme les argiles et les schistes. En termes d'écoulement, les paramètres principaux sont la porosité, la perméabilité, et les gradients potentiels des fluides. Pour les argiles et les schistes, ces paramètres sont peu connus; et cependant ce sont eux qui contrôlent les périodes pendant lesquelles les écoulements fluides se sont produits dans les bassins sédimentaires (de 100 à 100 millions d'années. Dans cet article, on examine la dépendance paramétrique des constantes temporelles des écoulements fluides dans les sédiments peu perméables par rapport à leur porosité et leur perméabilité. Dans une première partie, on présente une technique d'étude de l'effet d'un écoulement dans les argiles qui produit la sous-compaction et l'augmentation de la pression de fluide par rapport à la pression hydrostatique normale. On se place dans des conditions d'avant-forage ; la technique utilise la méthode des analyses de vitesse par mise en collection de point milieu commun des données sismiques de surface, et est basée sur le concept développé par Hottmann et Johnson (1965 et Pennebaker (1968. Dans une seconde

  6. LE TOURISME CULTUREL, MODÈLE DE DÉVELOPPEMENT ÉCONOMIQUE

    Directory of Open Access Journals (Sweden)

    George NICULESCU

    2010-06-01

    Full Text Available Le tourisme est essentiellement une forme de développement économique qui s’appuie sur les ressources culturelles. Mais c’est aussi une forme de développement qui, bien que participant de la réalité économique, est un moyen pour les individus et les sociétés de connaître et de comprendre leurs environnements et leur passé respectifs. En tant qu’expérience à la fois instructive et gratifiante, le tourisme peut être un outil d’émancipation permettant de s’enrichir et de communiquer intellectuellement, émotionnellement et spirituellement. C’est précisément ce flux et ces échanges entre les gens qui différencient le tourisme des formes plus mécanistes du commerce et du développement économique à l’échelle planétaire. Que ce soit comme forme d’expression artistique ou en tant que « mode de vie », la culture est presque constamment « en représentation ». Le tourisme, les voyages et les différents médias ont suscité une prise de conscience universelle de la richesse et de la diversité des cultures du monde. Parallèlement, il devient de plus en plus évident que le fait de s’intéresser et de participer à la vie culturelle ne saurait être considéré comme une activité marginale par rapport à d’autres aspects de la vie sociale, économique et politique. Plus que jamais, nous sommes conscients de la valeur de la culture, qui constitue désormais l’un des fondements de la planification économique et du développement. Le tourisme est une composante importante des nouvelles « économies culturelles » (ou du culturel qui transcendent les frontières dans la mesure où il mobilise et met en contact de nouveaux publics et crée de nouvelles pressions et de nouvelles opportunités.

  7. Accessibilité aux emplois en France : lele de la distance à la ville

    Directory of Open Access Journals (Sweden)

    Mohamed Hilal

    2004-12-01

    Full Text Available L'objet de cet article est de modéliser les niveaux d’accessibilité potentielle aux emplois des communes françaises selon lele de la distance à la ville. Pour ce faire, nous présentons, tout d’abord, un modèle d’accessibilité et la méthode mise en œuvre pour calculer de façon systématique, à partir des données du réseau routier, une matrice des plus courts chemins, mesurés en temps, entre les communes françaises. Ensuite, dans la deuxième partie, ces distances sont intégrées dans le modèle d’accessibilité retenu afin de mesurer la disponibilité potentielle aux emplois selon la distance au pôle urbain le plus proche et selon les principales catégories d’espace du zonage en aires urbaines et de son complément rural. Enfin, la mesure d’accessibilité potentielle est comparée à plusieurs mesures d’accessibilité empirique.

  8. diversité botanique dans le sud du parc national de taï, côte d

    African Journals Online (AJOL)

    AKA Boko Mathieu

    Contrôle du convertisseur monophasé par réseau de neurones ... pour Tc=T1. Le contrôle de cette puissance n'est donc possible que pour des puissances moyennes comprises entre ces deux valeurs limites. 2-2. Modélisation interne ..... performances de la commande numérique non linéaire utilisée en présentant le cas ...

  9. Le dictionnaire de chimie en lingála pour les élèves de Kinshasa ...

    African Journals Online (AJOL)

    Tel est le cas du lingála, langue parlée dans la ville de Kinshasa, dans le domaine de la chimie. Outre le travail de dépouillement du corpus, des travaux de création terminologique doivent donc être réalisés, afin de permettre à ces dictionnaires de satisfaire les attentes des utilisateurs. Pour cela, le lexicographe adopte ...

  10. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2008-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  11. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2009-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  12. Sous type rare du cancer de prostate: Le carcinome sarcomatoide

    African Journals Online (AJOL)

    A. Qarro

    est essentiellement chirurgical qui peut aller de la simple résection de la prostate jusqu'à l'exentération pelvienne associée ou non à la chimiothérapie ou à la radiothérapie. Le pronostic est très mauvais avec 20% de risque de décès la première année qui suit le diagnostic. Nous rapportons une observation d'un patient.

  13. La communication de recrutement dans le milieu hospitalier

    OpenAIRE

    Medina, Pablo

    2011-01-01

    Le développement de la communication institutionnelle et du marketing au sein des institutions hospitalières est très influencé par les changements qui ont lieu dans le milieu sanitaire. La communication de recrutement est l’une des activités les plus stratégiques dans ce cadre, non seulement parce qu’elle répond à des objectifs organisationnels très précis, mais aussi parce qu’elle contribue au développement du champ de la communication institutionnelle dans les hôpitaux. Mais, pour y réussi...

  14. Communication intentionnelle dans le domaine du leadership

    Directory of Open Access Journals (Sweden)

    Sophie Ménard

    2013-12-01

    Full Text Available L’existence de toute organisation repose sur le soutien que lui accordent ses membres. Le fonctionnement optimal d’un système est tributaire de la qualité des relations entre ses composantes, c’est-à-dire, pour une organisation, entre ses différents paliers. La qualité de ces relations présente des avantages concurrentiels sur les plans économique, politique et social, car elles se traduisent par une communication claire, directe et régulière entre les niveaux hiérarchiques. Pour les dirigeants, il s’agit de leur capacité à exercer leur leadership. Cette communication a un impact sur le développement des compétences des employés, la productivité de l’entreprise et sa visibilité stratégique dans la sphère politique et, enfin, sur l’attraction et le maintien d’une main-d’œuvre qualifiée et engagée. Il va sans dire qu’au 21e siècle, l’avènement des médias sociaux rend plus délicate la tâche des gestionnaires et présente ainsi un défi bien plus important que la mise en place de bonnes relations de travail qu’on préconisait au siècle dernier. Les auteurs aborderont le leadership autoral comme alternative en vue d’un leadership de conscience plus adapté aux défis des organisations du siècle actuel.

  15. La Recherche du Quark Top dans le Canal $e$ + Jets a D0

    Energy Technology Data Exchange (ETDEWEB)

    Lebrat, Jean-Francois [Orsay

    1996-05-01

    Le travail de thèse qui est résumé ici a débuté en 1993, alors que l'existence du quark top n'avait pas encore été mise en évidence expérimentalement. Il se concentre sur la recherche du top dans l'un de ses modes de désintégration, le canal e + jets, et utilise l'ensemble des outils d'identication des particules et d'analyse développés par la collaboration DØ. L'analyse présentée ici est la première à utiliser le TRD (le Détecteur à Rayonnement de Transition, qui a été mis au point et fabriqué à Saclay) pour une meilleure identication de l'électron.Nous présenterons tout d'abord le quark top, en décrivant la place qu'il occupe dans le modèle utilisé par les physiciens des particules, le Modèle Standard. Nous montrerons ainsi que l'existence du quark top était prédite par le modèle bien avant sa découverte, et indiquerons ainsi les raisons qui ont motivé notre analyse....

  16. Le foudre foudroyant et ravageantoublié de Pierre Juvernay

    Directory of Open Access Journals (Sweden)

    Sophie Longuet

    2007-01-01

    Full Text Available Parmi les textes que j’ai dû mettre de côté lors de mes recherches, j’ai pensé immédiatement à celui de Pierre Juvernay, Le Foudre foudroyant et ravageant, contre les péchez mortels, Paris, Pierre Le Mur, datant de 1637. Le titre m’avait interpelé étant donné le sujet de ma thèse dont le titre est le suivant : « De la foudre à la lumière. Enquête sur les formes de la luminosité et leur signification dans l’œuvre de Dante. » La nature du document est un texte d’exhortation proche des exempla médiévaux pour son contenu. Écrit pour mettre au jour une doctrine religieuse catholique propre au XVIIe siècle,ce livre m’a permis de m’intéresser aux exempla médiévaux, aux exhortations et aux sermons. Dieu, affligé par les péchés mortels, s’adresse aux hommes par l’intermédiaire du foudre qui est la représentation de la foudre. Il symbolise la puissance de Dieu et sert à faire peur afin d’éviter aux hommes de commettre des péchés. L’auteur utilise indifféremment  le foudre pour la foudre, mais cela implique une érudition qui fait référence à Jupiter armé dufoudre le portant dans ses serres. Ce feu du ciel effraie et fait trembler tout en inspirant le respect de la Toute-puissance. La foudre n’est pas encore considérée comme un phénomène naturel, mais elle est un châtiment divin. Il faudra attendre le XVIIIe siècle, en effet, pour que la physique se lance dans l’examen de la foudre en tant que telle après la découverte de l’électricité.

  17. Enseignement Basé sur les Compétences : Manuel d'Application dans le Domaine des Sciences Agronomiques a L'Université d'Abomey-Calavi

    NARCIS (Netherlands)

    Koutinhouin, B.; Hupkes, M.; Gooijer, de G.; Aho, N.; Windmeijer, P.N.

    2011-01-01

    Le présent manuel est produit dans le cadre du Projet d’Appui au Renforcement des Programmes de Formation et de Recherche en Agriculture à la Faculté des Sciences Agronomiques et à l’Ecole Polytechnique d’Abomey-Calavi, financé par le Gouvernement du Royaume des Pays-Bas (Projet NPT/BEN/146). Il est

  18. Le bois et ses usages dans le De architectura de Vitruve

    Directory of Open Access Journals (Sweden)

    Sylvie Rougier-Blanc

    2011-05-01

    Full Text Available Ni traité d’architecture à proprement parler, ni véritable ouvrage philosophique, le De architectura de Vitruve permet d’aborder la question du matériau bois et de ses usages en architecture de manière à la fois précise et décevante pour l’historien des techniques : précise parce que le paragraphe 9 du livre II est plus particulièrement consacré à cette materia, mais décevante parce que le contenu ne répond pas aux attentes et ne permet pas de dresser un bilan des choix des essences en foncti...

  19. Le Peer to Peer: Vers un Nouveau Modèle de Civilisation

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu’il s’agit d’une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d’un nouvel imaginaire social, et possède le potentiel de devenir le pilier d’un nouveau mode d’économie politique, voire d’un nouveau type de civilisation. Pour cela, nous allons d’abord définir le P2P, décrire en bref ces manifestations, et le différencier d’autres modalités d’échange intersubjectif tel que le marché, la hiérarchie, l’économie du don. Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n’est ni géré par un mode hiérarchique ou par l’état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun. Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l’échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding. En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants. Abstract: “Peer to peer” is hypothesized as a new social formation with intersubjective dynamics characteristic of distributed

  20. Le Jardin de Fleur

    Index Scriptorium Estoniae

    2008-01-01

    Ettevõtja Martin Reinsalu osalusel Marokosse kerkiv kuurortide kompleks Le Jardin de Fleur tunnistati CNBC Araabiamaade kinnisvaraarendusprojektide seas Maroko parimaks arendusprojektiks ning parimaks golfiarenduskeskuseks. Projekt toetub araabia arhitektuurile, mida on kombineeritud kaasaegse maroko disainiga

  1. Le CRDI en Tanzanie

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il y a longtemps que le CRDI appuie la recherche en Tanzanie, une démocratie stable. Depuis la fin des années 1990, le pays jouit d'une croissance économique soutenue, bien qu'il demeure l'un des. États les plus pauvres de la planète. Ses gouvernements successifs ont reconnu que la réduction de la pauvreté passait ...

  2. Le CRDI au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    contre le paludisme n les chercheurs contribuent à l'amélioration des services de santé n de jeunes femmes participent à la vie politique. Soutien accordé par le CRDI depuis 1971. 93 activités d'une valeur de 15 millions cad. Les chercheurs ont aidé à offrir l'enseignement primaire dans les langues maternelles. CRDI.

  3. Le CRDI au Maroc

    International Development Research Centre (IDRC) Digital Library (Canada)

    démocratiques. Au Maroc, le Centre d'études et de recherches en sciences sociales analyse ce que pourrait être la réaction du gouverne- ment aux pressions exercées par la population en vue d'un changement sur le plan politique. Rabat. Casablanca. Marrakech. Tan-Tan. Bou Arfa. Zagora. Oujda. Tanger. Fès. ALGÉRIE.

  4. Le CRDI en Afghanistan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Depuis près de 40 ans, le CRDI collabore étroitement avec les chercheurs des pays en développement et les appuie dans leur quête de moyens de créer des sociétés en meilleure santé, plus équitables et plus prospères. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G ...

  5. Le CRDI au Bhoutan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il en résulte des solutions locales, novatrices et durables, qui offrent des choix aux personnes qui en ont le plus besoin et font changer les choses. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter la page. Web du Bureau régional de ...

  6. Le CRDI au Kenya

    International Development Research Centre (IDRC) Digital Library (Canada)

    afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter.

  7. Le CRDI en Jordanie

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... dans les pays en développement afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9.

  8. Le CRDI en Bolivie

    International Development Research Centre (IDRC) Digital Library (Canada)

    plus grandes responsabilités aux munici- palités en matière de développement économique. De 2002 à 2007, le CRDI a appuyé la collaboration entre l'Atlantic. Community Economic Development. Institute, de Halifax, en Nouvelle-Écosse, et deux organismes boliviens, le Centro de Servicios Agropecuarios Técnicos, du.

  9. Dynamiques et rôle économique et social du secteur informel des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'économie des pays en développement, africain notamment, est caractérisée par la coexistence d'un secteur formel et d'un autre dit informel. ... Ce projet vise à mieux comprendre le dynamique actuelle du secteur informel des TIC et lele économique et social qu'il joue au Burkina Faso, au Cameroun et au Sénégal, ...

  10. Article Original Le cancer du rein chez l'adulte. Etude rétrospective à ...

    African Journals Online (AJOL)

    mn

    Depuis la généralisation des moyens d'imagerie, le cancer du rein est découvert fortuitement dans plus de 70% des cas. La triade classique (hématurie macroscopique, lombalgie et masse du flanc) ne représente. Tableau 5 : Taux de survie sans récidive en fonction de la taille tumorale, le stade tumoral, le grade nucléaire, ...

  11. Article Original Le kyste hydatique du rein fistulisé dans les voies ...

    African Journals Online (AJOL)

    mn

    indication à l'opacification par l'iode (allergie, insuffisance rénale). Le traitement du kyste hydatique fistulisé est uniquement chirurgical et doit tendre vers une chirurgie conservatrice en préservant le tissu rénal fonctionnel12-13. La lombotomie permet un abord extrapéritonéal évitant le risque d'essaimage de la cavité ...

  12. Pour mieux profiter des avantages commerciaux : le Réseau latino ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 juil. 2011 ... Éloigner les menaces et maximiser les possibilités : voilà le mantra des négociateurs commerciaux de par le monde. Pour que la stratégie réussisse, toutefois, les négociateurs et leurs gouvernements doivent pouvoir distinguer une option prometteuse d'un piège éventuel, c'est bien là le hic. Nombre de ...

  13. Dissection aortique dans le syndrome de Marfan: à propos d'un cas ...

    African Journals Online (AJOL)

    Nous rapportons le cas d'un jeune homme de 30 ans chez qui nous avons fait le diagnostic de la dissection aortique dans le syndrome de Marfan. Il a pu bénéficier d'une intervention chirurgicale à coeur ouvert avec un remplacement de la valve aortique. A ce jour, 30ème mois après l'opération aucune complication n'est ...

  14. Liste de vérification Bourse de recherche 2018 pour le CRDI | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Certains numériseurs le feront automatiquement. Cependant, si le vôtre n'offre pas cette possibilité, il existe des méthodes manuelles pour ce faire, qui font appel à Adobe Acrobat, Microsoft Word ou d'autres logiciels. Le CRDI ne fournit pas d'instructions à ce sujet, mais il est possible de trouver des instructions sur Internet.

  15. Booster la production locale du riz pour le renforcement de la ...

    African Journals Online (AJOL)

    Contexte et objectif : Le riz occupe une place importante dans la sécurité alimentaire des populations rurales et urbaines du Nord Cameroun. Dans un contexte socio-économique en pleine mutation, cet article est une contribution à la réflexion sur lele du riz au renforcement de la sécurité alimentaire au Nord Cameroun ...

  16. Les voies d'eau de l'espoir | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 déc. 2010 ... Le prochain objectif consistait à procéder au revêtement d'un canal secondaire dans la zone d'irrigation. Comme c'est le cas de tous les canaux secondaires non ... Pour sa part, l'équipe de recherche a versé 51 000 EGP provenant du budget du projet. Le projet d'amélioration du canal a débuté dans un ...

  17. Les implications socio-economiques des parkings le long de la ...

    African Journals Online (AJOL)

    Cependant, ce rôle de transit s'exerce dans un contexte concurrentiel dans la mesure où le corridor togolais, essentiellement routier, n'est pas le seul qui dessert les pays enclavés. Pour faire face à cette concurrence, chaque pays côtier multiplie des opérations de charme afin d'attirer plus opérateurs économiques de ...

  18. Importance de l'introduction des langues nationales dans le systeme ...

    African Journals Online (AJOL)

    Mais malheureusement, l'enfant béninois est marqué dès le début de sa scolarisation par une situation linguistique conflictuelle entre le français langues officielle et langue d'enseignement. Malgré la prise de plusieurs décisions traduites en actes législatifs et réglementaires, l'introduction des langues nationales dans le ...

  19. Administrateur à la paie (h/f) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Résumé des fonctions L'administrateur à la paie fournit un soutien efficace et efficient au conseiller de la paye et de systèmes RH afin de garantir le bon fonctionnement des activités de la Division des ressources humaines. Le titulaire est chargé de la saisie dans les délais prescrits de données exactes dans le SIGRHP ...

  20. L'action du CRDI — le développement du secteur privé

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    Le CRDI est du nombre. Il reconnaît depuis longtemps la valeur de l'industrie, des échanges et du commerce comme moteurs de la croissance économique. Grâce au soutien concret qu'il a accordé au développement du secteur privé, le CRDI a appris que deux types d'aide peuvent porter fruit : améliorer le con- texte dans ...

  1. Une façon plus sécuritaire de combattre le paludisme au Mexique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2010 ... Le nombre de cas de paludisme a dégringolé au Mexique — de 25 023 en 1998 (un sommet) à 4 895 en 2001, puis à 1 985 en 2008. Le pays y est arrivé sans recourir au DDT. Aux termes de l'Accord de libre-échange nord‑américain, le Mexique s'était engagé à éliminer graduellement l'utilisation du DDT ...

  2. Le nouveau visage de la philanthropie en Inde | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Connectez-vous avec Nirojan sur LinkedIn. La philanthropie est en hausse en Inde et le phénomène devrait continuer à croître. La nouvelle richesse transforme également le visage des dons de charité et retient l'attention du public. Par conséquent, le nombre de conseillers en philanthropie augmente aussi. La relation ...

  3. Au-delà de la croissance rapide : combiner le paradoxe et la logique dominante pour un modèle d’hypercroissance durable

    OpenAIRE

    Chanut-Guieu, Cécile; Guieu, Gilles; Tannery, Franck; Dana, Léo-Paul

    2014-01-01

    International audience; Au-delà de la croissance rapide: Combiner le paradoxe et la logique dominant pour un modèle d'hypercroissance durable Résumé : Lorsque la PME est en croissance rapide, les enjeux qu'elle doit relever sont nombreux et exigeants. Ceci est encore plus vrai pour les PME en hypercroissance, dont le rythme de développement les amène à doubler de taille en quatre années. A travers l'analyse longitudinale et multi-méthodes de la constitution d'un groupe de taille moyenne (600 ...

  4. Festivals de cinéma dans le monde arabe

    Directory of Open Access Journals (Sweden)

    Jean-Michel Frodon

    2013-12-01

    Full Text Available Alors que les deux grands festivals « historiques » du monde arabe, Carthage (JCC et Le Caire, sont entrés en décadence, on assiste depuis le début des années 2000 à une véritable explosion du phénomène festivalier dans le monde arabe. Le pays le plus en pointe est le Maroc, quoique de manière contrastée, avec une manifestation de prestige à Marrakech, et une nuée de petites manifestations. Dans les émirats du Golfe, la multiplication des festivals traduit une stratégie de communication plutôt qu’une volonté de développement culturel. Cette stratégie est fragilisée par la concurrence que se livrent les différents acteurs. Dans les autres pays arabes, on trouve une grande variété de situations sous le signe de la dispersion. Pourtant, l’accumulation de festivals (une centaine dans la région finit par avoir des effets d’ensemble, au-delà des buts, moyens et limites de chacun d’eux. Le phénomène festivalier, bien qu’inscrit dans des agendas locaux ou nationaux, génère de manière plus vaste des réseaux générationnels, financiers, de procédures d’expertise, de processus d’interrelation, géographiques mais aussi entre le cinéma et les autres arts ou médias.

  5. Le Kongo de Sony Labou Tansi

    Directory of Open Access Journals (Sweden)

    Céline Gahungu

    2015-02-01

    Full Text Available Les textes inédits de Sony Labou Tansi proposent une réflexion sur l’histoire, et plus singulièrement sur celle du Kongo. Le souvenir du prestigieux royaume apparaît dès les premiers manuscrits, composés au début des années 1970. Loin d’être circonscrit aux écrits de jeunesse, le Kongo surgit sous de multiples formes dans le dédale des textes rédigés au cours des années suivantes. Cette fascination pousse l’écrivain dans une dynamique de recherche esthétique : comment évoquer cet illo tempore mythique sans sacrifier à une historicité convenue ? Comment inventer une écriture en mesure de rendre compte du fabuleux royaume ?L’analyse littéraire ne peut cependant faire fi du contexte politique dans lequel Sony Labou Tansi s’inscrit. Outre sa dimension historique et toponymique, Kongo est un ethnonyme dont l’auteur s’est réclamé. Celui-ci a revendiqué à de nombreuses reprises son appartenance à une identité kongo au point de s’être engagé, à la fin des années 1980, dans les rangs du MCDDI1. Ce discours identitaire et l’adhésion à un parti ethnique ont troublé l’image d’un auteur volontiers perçu comme un démocrate véritable. Est-il possible d’articuler le Kongo littéraire et le Kongo politique ? Le Kongo, dont l’ombre portée apparaît dans les manuscrits littéraires mais également dans les articles et les déclarations politiques, pourrait-il nous aider à saisir les enjeux de l’écriture protéiforme de Sony Labou Tansi ?

  6. « Tout homme est un prophète »

    Directory of Open Access Journals (Sweden)

    Anne-Cécile Pottier-Thoby

    2000-05-01

    Full Text Available Ecrivain de la spiritualité chrétienne, Julien Green, grand lecteur de la Bible, de Blake et de Léon Bloy, voit dans le romancier une sorte de prophète capable de déchiffrer les signes du temps, et "la trame invisible de l'existence". Le Journal de l'écrivain est aussi ponctué d'attentions aux présages, et aux signes annonciateurs. Dans un de ses romans, Varouna, c'est même tout le récit qui s'appuie sur un rêve prophétique. Mais Julien Green prend soin de distinguer les prophètes des faux-prophètes, comme les psychanalystes.

  7. Celui qui implose dans le vacuum de la difficulté de survivre dans le vacuum

    Directory of Open Access Journals (Sweden)

    Gaston Tremblay

    2004-03-01

    Full Text Available Le vacuum dont nous parlons découle directement de l’implosion du Canada français, c’est-à-dire du mouvement de repli qui, à la fin des années soixante, amène les Canadiens-Français à délimiter pour la première fois leurs frontières nationales. C’est en quelque sorte une conversion au réel, aussi bien pour les Québécois qui tentent alors de prendre possession de leur territoire, que pour les Franco-Ontariens qui doivent faire le deuil de leurs institutions nationales.

  8. The Plot Against America : l’auteur, le lecteur et le complot.

    Directory of Open Access Journals (Sweden)

    Arnaud Schmitt

    2008-01-01

    Full Text Available Être lecteur de Philip Roth n’est pas une sinécure. La quiétude n’est de toute façon pas ce que le lecteur assidu vient chercher dans cette œuvre intense et protéiforme. Cependant, en fonction du texte qui lui tombe entre les mains, le lecteur de passage peut s’y sentir mal accueilli. Il serait intéressant d’établir une nomenclature des types de relation qu’un auteur peut entretenir avec son lectorat, mais cette entreprise relèverait de la gageure, et ce pour deux raisons : tout d’abord, cert...

  9. Le contrôle de la reproduction chez les poissons.

    Directory of Open Access Journals (Sweden)

    CHEVASSUS B.

    1979-07-01

    Full Text Available L'utilisation de populations monosexes peut permettre d'accroître la rentabilité économique, lorsque la reproduction est trop rapide (aquaculture extensive dans les pays tropicaux ou dans le cas d'espèces où l'un des sexes est plus avantageux (meilleure vitesse de croissance ou maturation plus tardive. Nous avons analysé dans ce papier quatre méthodes permettant la production de populations monosexes. Si l'inversion sexuelle par traitement hormonal ou (a gynogenèse induite (dans le cas d'une homogamétie femelle ne semblent pas directement exploitables, on peut attendre du sexage génétique qui combine ces deux méthodes, des résultats prometteurs. L'hybridation interspécifique peut également conduire à une descendance monosexe dans des cas particuliers.

  10. Entre la complaisance et le radicalisme économique : Quelle perspective pour le développement local ?

    Directory of Open Access Journals (Sweden)

    Pierre Ducasse

    2003-05-01

    Full Text Available Ce texte présente une critique de la pratique du développement local vu sous l’angle d’un acteur actif dans le domaine. La critique est construite à partir de quatre perspectives : la complaisance, l’influence, la cohabitation et le radicalisme économique. Le texte situe le mouvement du développement local au centre de ces quatre perspectives tout en invitant les acteurs à jouer la carte du radicalisme économique.

  11. Avis 2 sur relever le défi alimentaire et celui de la valorisation non alimentaire des productions agricoles. Le cas des biocarburants liquides

    OpenAIRE

    Centre de Coopération Internationale en Recherche Agronomique pour le Développement

    2010-01-01

    Le cas des biocarburants liquides est représentatif des questions éthiques posées à la recherche agronomique pour permettre à l’agriculture de relever le triple défi alimentaire, énergétique et environnemental des années à venir. Le Comité consultatif commun d’éthique pour la recherche agronomique Inra-Cirad a adopté le 19 mars 2010 son 2e avis. Il formule neuf recommandations qui invitent les deux instituts à développer une vigilance éthique sur la finalité des recherches sur les biocarburan...

  12. Clone - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...le URL: ftp://ftp.biosciencedbc.jp/archive/clest/LATEST/clest_clone.zip File size: 660 KB Simple search URL ...ion Download License Update History of This Database Site Policy | Contact Us Clone - ClEST | LSDB Archive ...

  13. Identification de Staphylococcus aureus : est-il possible de réduire ...

    African Journals Online (AJOL)

    SARAH

    31 janv. 2014 ... influencer la recherche de la staphylocoagulase libre ? 6027. Identification de Staphylococcus aureus : est-il possible de réduire le volume de plasma de lapin sans influencer la recherche de la staphylocoagulase libre ? Bankolé H.S., Dougnon T.V., Fiogbé E.P., Amoussou A.N., Baba-Moussa L.

  14. 1 1) Pourquoi est-ce que je ne parviens pas à ouvrir les formulaires ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Faites vos calculs avec soin car votre demande pourrait ne pas être admissible.) 6) Existe-t-il une liste de pays admissibles dans lesquels mon établissement ou organisme est autorisé à travailler ou à avoir des partenaires ? Non, le CRDI n'a rien de tel; cependant, il ne soutient des travaux que dans les pays à faible.

  15. La culture matérielle enfantine entre le cute et le cool

    Directory of Open Access Journals (Sweden)

    Gilles Brougère

    2012-11-01

    Full Text Available Cet article explore la façon dont on adresse un objet à l’enfant, c’est-à-dire la rhétorique à l’œuvre pour séduire les enfants (et les parents dans certains cas. Si l’éducation peut être présente pour certains produits, domine très largement aujourd’hui une rhétorique du fun, une association de l’objet à l’enfance via le divertissement et l’insertion dans une culture des pairs. Pour partie cet adressage se fait à travers l’utilisation de personnages ou d’univers sous licence qui proposent une rhétorique du fun prête à l’emploi. Mais l’analyse des univers disponibles montre que l’on peut décomposer le fun à travers deux pôles opposés, le cute, dont Hello Kitty constitue un exemple archétypal, et le cool, que Titeuf permet de saisir dans sa logique. A travers la distinction du cute et du cool, il s’agit de contribuer à l’analyse du déploiement contemporain d’une culture du divertissement qui est incorporée aux objets de l’enfance, tout en étant un moyen de capter l’intérêt de ceux-ci.

  16. Autonymies : François la Fraise et le nom du corps

    OpenAIRE

    Beizer, Janet

    2017-01-01

    François le Champi, on en convient, est une histoire d’inceste. Le doute n’est même pas permis, puisque c’est précisément ce roman que Proust fait lire à Marcel par sa mère la nuit où cette présence maternelle tant convoitée lui est exceptionnellement accordée. Quand, bien des années plus tard, Marcel redécouvre le livre dans une nouvelle édition à la bibliothèque du prince de Guermantes, il finit par refuser de le relire, et va jusqu’à repousser un retour éventuel à l’exemplaire de son enfan...

  17. Mise en oeuvre de la théorie de la percolation pour modéliser le drainage des milieux poreux et la perméabilité relative au liquide non mouillant injecté Application of the Percolation Theory for the Simulation of Penetration Into Porous Media of a Non Wetting Fluid and the Prediction of the Relative Permeability Curve

    Directory of Open Access Journals (Sweden)

    Chatzis I.

    2006-11-01

    Full Text Available Pour comprendre les phénomènes physiques ayant lieu au sein des milieux poreux, il est nécessaire d'arriver à un modèle géométrique qui est représentatif du milieu, et qui permet de calculer ses propriétés. Dans le présent article, on étudie le comportement en drainage d'une variété de réseaux réguliers représentant l'espace des vides en utilisant, à l'aide de l'ordinateur, les techniques de la percolation des sites et des liaisons. Tous ces réseaux contiennent des liens et des nSuds et on prend en compte la corrélation qui existe entre la probabilité d'être conducteur pour un nSud et la probabilité d'être conducteur pour un lien. Au cours de l'envahissement d'un réseau, on a déterminé de nombreuses grandeurs en fonction de ces probabilités. Les résultats obtenus sur des réseaux d'une taille de 33 x 33 mailles ou de 18 x 18 x 12 mailles, sont bien représentatifs des réseaux infinis. A partir des résultats obtenus sur réseaux au moyen de la théorie de la percolation on a calculé :- la courbe de porosimétrie au mercure des grès ; - l'évolution de la saturation non conductriceen mercure caractéristique des grès ; - la courbe de la perméabilité relative au mercure caractéristique des grès, et - la courbe de la perméabilité relative à l'huile des empilements de sable. Pour pouvoir effectuer ces calculs, il a fallu tenir compte de la correspondance entre la probabilité d'être conducteur (pour un lien ou un site et la distribution cumulée des diamètres (d'un lien ou d'un nSud. Par ailleurs, on a utilisé des fonctions densité réalistes pour le diamètre des liens et des nSuds, des hypothèses tant sur la relation entre le volume et le diamètre des pores que sur leur forme moyenne, et d'autres hypothèses pour le calcul des perméabilités relatives. Les résultats calculés à partir du réseau cubique et du réseau tétraédrique, en utilisant la percolation de sites, s'accordent bien avec les

  18. Le Chien de faïence

    Directory of Open Access Journals (Sweden)

    Marie-Laure Schultze

    2011-11-01

    Full Text Available Marie-Laure Schultze est enseignante-chercheure depuis une vingtaine d'années. Elle a travaillé en Angleterre, au Canada et surtout en France, où elle est actuellement en poste à Aix-Marseille Université. Elle y a ouvert avec une collègue des ateliers (exceptionnellement rares dans les universités françaises de traduction créatrice et d’écriture plurilingue ; ces ateliers sont destinés à leurs étudiants apprenant l’anglais et consolidant le français. En parallèle, et dans les interstices laissés par sa recherche sur la place de l’écriture créatrice dans l’apprentissage des langues et sa famille (un compagnon et trois enfants constituent le noyau de la drupe, elle écrit et publie bon an mal an cahin caha ses textes (de la fiction courte, du théâtre, deux romans en chantier, des histoires pour enfants... sur son blog http://carnetdetextes.wordpress.com/

  19. Nouvelle constitution du Zimbabwe et campagne pour le droit à la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Community Working Group on Health (CWGH) est un réseau d'organismes communautaires visant à stimuler la participation des collectivités dans le domaine de la santé au moyen d'une démarche ... Five world-class research teams are working to develop vaccines for neglected livestock diseases in the Global South.

  20. Nouveau partenariat pour le développement de l'Afrique | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    économie mondiale, elle traîne derrière elle un cortège de pauvreté et de piètre gouvernance. Devant elle, la promesse d'un avenir meilleur lui est offerte par le Nouveau partenariat pour le développement de l'Afrique (NEPAD), ...

  1. Le développement a un visage et une adresse aux Philippines ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    31 janv. 2011 ... Le barangay, qui est la structure de base de l'organisation administrative, ressemble à un village. D'après le code philippin de l'administration locale, il doit compter au moins 2 000 habitants en zone rurale et 5 000 en zone urbaine. Cellule fondamentale de la planification et de la mise en application des ...

  2. : tous les projets | Page 623 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Programme: Alimentation, environnement et santé. Financement total : CA$ 300,000.00. Atténuation des risques pour la santé dans le secteur de la poterie : étude de cas à Kumbharwada, à Mumbai (Inde). Projet. Kumbharwada, dans le bidonville de Dharavi, à Mumbai, est une collectivité de quelque 1 200 familles dont la ...

  3. Établissement d'une plateforme commune de recherche sur le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    épidémie se caractérise par la complexité des sous-types de VIH, est une cible capitale pour la recherche visant à évaluer le vaccin contre le VIH. Cette subvention appuiera l'établissement d'un partenariat réunissant l'Institute of Human ...

  4. La gestion forestière communautaire dans le sud-ouest de Madagascar

    DEFF Research Database (Denmark)

    Casse, Thorkil; Milhøj, Anders

    2012-01-01

    La principale conclusion est que le modèle de transfert de la gestion forestière vers les communautés locales malgaches, du moins dans cette partie du pays, n'a pas modifié significativement l'attitude des villageois vis-à-vis de la conservation de la forêt....

  5. La Collecte de renseignements personnels dans le contexte d'une ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    whoskin

    Le CRDI est assujetti à la Loi sur la protection des renseignements personnels, L.R.C. 1985, c. P-21. (http://www.canlii.org/ca/loi/p-21/). Les renseignements recueillis dans le contexte de votre demande, dont certains peuvent être de nature personnelle, peuvent comprendre notamment ce qui suit : • études et emplois ...

  6. : tous les projets | Page 413 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    S'attaquer à la marginalisation, à la criminalité et à la violence chez les jeunes - lele du capital social communautaire. Projet. Il est maintenant reconnu que les adolescents ont besoin d'un capital social positif (réseaux sociaux, relations interpersonnelles) pour devenir des adultes productifs et socialement responsables.

  7. Le rendement du sorgho fera un bond au Soudan grâce à un semoir ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    an dernier le premier prix de l'Innovation Contest in Knowledge Management and Knowledge Sharing in Agricultural and Rural Development in the MENA Region. Ce prix est assorti d'une bourse de 5 000 $. Le WaHIP a été ...

  8. Étude ethnobotanique des plantes médicinales utilisées dans le ...

    African Journals Online (AJOL)

    SARAH

    29 févr. 2016 ... Conclusion et application des résultats : Cette étude fait ressortir les plantes médicinales utilisées dans le traitement des ... Conclusion and application of results: This study shows the medicinal plants used in the treatment of dermatological ... Vu que les terres cultivables sont rares, le pastoralisme est ...

  9. Le trouble spécifique du langage oral chez les enfants bilingues

    NARCIS (Netherlands)

    Laloi, A.; Guedin-Dumont, M.; Céleste, B.

    2013-01-01

    Le trouble spécifique du langage oral chez les enfants bilingues De par la mobilité grandissante des populations, la proportion d’enfants grandissant dans un environnement plurilingue augmente en France. En région parisienne par exemple, la proportion d’enfants bilingues est estimée à 25%. Or le

  10. : tous les projets | Page 283 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet Innovation scientifique et technologique au service des groupes à la " base de la pyramide " - Asie du Sud-Est (no 104904) que finançait le CRDI et qui vient de prendre fin appuyait la recherche sur les innovations favorables .... Sujet: DISABLED PERSONS, DISABLED WORKERS, INFORMATION TECHNOLOGY.

  11. : tous les projets | Page 27 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le lien positif entre les femmes, leur pouvoir économique, la croissance de leurs pays et le bien-être de leurs collectivités est de plus en plus reconnu à l'échelle mondiale. Région: North and Central America, South America. Programme: Employment and Growth. Financement total : CA$ 290,300.00. Soutien technique aux ...

  12. Résultats de recherche | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mars 2018 ... Le programme conjoint canado-israélien de recherche en santé est un programme d'une durée de sept années et d'un budget de 35 millions de CAD, conclu entre le CRDI, l'Israel Science Foundation, l'Azrieli Foundation et les Instituts de recherche en s. Livres.

  13. Le chaos et l'harmonie la fabrication du Réel

    CERN Document Server

    Xuan Thuan, Trinh

    1998-01-01

    Cette fin de siècle a vu un véritable bouleversement dans notre façon de concevoir le monde. Après avoir dominé la pensée occidentale pendant trois cents ans, la vision newtonienne d'un univers fragmenté, mécaniste et déterministe a fait place à celle d'un monde exubérant de créativité. Le Réel n'est plus déterminé seulement par des lois naturelles appliquées à des conditions initiales particulières, mais aussi moulé et façonné par une suite d'événements contingents et historiques qui peuvent bouleverser la réalité à son niveau le plus profond. Celui du bolide rocailleux venu percuter la Terre il y a quelque 65 millions d'années et responsable de la mort des dinosaures en est un exemple. Les lois physiques ont perdu leur rigidité. Avec l'avènement de la mécanique quantique, le hasard est entré en force dans le monde subatomique. Le monde macroscopique n'a pas été épargné. Avec la théorie du chaos, le hasard et le non-déterminisme ont envahi non seulement la vie de tous le...

  14. Le corpus lexicographique dans les langues à tradition orale: le cas ...

    African Journals Online (AJOL)

    Le sujet de cet article est la compilation du corpus lexicographique dans les langues à tradition orale, et exige une démarche différente de celle ayant une longue tradition écrite. De ce fait, ces dernières disposent d'une importante documentation pouvant servir comme base pour de nombreux sujets de recherche. L'auteur ...

  15. Le numérique pour stopper le moulin à rumeurs | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 sept. 2016 ... Au sud-est du Kenya, une information erronée peut se révéler mortelle, mais une organisation canadienne oeuvre à la prevention des conflits. Un projet financé par le CRDI mise sur la technologie des textos pour lutter contre la désinformation et à sauver des vies au Kenya. Cet article fait partie d'une série ...

  16. La croissance ne fait pas le bonheur : les économistes le savent-ils ?

    OpenAIRE

    Isabelle Cassiers; Catherine Delain

    2006-01-01

    En dépit d'une croissance économique continue, la " satisfaction de vie " des Occidentaux stagne depuis 30 ans au moins. Les économistes qui ont inscrit cette question sur leur agenda le savent parfaitement. Cette divergence entre la progression des revenus et du produit intérieur brut (PIB) par habitant, d'une part, et du bien-être, c'est-à-dire l'évaluation subjective de sa satisfaction personnelle, d'autre part, s'explique par deux facteurs principaux. D'abord, toute richesse est relative ...

  17. Malaisie : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Projet. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Région: Central Asia, Far East Asia, South Asia, Malaysia, Viet Nam, Thailand. Programme: Alimentation, environnement et ...

  18. Foire aux questions sur la bourse Regard canadien sur le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    21) Vous indiquez que les résultats du concours seront annoncés en septembre. À quelle date précisément ? 22) Qu'entend-on par l'attribution d'une bourse à titre conditionnel ? 23) Est-ce que je peux effectuer mes travaux sur le terrain en moins de trois mois ? 24) Est-ce que je peux utiliser la bourse Regard canadien sur ...

  19. Fluid Mechanics.

    Science.gov (United States)

    Drazin, Philip

    1987-01-01

    Outlines the contents of Volume II of "Principia" by Sir Isaac Newton. Reviews the contributions of subsequent scientists to the physics of fluid dynamics. Discusses the treatment of fluid mechanics in physics curricula. Highlights a few of the problems of modern research in fluid dynamics. Shows that problems still remain. (CW)

  20. Fluid Interfaces

    DEFF Research Database (Denmark)

    Hansen, Klaus Marius

    2001-01-01

    Fluid interaction, interaction by the user with the system that causes few breakdowns, is essential to many user interfaces. We present two concrete software systems that try to support fluid interaction for different work practices. Furthermore, we present specificity, generality, and minimality...... as design goals for fluid interfaces....

  1. Le principe d'Anselme : la lecture de l'argument d'Anselme par Charles Hartshorne

    NARCIS (Netherlands)

    Manson, Nadine

    2007-01-01

    Peut-on ou non prouver Dieu? Cette question tire son origine du XI-ème siècle, et plus particulièrement de celui que l'on appelle le << père de la Scolastique>>, Anselme de Canterbury. Le monde a bien changé depuis Anselme. La philosophie n'est plus divine, elle n'est plus qu'humaine. Dieu n'est

  2. : tous les projets | Page 167 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le lac Tonlé Sap, au Cambodge, est le plus grand lac d'eau douce en Asie du Sud-Est. End Date: 25 janvier 2017. Région: South Asia, Far East Asia, Cambodia, Canada. Programme: Climate Change. Financement total : CA$ 0.00. Amélioration de la gouvernance de l'eau et de l'adaptation aux changements climatiques ...

  3. Changements climatiques et infiltrations d'eau salée le long du ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Amélioration de la gouvernance de l'eau et de l'adaptation aux changements climatiques au Cambodge. Le lac Tonlé Sap, au Cambodge, est le plus grand lac d'eau douce en Asie du Sud-Est. Voir davantageAmélioration de la gouvernance de l'eau et de l'adaptation aux changements climatiques au Cambodge ...

  4. Sexospécificités | Page 199 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans le but de démystifier la « problématique » de l'eau, le Bulletin du CRDI s'est entretenu avec la gouverneure Margaret Catley-Carlson, qui s'intéresse vivement depuis une vingtaine d'années à la gestion de l'eau. Elle est présidente du Partenariat mondial de l'eau et membre de la Commission mondiale de l'eau.

  5. Technologies de l'information et de la communication pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Madame Etta est l'auteure de nombreux ouvrages et articles dans le domaine de la psychologie cognitive, de l'apprentissage, des soins aux enfants, du développement et de la nutrition, de l'étude des femmes et de l'environnement. Elle est membre de la British Psychological Society, de la Société internationale pour le ...

  6. Donner aux filles et aux femmes le pouvoir de décider | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    28 mars 2018 ... ... soutient les droits des femmes et des filles de décider – le pourcentage de femmes en âge de procréer qui utilisent une méthode de contraception moderne au Nigéria et en Tanzanie, par exemple, est respectivement de 14,7 % et de 29,2 %. Le problème est particulièrement grave chez les adolescentes, ...

  7. Répercussions de la confiscation des terres dans le nord de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le conflit en Colombie au sujet des terres est l'un des grands obstacles à la signature d'accords de paix. Les combats armés entraînent le déplacement des paysans, qui abandonnent leurs terres ou se les font confisquer. Ce phénomène est intimement lié à l'accumulation des terres par les narcotrafiquants et les seigneurs ...

  8. Le syndrome du canal carpien chez les patients hémodialysés ...

    African Journals Online (AJOL)

    Le syndrome du canal carpien (SCC) regroupe l'ensemble des signes et symptômes liés à la compression du nerf médian dans le canal carpien. Cette manifestation de l'amylose à béta2-microglobuline est une complication fréquente de l'hémodialyse au long cours. L'objectif de ce travail est d'analyser les caractéristiques ...

  9. ÉTUDE DE CAS — Costa Rica : Du choix pour le consommateur à l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 déc. 2010 ... La CPC s'est adressée aux parties en cause pour obtenir l'information qui lui permettrait d'évaluer le pouvoir de marché de chacune. Une situation atypique, car normalement, c'est la CPC qui a le fardeau de la preuve, souligne Pamela Sittenfeld, directrice générale de la CPC au moment de l'enquête, ...

  10. Le câprier, une espèce arbustive pour le développement rural durable en Algérie

    OpenAIRE

    Benseghir-Boukhari, Latifa Assia; Seridi, Ratiba

    2009-01-01

    Le câprier est l’une des rares espèces arbustives qui présente autant de qualités avec de nombreux usages.Plante spontanée, xérophyte et héliophile, elle est très répandue dans le bassin méditerranéen. Elle tolèreles conditions climatiques contraignantes des zones arides et semi-arides ainsi que des températures extrêmes.Elle peut donc jouer un rôle écologique très utile,dans ces régions, pour la protection contre l’érosion.Mais le câprier est aussi cultivé. Il fournit un condiment recherché,...

  11. Lymphome et grossesse: le point de vue de l'obstétricien, à propos de 2 cas

    Science.gov (United States)

    Amourak, Sarah; Alaoui, Fatimazahra Fdili; Jayi, Sofia; Bouguern, Hakima; Chaara, Hikmat; Melhouf, Moulay Abdelilah

    2014-01-01

    L'association lymphome et grossesse est une situation rare, mais non exceptionnelle, relevant de la coïncidence. Le lymphome vient en 4ème position des cancers rencontrés chez la femme enceinte, La clinique est trompeuse et inconstante, le diagnostic reste histologique et on distingue 2 types: lymphome malin hodgkinien (LMH) et le lymphome malin non hodgkinien (LMNH). Malgré le contexte de véritable urgence hématologique, la décision d'initier ou de différer le traitement est délicate, influencée par le type de lymphome, son extension et sa localisation, la répercussion organique, le degré de maturation f'tale, les risques obstétricaux et les valeurs éthiques, culturelles et religieuses de la patiente. Le traitement consiste essentiellement à une chimiothérapie. Le LH durant la grossesse est relativement moins agressif et d’évolution plus favorable que le LMNH. PMID:25883744

  12. Experimental study of chemical-mechanical coupling during percolation of reactive fluid through rocks under stress, in the context of the CO{sub 2} geological sequestration; Etude experimentale du couplage chimie-mecanique lors de la percolation d'un fluide reactif dans des roches sous contrainte, dans le contexte de la sequestration geologique du CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Le Guen, Y

    2006-10-15

    CO{sub 2} injection into geological repositories will induce chemical and mechanical instabilities. The study of these instabilities is based on experimental deformation of natural rock samples under stress, in the presence of fluids containing, or not, dissolved CO{sub 2}. Triaxial cells used for the experiments permitted an independent control and measurement of stress, temperature, fluid pressure and composition. Vertical strains were measured during several months, with a resolution of 1.10{sup -12} s{sup -1} on the strain rate. Simultaneously, fluids were analysed in order to quantify fluid-rock interactions. For limestone samples, percolation of CO{sub 2}-rich fluids increases strain rate by a factor 1.7 up to 5; on the other hand, sandstone deformation remained almost the same. Increase in strain rate with limestone samples was explained by injected water acidification by the CO{sub 2} which increases rock solubility and reaction kinetics. On the opposite, small effect of CO{sub 2} on quartz explains the absence of deformation. X-ray observations confirmed the importance of rock composition and structure on the porosity evolution. Numerical simulations of rock elastic properties showed increasing shear stress into the sample. Measured deformation showed an evolution of reservoir rocks mechanical properties. It was interpreted as the consequence of pressure solution mechanisms both at grains contacts and on grain free surfaces. (author)

  13. Le développement de la fonction visuelle chez l’enfant : étude bibliographique

    OpenAIRE

    Grégoire, Magalie

    2015-01-01

    La vision est le sens le plus important et le plus développé chez l’être humain, il constitue à lui seul 80 % des perceptions de notre environnement. Mais c’est aussi le sens le plus immature à la naissance. La plupart des paramètres visuels se développent durant cette période et notamment lors de la première année. Le développement de cette fonction visuelle dépend du développement anatomique des différentes structures qui composent le système optique mais aussi de l’expérience visuelle réal...

  14. Lele du faire-valoir indirect dans le renouvellement générationnel des agriculteurs irrigants en Tunisie

    Directory of Open Access Journals (Sweden)

    Amichi Hichem

    2016-01-01

    Full Text Available L’accès des jeunes agriculteurs aux ressources foncières est peu pris en compte dans les débats sur la durabilité des agricultures dans les pays du Sud. Les dispositifs de transfert foncier vers cette catégorie sociale, importante sur le plan démographique, restent rares et peu opérants. Nous montrons ici, à travers l’étude de trois situations irriguées en Tunisie, que des transferts de terres vers les jeunes existent mais qu’ils s’effectuent souvent de manière informelle, et plus à travers différentes formes de faire-valoir indirect (FVI qu’à travers un transfert de propriété. Nous analysons lele joué par le FVI dans la flexibilité des systèmes fonciers locaux et nous discutons le caractère durable des dynamiques qui en découlent. Nous discutons enfin le défi majeur que représente pour les décideurs politiques en Tunisie et au Maghreb l’inscription de cette agriculture informelle dans une perspective durable. Approfondir les connaissances sur lele joué par le FVI dans la flexibilité des systèmes fonciers et agraires locaux peut fournir des pistes de réflexion pour mieux valoriser des ressources en terre et en eau très disputées en Tunisie, et ailleurs au Maghreb.

  15. Le matérialisme scientifique

    Science.gov (United States)

    Meunier, Jean-François

    2004-03-01

    De nos jours, il arrive quotidiennement aux grands hommes d'avoir à fréquenter d'ignorants mortels épris d'une conviction maladive que la science est la grande responsable de tous les maux du monde. Évidemment sans physique atomique, il n'y aurait pas eu d'Hiroshima et sans révolution industrielle, pas de pollution et etc. Cependant, ces accusations envers le progrès technique sont tout à fait injustes, irréfléchies et, j'irai même jusqu'à dire, irresponsables, puisque le calcul, i.e. la planification, même la plus élémentaire, est ce qui caractérise le mieux, pragmatiquement, la société humaine. À mon avis, les problèmes sociaux tireraient plutôt leur origine de sciences sociales irréalistes, qui, concrètment, inspireraient ou serviraient d'alibis à ceux qui détiennent véritablement le pouvoir. Dans cet article, je tenterai donc de démontrer la meilleure véracité et efficacité du matérialisme scientifique. Cette doctrine, dont Mario Bunge est le plus illustre représentant, s'appuy sur les résultats théoriques et expérimentaux des sciences factuelles ainsi que sur l'exactitude logique des mathématiques, utilisées ici comme langage universel de l'expression des idées. Cette conception philosophique qui s'inspire principalement du modèle des théories physiques, stipule que les réalités sociales sont, comme tout autre réalité, matérielles, mathématisables et représentables comme des systèmes en interaction. En fait, le modèle des physiciens ayant historiquement fait ses preuves en matière de testabilité et de cohérence interne est proposé d'être appliquer aux sciences sociales, aujourd'hui scindées des sciences dites pures sous l'inspiration des pseudo penseurs néo-kantiens, phénoménologiques et post-moderne. Cette nouvelle approche permettrait ainsi d'évoluer plus exactement vers une compréhension des bases sociales et biologiques du comportement humain afin de développer une éthique sans cesse plus r

  16. Le kyste hydatique du cordon spermatique : une localisation exceptionnelle

    Directory of Open Access Journals (Sweden)

    Mohamed Moncef Hamdane

    2011-12-01

    Full Text Available L� hydatidose est une anthropozoonose due au developpement chez l�homme de la forme larvaire du taenia Echinococcus granulosis. La plupart des kystes hydatiques se localisent dans le foie et les poumons. Le kyste hydatique du cordon spermatique est extremement rare avec seulement 4 cas rapportes dans la litterature. Les auteurs rapportent dans cet article un nouveau cas d�hydatidose du cordon spermatique. Il s�agissait d�un homme de 40 ans qui consultait pour des douleurs scrotales evoluant depuis huit mois. L�examen clinique a mis en evidence une tumefaction mobile, inguino-scrotale, droite. L�echographie testiculaire a objective une hernie inguinale droite associee a deux kystes epididymaires bilateraux. Le patient a ete opere pour cure de son hernie avec decouverte en per-operatoire d�un kyste du cordon spermatique qui a ete reseque. L�examen anatomopathologique a conclu a une hydatidose du cordon spermatique.

  17. Mais qui a attrapé le bison de Higgs ?

    CERN Document Server

    Louapre, David

    2016-01-01

    Les premiers hommes, le Big-Bang et le boson de Higgs vous intriguent ? Vous fourmillez de questions sans toujours oser les poser à haute voix ? Ce livre est fait pour vous ! Laissez le créateur de la chaîne YouTube "Science étonnante" (près de 100 000 abonnés) vous révéler ses découvertes préférées. Vous n'avez qu'une vague idée de ce qu'est un atome ? Un gène ? Une probabilité ? Embarquez, vous en savez bien assez !

  18. Livres | Page 29 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Evictions and the Right to Housing : Experience from Canada, Chile, the Dominican Republic, South Africa, and South Korea. Le droit au logement est un droit ... Couverture du livre Communicating with Adolescents about AIDS : Experience from Eastern and Southern Africa. Communicating with Adolescents about AIDS ...

  19. Des connaissances aux politiques : Tirer le meilleur parti possible ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2009 ... La recherche exerce-t-elle une influence sur la conception des politiques et la prise de décision de la part de l'administration publique et, si c'est le cas, ... face obstacles that limit their ability to establish careers and become leaders in the fields of science, technology, engineering, and mathematics (STEM).

  20. Asie centrale | Page 35 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Soutien aux processus d'élaboration des politiques de réglementation des biotechnologies en Asie du Sud-Est. Langue French. Read more about Innovation en matière de biocarburants sous le signe de l'inclusion en Indonésie. Langue French. Read more about Toward Inclusive Biofuel ...

  1. Publications | Page 120 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'... ÉTUDE DE CAS — Rosario, ...

  2. (Vitaceae) dans le Parc National des Iles de la M

    African Journals Online (AJOL)

    SARAH

    31 juil. 2015 ... obtenus ont montré qu'une lutte biologique est envisageable à travers la chenille de Hippotion celerio, ... études sur la bio-écologie de C. quadrangularis ..... Le tableau 1 montre que les chenilles de H. celerio utilisent la plante C. quadrangularis comme source d'alimentation. La moyenne journalière de ...

  3. Programme de bourses de recherche sur le changement climatique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une faculté d'adaptation limitée est souvent reconnue comme l'un des principaux facteurs de vulnérabilité aux changements climatiques. Le programme Adaptation aux changements climatiques en Afrique (ACCA) du CRDI vise à aider les sociétés africaines à faire face aux changements climatiques. Cette subvention ...

  4. Les risques industriels et le prix des logements

    DEFF Research Database (Denmark)

    Grislain-Letrémy, Céline; Katossky, Arthur

    2013-01-01

    Le prix des logements peut diminuer du fait de la proximité d’installations industrielles. Cet effet dépend de la perception du risque par les riverains et est donc potentiellement modifié par des événements changeant la perception du risque, tels que les plans de prévention des risques technolog...

  5. Le Huchon (Hucho hucho L.. Etat des connaissances et perspectives

    Directory of Open Access Journals (Sweden)

    JATTEAU Ph.

    1991-07-01

    Full Text Available Cette revue bibliographique a pour but de présenter le huchon, Hucho hucho. Un point sur l'état des connaissances tant biologiques que techniques de l'élevage est réalisé. Les perspectives de développement de cette filière en France sont évaluées.

  6. Publications | Page 156 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Evictions and the Right to Housing : Experience from Canada, Chile, the Dominican Republic, South Africa, and South Korea. Le droit au logement est un droit fondamental de la personne réaffirmé en juin 1996 lorsque les gouvernements du monde entier se sont réunis à Istanbul, en Turquie pour Habitat II – la deuxième ...

  7. Combattre le jaunissement mortel du cocotier (FCRSAI 2e phase ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ivoire, les cocoteraies occupent environ 50 000 hectares (un hectare pour cinq agriculteurs) et produisent quelque 45 000 tonnes de coprah par année. Le coprah est l'amande desséchée du coco, d'où l'on extrait l'huile de coprah (ou de coco).

  8. La importancia de la experiencia estética y el arte actual

    OpenAIRE

    Tejada, Jesús

    2003-01-01

    Es imprescindible que la reflexión estética aborde el problema de la crisis del arte actual y que analice las distintas respuestas que en la práctica se le están dando. La renovación del diálogo con planteamientos estéticos tradicionales puede arrojar una nueva luz sobre la actividad de la creatividad artística, al destacar los conceptos de emoción y conocimiento entre otros.

  9. Fluid dynamics of dilatant fluid

    DEFF Research Database (Denmark)

    Nakanishi, Hiizu; Nagahiro, Shin-ichiro; Mitarai, Namiko

    2012-01-01

    A dense mixture of granules and liquid often shows a severe shear thickening and is called a dilatant fluid. We construct a fluid dynamics model for the dilatant fluid by introducing a phenomenological state variable for a local state of dispersed particles. With simple assumptions for an equation...

  10. Le bertillonnage en Amérique du Sud

    Directory of Open Access Journals (Sweden)

    Diego Galeano

    2011-05-01

    Full Text Available Durant la seconde moitié du XIXe siècle, plusieurs pays sud-américains entament des réformes policières dans le cadre de la construction des États nationaux. Certains « modèles policiers », bien acceptés sur le plan culturel en Europe à l'époque, vont servir d'instruments de légitimation des projets de modernisation institutionnelle mis en œuvre localement. Paris, et plus généralement le « modèle français », est alors de loin la source d'inspiration favorite des réformistes sud-américains, qu...

  11. Sur la reponse en frequence du tissu nerveux dans le cortex

    Science.gov (United States)

    Bedard, Claude

    Dans cette These de Physique, nous avons etudie la dependance en frequence du champ electrique du tissu nerveux dans le cortex. Ce champ est aussi designe par "Local field Potential" LFP dans la litterature scientifique. Cette etude est fondee sur la theorie du champ electromagnetisme de Maxwell et sur de l'information tiree de la donne experimentale. Le resultat essentiel de cette These est que la grandeur enorme du temps de relaxation de Maxwell des membranes cellulaires semble etre la cause principale de la dependance en frequence des LFPs. Cette dependance en frequence causee par chaque membrane cellulaire est l'analogue d'un circuit RC ou la resistance R est la resistivite parallele d'une membrane cellulaire, et ou la capacite C est la permittivite electrique de la membrane. L'effet resultant d'un tres grand nombre de cellules donne un spectre de Fourier dont l'enveloppe est tres pres d'un signal en 1/f. Le modele physique propose dans cette These permet de lier les mesures prises a l'interieur d'une dendrite des variations de potentiel electrique a celles prises dans le liquide extracellulaire. De plus, cette These semble ouvrir la possibilite de mesurer le temps de relaxation de Maxwell des membranes cellulaires a l'aide de la mesure de la reponse en frequence du potentiel electrique extracellulaire (LFP). Enfin, cette These permet de lever le voile sur un sujet peu etudie, principalement en raison de la difficulte que represente l'etude des phenomenes electriques dans des milieux complexes comme les tissus vivants. En particulier, le probleme du filtrage frequentiel du potentiel electrique extracellulaire est une propriete fondamentale du tissu nerveux et son origine n'est pas connue.

  12. Le sens du portrait.

    Directory of Open Access Journals (Sweden)

    Christophe Apprill

    2007-01-01

    Full Text Available À l’entrée du vieux port de Marseille, le projet Euroméditerranée prévoit la construction d’un musée, le Musée des Civilisations de l’Europe et de la Méditerranée (M ucem . Il accueillera les anciennes collections du Musée National des Arts et Traditions Populaires (M natp que les badauds en promenade au jardin d’acclimatation croisaient sans le savoir. Un concours d’architecture a été lancé, remporté par un architecte de la région, Rudy Riccioti. Son projet ...

  13. Le Nouveau Monde

    Directory of Open Access Journals (Sweden)

    Alain Musset

    2006-04-01

    Full Text Available L’histoire de la conquête du Nouveau Monde par les Européens semble devoir se résumer au destin de deux femmes chargées d’assurer le truchement entre les deux mondes et de jouer lele d’intermédiaire amoureuse ou de grande traîtresse : au Nord, Pocahontas, au Sud, La Malinche. Quand Cortés débarque en 1519 sur les côtes du Tabasco, un cacique désireux de lui plaire lui offre vingt femmes dont une superbe jeune fille, Malintzin (la Malinche, rebaptisée Marina. Celle-ci deviendra sa maîtres...

  14. S’interroger sur la météo, c’est s’interroger sur soi-même

    OpenAIRE

    Becker, Karin

    2018-01-01

    S’interroger sur la météo, c’est s’interroger sur soi-même. Car dans la perspective des sciences humaines, c’est le temps vécu qui est placé au centre de l’intérêt dans l’étude des météores, c’est-à-dire le ressenti corporel et mental sur le plan individuel et sur le plan collectif. Autrement dit, l’attention des chercheurs porte sur la « perception du climat », pour reprendre la dénomination du réseau interdisciplinaire dirigé par l’ethnologue Martin de la Soudière, la géographe climatologue...

  15. Le système alimentaire mondial est-il soluble dans le développement durable ?

    OpenAIRE

    Rastoin, J.L.

    2006-01-01

    In a process of world economic domination by an agro-industrial and agro-tertiary food system, the author wonders about the feasibility of an alternative model. The intensive agro-industrial model (financiarized, concentrated, specialized and globalized), allows remarkable results in terms of products prices and safety, but generates negative externalities. In the long term, this model could threat the food equilibrium of the populations and ecological balance of our planet. The concept of su...

  16. Rites et Condition Humaine : Leçon sur les leçons des pères

    African Journals Online (AJOL)

    uns des secrets qui le rendent, encore une fois, plus que jamais forts. Question de méthode. Nous précisons, enfin, que ce travail est rendu possible grâce à la lecture d'ouvrages portant sur les thèmes du rite, de l'initiation, du corps et de la mort.

  17. Programme Fortran 77 d\\'ajustement du modèle de géoïde EGM96 ...

    African Journals Online (AJOL)

    Les altitudes recherchées lors du nivellement sont mesurées par rapport à une surface de référence : le géoïde. Le nivellement géométrique est un processus long et onéreux, on préfère désormais procéder par nivellement GPS (Global Positioning System). La surface de référence est alors réalisée en ajustant le modèle ...

  18. Le dispositif intra-ut?rin: ? propos d?une complication rare et revue de la litt?rature

    OpenAIRE

    Kallat, Adil; Ibrahimi, Ahmed; Fahsi, Otheman; El Sayegh, Hachem; Iken, Ali; Benslimane, Lounis; Nouini, Yassine

    2017-01-01

    Le dispositif intra-ut?rin (DIU) constitue la m?thode contraceptive la plus utilis?e dans le monde. Sa migration trans-ut?rine est une complication rare et son incidence est estim?e dans la litt?rature de 1/350 insertions ? 1/10000 insertions. Nous rapportons le cas d'une patiente ?g?e de 40 ans, chez qui un DIU a ?t? pos? il y a 12 ans environ, ayant consult? pour des douleurs pelviennes et des lombalgies droites associ?es ? une h?maturie intermittente et des br?lures mictionnelles. Le bilan...

  19. Fluids engineering

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    Fluids engineering has played an important role in many applications, from ancient flood control to the design of high-speed compact turbomachinery. New applications of fluids engineering, such as in high-technology materials processing, biotechnology, and advanced combustion systems, have kept up unwaining interest in the subject. More accurate and sophisticated computational and measurement techniques are also constantly being developed and refined. On a more fundamental level, nonlinear dynamics and chaotic behavior of fluid flow are no longer an intellectual curiosity and fluid engineers are increasingly interested in finding practical applications for these emerging sciences. Applications of fluid technology to new areas, as well as the need to improve the design and to enhance the flexibility and reliability of flow-related machines and devices will continue to spur interest in fluids engineering. The objectives of the present seminar were: to exchange current information on arts, science, and technology of fluids engineering; to promote scientific cooperation between the fluids engineering communities of both nations, and to provide an opportunity for the participants and their colleagues to explore possible joint research programs in topics of high priority and mutual interest to both countries. The Seminar provided an excellent forum for reviewing the current state and future needs of fluids engineering for the two nations. With the Seminar ear-marking the first formal scientific exchange between Korea and the United States in the area of fluids engineering, the scope was deliberately left broad and general

  20. Fault Permeability and Strength Evolution Related to Fracturing and Healing Episodic Processes (Years to Millennia: the Role of Pressure Solution Évolution de la perméabilité et de la résistance des failles associée à des processus épisodiques de fracturation et colmatage (années - millénaires : lele de la dissolution cristallisation sous contrainte

    Directory of Open Access Journals (Sweden)

    Gratier J.-P.

    2011-02-01

    geological context of a faulted area. Finally, as the mechanisms of permeability and strength evolution interact and occur on various scales of time and space, they must be integrated into numerical models, which are briefly discussed. Il est bien connu que les fluides circulent le long des failles, mais il est aussi démontré que les failles se comportent en barrières imperméables. Il faut donc considérer que les failles puissent être successivement des chemins ouverts et fermés. À l’échelle de temps des activités humaines (années à millénaires, l’étude du cycle sismique offre la possibilité de construire un modèle de telles évolutions. Selon ce modèle, la fracturation sismique (ou hydraulique ouvre les chemins des fluides de manière quasi-instantanée le long des failles avec des processus d’amollissement et de fluage post-fracturation. La fermeture de ces chemins de fluide par cicatrisation de la faille est beaucoup plus progressive, associée à un durcissement et une reconstitution de pression des fluides. De tels comportements transitoires ont des conséquences majeures dans les études : de l’évolution de la perméabilité le long des failles, avecapplication à l’exploitation de réservoirs pétroliers et auxstockages de fluides et de déchets; de l’évolution des flux de fluides le long des failles avec application au bilan des échanges et à l’évolution du climat à l’échelle de la terre; du temps de retour des séismes et de la probabilité de leur occurrence. Le but est de comprendre et d’évaluer la cinétique des processus et donc les temps caractéristiques spécifiques des cycles de fracturation et de colmatage. Des résultats d’expériences de laboratoire et d’étude de failles naturelles sont présentés qui montrent comment des processus de dissolution cristallisation sous contrainte peuvent expliquer à la fois les processus de fluage et de colmatage, et la façon dont ils sont associés dans la nature. Les