Photoelectron Emission Studies in CsBr at 257 nm

International Nuclear Information System (INIS)

Maldonado, Juan R.; Liu, Zhi; Sun, Yun; Pianetta, Piero A.; Pease, Fabian W.

2006-01-01

CsBr/Cr photocathodes were found [1,2] to meet the requirements of a multi-electron beam lithography system operating with a light energy of 4.8 eV (257nm). The fact that photoemission was observed with a light energy below the reported 7.3 eV band gap for CsBr was not understood. This paper presents experimental results on the presence of intra-band gap absorption sites (IBAS) in CsBr thin film photo electron emitters, and presents a model based on IBAS to explain the observed photoelectron emission behavior at energies below band gap. A fluorescence band centered at 330 nm with a FWHM of about 0.34 eV was observed in CsBr/Cr samples under 257 nm laser illumination which can be attributed to IBAS and agrees well with previously obtained synchrotron photoelectron spectra[1] from the valence band of CsBr films

Magnetic and structural properties of mechanically alloyed Tb0.257-xNdxFe0.743 alloys, with x = 0 and 0.257

International Nuclear Information System (INIS)

Rojas Martinez, Y.; Bustos Rodriguez, H.; Oyola Lozano, D.; Perez Alcazar, G. A.; Paz, J. C.

2007-01-01

The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb 0.257-x Nd x Fe 0.743 alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the α and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.

Loci and candidate genes conferring resistance to soybean cyst nematode HG type 2.5.7.

Science.gov (United States)

Zhao, Xue; Teng, Weili; Li, Yinghui; Liu, Dongyuan; Cao, Guanglu; Li, Dongmei; Qiu, Lijuan; Zheng, Hongkun; Han, Yingpeng; Li, Wenbin

2017-06-14

Soybean (Glycine max L. Merr.) cyst nematode (SCN, Heterodera glycines I,) is a major pest of soybean worldwide. The most effective strategy to control this pest involves the use of resistant cultivars. The aim of the present study was to investigate the genome-wide genetic architecture of resistance to SCN HG Type 2.5.7 (race 1) in landrace and elite cultivated soybeans. A total of 200 diverse soybean accessions were screened for resistance to SCN HG Type 2.5.7 and genotyped through sequencing using the Specific Locus Amplified Fragment Sequencing (SLAF-seq) approach with a 6.14-fold average sequencing depth. A total of 33,194 SNPs were identified with minor allele frequencies (MAF) over 4%, covering 97% of all the genotypes. Genome-wide association mapping (GWAS) revealed thirteen SNPs associated with resistance to SCN HG Type 2.5.7. These SNPs were distributed on five chromosomes (Chr), including Chr7, 8, 14, 15 and 18. Four SNPs were novel resistance loci and nine SNPs were located near known QTL. A total of 30 genes were identified as candidate genes underlying SCN resistance. A total of sixteen novel soybean accessions were identified with significant resistance to HG Type 2.5.7. The beneficial alleles and candidate genes identified by GWAS might be valuable for improving marker-assisted breeding efficiency and exploring the molecular mechanisms underlying SCN resistance.

24 CFR 983.257 - Owner termination of tenancy and eviction.

Science.gov (United States)

2010-04-01

... (iv) do not apply to the PBV program. (In the PBV program, “good cause” does not include a business or... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.257 Owner termination of tenancy... good cause as stated in paragraph (a) of this section; (3) Refuse to renew the lease without good cause...

40 CFR 257.5 - Disposal standards for owners/operators of non-municipal non-hazardous waste disposal units that...

Science.gov (United States)

2010-07-01

... compliance with §§ 257.7 through 257.30 prior to the receipt of CESQG hazardous waste. (b) Definitions.... Waste management unit boundary means a vertical surface located at the hydraulically downgradient limit.../operators of non-municipal non-hazardous waste disposal units that receive Conditionally Exempt Small...

24 CFR 257.401 - Notice of false information from mortgagor-procedure.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of false information from... HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM Enforcement Mortgagor False Information § 257.401 Notice of false information from mortgagor-procedure. (a) If FHA finds that the mortgagor has...

24 CFR 257.203 - Calculation of up-front and annual mortgage insurance premiums for H4H program mortgages.

Science.gov (United States)

2010-04-01

... mortgage insurance premiums for H4H program mortgages. 257.203 Section 257.203 Housing and Urban... mortgage insurance premiums for H4H program mortgages. (a) Applicable premiums. Any mortgage presented for... LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM...

Magnetic and structural properties of mechanically alloyed Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys, with x = 0 and 0.257

Energy Technology Data Exchange (ETDEWEB)

Rojas Martinez, Y., E-mail: yarojas@ut.edu.co; Bustos Rodriguez, H.; Oyola Lozano, D. [University of Tolima, Department of Physics (Colombia); Perez Alcazar, G. A.; Paz, J. C. [University of Valle, Department of Physics (Colombia)

2007-02-15

The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the {alpha} and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.

47 CFR 25.257 - Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS. 25.257 Section 25.257 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...

2-(5,7-Dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetic acid

Directory of Open Access Journals (Sweden)

Hong Dae Choi

2008-08-01

Full Text Available The title compound, C13H14O3S, was prepared by alkaline hydrolysis of ethyl 2-(5,7-dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetate. In the crystal structure, the carboxyl groups are involved in intermolecular O—H...O hydrogen bonds, which link the molecules into centrosymmetric dimers. These dimers are further packed into stacks along the a axis by weak C—H...π interactions.

Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum

International Nuclear Information System (INIS)

Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.

2006-01-01

The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.

Mitochondrial DNA polymerase editing mutation, PolgD257A, disturbs stem-progenitor cell cycling in the small intestine and restricts excess fat absorption.

Science.gov (United States)

Fox, Raymond G; Magness, Scott; Kujoth, Gregory C; Prolla, Tomas A; Maeda, Nobuyo

2012-05-01

Changes in intestinal absorption of nutrients are important aspects of the aging process. To address this issue, we investigated the impact of accelerated mitochondrial DNA mutations on the stem/progenitor cells in the crypts of Lieberkühn in mice homozygous for a mitochondrial DNA polymerase gamma mutation, Polg(D257A), that exhibit accelerated aging phenotype. As early as 3-7 mo of age, the small intestine was significantly enlarged in the PolgD257A mice. The crypts of the PolgD257A mice contained 20% more cells than those of their wild-type littermates and exhibited a 10-fold increase in cellular apoptosis primarily in the stem/progenitor cell zones. Actively dividing cells were proportionally increased, yet a significantly smaller proportion of cells was in the S phase of the cell cycle. Stem cell-derived organoids from PolgD257A mice failed to develop fully in culture and exhibited fewer crypt units, indicating an impact of the mutation on the intestinal epithelial stem/progenitor cell maintenance. In addition, epithelial cell migration along the crypt-villus axis was slowed and less organized, and the ATP content in the villi was significantly reduced. On a high-fat, high-carbohydrate diet, PolgD257A mice showed significantly restricted absorption of excess lipids accompanied by an increase in fecal steatocrits. We conclude that the PolgD257A mutation causes cell cycle dysregulation in the crypts leading to the age-associated changes in the morphology of the small intestine and contributes to the restricted absorption of dietary lipids.

Mitochondrial DNA polymerase editing mutation, PolgD257A, reduces the diabetic phenotype of Akita male mice by suppressing appetite.

Science.gov (United States)

Fox, Raymond; Kim, Hyung-Suk; Reddick, Robert L; Kujoth, Gregory C; Prolla, Tomas A; Tsutsumi, Shuichi; Wada, Youichiro; Smithies, Oliver; Maeda, Nobuyo

2011-05-24

Diabetes and the development of its complications have been associated with mitochondrial DNA (mtDNA) dysfunction, but causal relationships remain undetermined. With the objective of testing whether increased mtDNA mutations exacerbate the diabetic phenotype, we have compared mice heterozygous for the Akita diabetogenic mutation (Akita) with mice homozygous for the D257A mutation in mitochondrial DNA polymerase gamma (Polg) or with mice having both mutations (Polg-Akita). The Polg-D257A protein is defective in proofreading and increases mtDNA mutations. At 3 mo of age, the Polg-Akita and Akita male mice were equally hyperglycemic. Unexpectedly, as the Polg-Akita males aged to 9 mo, their diabetic symptoms decreased. Thus, their hyperglycemia, hyperphagia and urine output declined significantly. The decrease in their food intake was accompanied by increased plasma leptin and decreased plasma ghrelin, while hypothalamic expression of the orexic gene, neuropeptide Y, was lower and expression of the anorexic gene, proopiomelanocortin, was higher. Testis function progressively worsened with age in the double mutants, and plasma testosterone levels in 9-mo-old Polg-Akita males were significantly reduced compared with Akita males. The hyperglycemia and hyperphagia returned in aged Polg-Akita males after testosterone administration. Hyperglycemia-associated distal tubular damage in the kidney also returned, and Polg-D257A-associated proximal tubular damage was enhanced. The mild diabetes of female Akita mice was not affected by the Polg-D257A mutation. We conclude that reduced diabetic symptoms of aging Polg-Akita males results from appetite suppression triggered by decreased testosterone associated with damage to the Leydig cells of the testis.

Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies

NARCIS (Netherlands)

Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.

1984-01-01

The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle

Role of Ser-257 in the sliding mechanism of NADP(H) in the reaction catalyzed by the Aspergillus fumigatus flavin-dependent ornithine N5-monooxygenase SidA.

Science.gov (United States)

Shirey, Carolyn; Badieyan, Somayesadat; Sobrado, Pablo

2013-11-08

SidA (siderophore A) is a flavin-dependent N-hydroxylating monooxygenase that is essential for virulence in Aspergillus fumigatus. SidA catalyzes the NADPH- and oxygen-dependent formation of N(5)-hydroxyornithine. In this reaction, NADPH reduces the flavin, and the resulting NADP(+) is the last product to be released. The presence of NADP(+) is essential for activity, as it is required for stabilization of the C4a-hydroperoxyflavin, which is the hydroxylating species. As part of our efforts to determine the molecular details of the role of NADP(H) in catalysis, we targeted Ser-257 for site-directed mutagenesis and performed extensive characterization of the S257A enzyme. Using a combination of steady-state and stopped-flow kinetic experiments, substrate analogs, and primary kinetic isotope effects, we show that the interaction between Ser-257 and NADP(H) is essential for stabilization of the C4a-hydroperoxyflavin. Molecular dynamics simulation results suggest that Ser-257 functions as a pivot point, allowing the nicotinamide of NADP(+) to slide into position for stabilization of the C4a-hydroperoxyflavin.

Half-lives of long-lived isotopes of transactinium elements from 228Th to 257Fm

International Nuclear Information System (INIS)

Surin, V.M.; Fomushkin, Eh.F.

1983-09-01

The experimental measurements and critical evaluation results of the long-lived isotope half-decay periods of transactinium elements (from 228 Th to 257 Fm) are given on July 1981 to be published in open literature and related to the natural radioactive decay. From the massif of the known half-decay periods the most reliable data were selected, received or evaluated and recommended for practical use; the calculations of isotope specific activities were performed on this data. (author)

Decay studies of neutron-deficient lawrencium isotopes

International Nuclear Information System (INIS)

Antalic, S.; Saro, S.; Streicher, B.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R.; Hofmann, S.; Kuusiniemi, P.; Leino, M.; Nishio, K.; Sulignano, B.

2008-01-01

The radioactive decay of the isotopes 254-256 Lr and their daughter products was investigated by means of α, prompt α-γ and delayed conversion electron-γ coincidence spectroscopy. The isotopes were produced using the reaction 48 Ca+ 209 Bi. (orig.)

Extending Penning trap mass measurements with SHIPTRAP to the heaviest elements

International Nuclear Information System (INIS)

Block, M.; Ackermann, D.; Herfurth, F.; Hofmann, S.; Blaum, K.; Droese, C.; Marx, G.; Schweikhard, L.; Düllmann, Ch. E.; Eibach, M.; Eliseev, S.; Haettner, E.; Plaß, W. R.; Scheidenberger, C.; Heßberger, F. P.; Ramirez, E. Minaya; Nesterenko, D.

2013-01-01

Penning-trap mass spectrometry of radionuclides provides accurate mass values and absolute binding energies. Such mass measurements are sensitive indicators of the nuclear structure evolution far away from stability. Recently, direct mass measurements have been extended to the heavy elements nobelium (Z=102) and lawrencium (Z=103) with the Penning-trap mass spectrometer SHIPTRAP. The results probe nuclear shell effects at N=152. New developments will pave the way to access even heavier nuclides.

Propiedades estructurales y magnéticas de aleaciones Gd0.257 -xTbxFe0.743 obtenidas por aleamiento mecánico

Directory of Open Access Journals (Sweden)

Mauricio Galvis-Patiño

2017-01-01

Full Text Available En el presente trabajo se reporta el estudio de las propiedades estructurales y magnéticas de la composición en forma de polvo de Gd0.257-xTbxFe0.743 con x=0,  0.1285,  0.257,preparados por Aleamiento Mecánico (AM en atmosfera de argón durante 72 horas mediante un molino planetario de alta energía ;la caracterización estructural se realizó por medio de Difractometría de rayos X(DRX, para la caracterización magnética se utilizó la espectroscopía Mössbauer, los ciclos de histéresis se llevaron a cabo a través de  PPMS (Physical Property Measurement System, Sistema de Medidas de Propiedades Físicas. La fase de α-Fe se presenta en los tres difractogramas mediante un pico característico cuya  intensidad disminuye al reemplazar el Tb por el Gd, presentándose la menor en x= 0 así mismo se observa un aumento de su ancho atribuible a la presencia de átomos de Gd en lugares propios del Fe. Los espectros Mössbauer (EM fueron ajustados con sextetos, dobletes, singletes y distribuciones de campo hiperfino lo que señala que el orden magnético se ve alterado al sustituir el Tb por el Gd en la composición. Las propiedades magnéticas extrínsecas de la composición en estudio, la caracterizan como materiales magnéticamente semiduros.

Kidney transplant graft outcomes in 379 257 recipients on 3 continents.

Science.gov (United States)

Merion, Robert M; Goodrich, Nathan P; Johnson, Rachel J; McDonald, Stephen P; Russ, Graeme R; Gillespie, Brenda W; Collett, David

2018-03-24

Kidney transplant outcomes that vary by program or geopolitical unit may result from variability in practice patterns or health care delivery systems. In this collaborative study, we compared kidney graft outcomes among 4 countries (United States, United Kingdom, Australia, and New Zealand) on 3 continents. We analyzed transplant and follow-up registry data from 1988-2014 for 379 257 recipients of first kidney-only transplants using Cox regression. Compared to the United States, 1-year adjusted graft failure risk was significantly higher in the United Kingdom (hazard ratio [HR] 1.22, 95% confidence interval [CI] 1.18-1.26, P < .001) and New Zealand (hazard ratio [HR] 1.29, 95% confidence interval [CI] 1.14-1.46, P < .001), but lower in Australia (HR 0.90, 95% CI 0.84-0.96, P = .001). In contrast, long-term adjusted graft failure risk (conditional on 1-year function) was significantly higher in the United States compared to Australia, New Zealand, and the United Kingdom (HR 0.74, 0.75, and 0.74, respectively; each P < .001). Thus long-term kidney graft outcomes are approximately 25% worse in the United States than in 3 other countries with well-developed kidney transplant systems. Case mix differences and residual confounding from unmeasured factors were found to be unlikely explanations. These findings suggest that identification of potentially modifiable country-specific differences in care delivery and/or practice patterns should be sought. © 2018 The American Society of Transplantation and the American Society of Transplant Surgeons.

Status of the lanthanides and actinides in the periodic table

International Nuclear Information System (INIS)

Holden, N.E.

1985-01-01

In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

Cold fusion reactions with 48Ca

International Nuclear Information System (INIS)

Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.

1989-04-01

Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs

High-accuracy coupled cluster calculations of atomic properties

Energy Technology Data Exchange (ETDEWEB)

Borschevsky, A. [School of Chemistry, Tel Aviv University, 69978 Tel Aviv, Israel and Centre for Theoretical Chemistry and Physics, The New Zealand Institute for Advanced Study, Massey University Auckland, Private Bag 102904, 0745 Auckland (New Zealand); Yakobi, H.; Eliav, E.; Kaldor, U. [School of Chemistry, Tel Aviv University, 69978 Tel Aviv (Israel)

2015-01-22

The four-component Fock-space coupled cluster and intermediate Hamiltonian methods are implemented to evaluate atomic properties. The latter include the spectra of nobelium and lawrencium (elements 102 and 103) in the range 20000-30000 cm{sup −1}, the polarizabilities of elements 112-114 and 118, required for estimating their adsorption enthalpies on surfaces used to separate them in accelerators, and the nuclear quadrupole moments of some heavy atoms. The calculations on superheavy elements are supported by the very good agreement with experiment obtained for the lighter homologues.

High-accuracy coupled cluster calculations of atomic properties

International Nuclear Information System (INIS)

Borschevsky, A.; Yakobi, H.; Eliav, E.; Kaldor, U.

2015-01-01

The four-component Fock-space coupled cluster and intermediate Hamiltonian methods are implemented to evaluate atomic properties. The latter include the spectra of nobelium and lawrencium (elements 102 and 103) in the range 20000-30000 cm −1 , the polarizabilities of elements 112-114 and 118, required for estimating their adsorption enthalpies on surfaces used to separate them in accelerators, and the nuclear quadrupole moments of some heavy atoms. The calculations on superheavy elements are supported by the very good agreement with experiment obtained for the lighter homologues

Measurement of the first ionization potential of lawrencium (element 103)

CERN Document Server

Sato, T K; Borschevsky, A; Stora, T; Sato, N; Kaneya, Y; Tsukada, K; Düllmann, Ch E; Eberhardt, K; Eliav, E; Ichikawa, S; Kaldor, U; Kratz, J V; Miyashita, S; Nagame, Y; Ooe, K; Osa, A; Renisch, D; Runke, J; Schädel, M; Thörle-Pospiech, P; Toyoshima, A; Trautmann, N

2015-01-01

The chemical properties of an element are primarily governed by the configuration of electrons in the valence shell. Relativistic effects influence the electronic structure of heavy elements in the sixth row of the periodic table, and these effects increase dramatically in the seventh row—including the actinides—even affecting ground-state configurations. Atomic s and p1/2 orbitals are stabilized by relativistic effects, whereas p3/2, d and f orbitals are destabilized, so that ground-state configurations of heavy elements may differ from those of lighter elements in the same group. The first ionization potential (IP1) is a measure of the energy required to remove one valence electron from a neutral atom, and is an atomic property that reflects the outermost electronic configuration. Precise and accurate experimental determination of IP1 gives information on the binding energy of valence electrons, and also, therefore, on the degree of relativistic stabilization. However, such measurements are hampered by ...

Achieving a Net Zero Energy Retrofit – in a humid, temperate climate – lessons from the University of Hawai’i at M&#257noa

Energy Technology Data Exchange (ETDEWEB)

Regnier, Cindy [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Harding, Ari [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Alastair [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2015-07-01

The University of Hawai’i at M&#257noa (UHM) partnered with the US Department of Energy (DOE) and the Hawai`i Clean Energy Initiative to develop and implement solutions to retrofit exiting buildings to reduce energy consumption by at least 30% as part of DOE’s Commercial Building Partnerships (CBP) Program1. Kuykendall Hall, located on the UHM campus in Honolulu, was the focus of a CBP analysis and design collaboration among the University of Hawai’i, their consultants, and Lawrence Berkeley National Laboratory (LBNL). Kuykendall Hall consists of two 1960s-era wings – a four-story wing containing classrooms, and a seven-story tower containing offices – with a total floor area of approximately 76,000 square feet (ft²).

GSK3 beta forms a tetrameric complex with endogenous PS1-CTF/NTF and beta-catenin. Effects of the D257/D385A and FAD-linked mutations.

Science.gov (United States)

Tesco, G; Tanzi, R E

2000-01-01

We have previously shown that the endogenous C-terminal fragment of presenilin 1 co-immunoprecipitates with endogenous beta-catenin. Since PS1 has been suggested to be involved in beta-catenin stabilization, we further investigated whether GSK3 beta, responsible for beta-catenin phosphorylation and degradation, is part of the PS1/beta-catenin complex. In naïve H4 and CHO cells, PS1 co-immunoprecipitated with both endogenous beta-catenin and GSK3 beta. In addition, GSK3 beta endogenously binds to the PS1-CTF/NTF complex and beta-catenin in naïve CHO cells. GSK3 beta also co-immunoprecipitated with PS1 full length in CHO cell lines overexpressing PS1 wild type. Given that it has been recently shown that PS1 mutations of aspartate 257 or 385 result in prevention of PS1 endoproteolysis and inhibition of gamma-secretase activity, we also tested whether PS1 endoproteolysis is required for beta-catenin/GSK3 beta/PS1 binding and whether PS1 FAD-linked mutations affect GSK3 beta recruitment in the PS1/beta-catenin complex. GSK3 beta was detected in PS1 immunoprecipitates from H4 cell lines overexpressing PS1 wild type, delta E10, A286E, L246V and in CHO cell lines overexpressing aspartate or M146L mutations. The latter data show that the absence of PS1 endoproteolysis (D257A/D385A and delta E10) or the presence of PS1-FAD mutations does not interfere with beta-catenin/GSK3 beta/PS1 complex formation.

Observation of a Neutral Structure near the DD[over ¯]^{*} Mass Threshold in e^{+}e^{-}→(DD[over ¯]^{*})^{0}π^{0} at sqrt[s]=4.226 and 4.257 GeV.

Science.gov (United States)

Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S Chen; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; He, X Q; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, J J; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

2015-11-27

A neutral structure in the DD[over ¯]^{*} system around the DD[over ¯]^{*} mass threshold is observed with a statistical significance greater than 10σ in the processes e^{+}e^{-}→D^{+}D^{*-}π^{0}+c.c. and e^{+}e^{-}→D^{0}D[over ¯]^{*0}π^{0}+c.c. at sqrt[s]=4.226 and 4.257 GeV in the BESIII experiment. The structure is denoted as Z_{c}(3885)^{0}. Assuming the presence of a resonance, its pole mass and width are determined to be [3885.7_{-5.7}^{+4.3}(stat)±8.4(syst)]  MeV/c^{2} and [35_{-12}^{+11}(stat)±15(syst)]  MeV, respectively. The Born cross sections are measured to be σ[e^{+}e^{-}→Z_{c}(3885)^{0}π^{0},Z_{c}(3885)^{0}→DD[over ¯]^{*}]=[77±13(stat)±17(syst)]  pb at 4.226 GeV and [47±9(stat)±10(syst)]  pb at 4.257 GeV. The ratio of decay rates B[Z_{c}(3885)^{0}→D^{+}D^{*-}+c.c.]/B[Z_{c}(3885)^{0}→D^{0}D[over ¯]^{*0}+c.c.] is determined to be 0.96±0.18(stat)±0.12(syst), consistent with no isospin violation in the process, Z_{c}(3885)^{0}→DD[over ¯]^{*}.

A Missense Mutation of G257A at Exon 3 in PEX7 CDS Was Responsible for the Incidence of Rhizomelic Chondrodysplasia Punctata Type 1

Directory of Open Access Journals (Sweden)

Marziyeh Alamatsaz

2018-02-01

Full Text Available Background Rhizomelic chondrodysplasia punctata (RCDP type 1 is among of the rare autosomal recessive peroxisome biogenesis disorders caused by mutations in the PEX7 gene. RCDP patients with the classic form of RCDP1 do not live more than 10- year. Materials and Methods In the present study, a two-year-old girl with skeletal abnormalities and dysmorphic facial appearance is reported to be suffered from RCDP. The patient's parents were second cousins and healthy and there was no similar case in the parents’ family. PEX7 gene was sequenced in the patient and her parents. Results A homozygous mutation, G257A, was identified PEX7 in the genome of patient while the parents were compound heterozygous. Conclusion Taken together, clinical presentation and peroxisome profile of the patient suggested a missense mutation led to formation of a pathogenic PEX7, responsible for incidence of RCDP.

Validation of new superheavy elements and IUPAC-IUPAP joint working group

International Nuclear Information System (INIS)

Jarlskog, Cecilia

2016-01-01

The great chemist Glenn Seaborg has written a delightful little book “Man-made Transuranium Elements”, published in 1963, in which he points out that: “The former basic criterion for the discovery of a new element – namely, chemical identification and separation from all previously-known elements – had to be changed in the case of lawrencium (element 103). This also may be true for elements beyond lawrencium.” Indeed this is what has happened. The elements with Z ≥ 103 are produced in nuclear reactions and are detected by counters. The detectors have undergone substantial refinement. For example one uses multiwire proportional chambers [for which George Charpak received the 1992 Nobel Prize in Physics] as well as solid state micro-strip detectors. In spite of this remarkable shift from chemistry to physics, the managerial staff of the International Union of Pure and Applied Chemistry (IUPAC) does not seem to be aware of what has been going on. The validation of superheavy elements should be done by physicists as the chemists lack the relevant competence as I will discuss here below. This article is about a collaboration between International Union of Pure and Applied Chemistry (IUPAC) and its sister organization International Union of Pure and Applied Physics (IUPAP), to deal with discovery of superheavy elements beyond Z = 112. I spent a great deal of time on this issue. In my opinion, the collaboration turned out to be a failure. For the sake of science, which should be our most important concern (and not politics), the rules for the future collaborations, if any, should be accurately defined and respected. The validation of new elements should be done by people who have the relevant competence – the physicists.

Chemical and nuclear properties of lawrencium (element 103) and hahnium (element 105)

International Nuclear Information System (INIS)

Henderson, R.A.

1990-01-01

The chemical and nuclear properties of Lr and Ha have been studied, using 3-minute 260 Lr and 35-second 262 Ha. The crystal ionic radius of Lr 3+ was determined by comparing its elution position from a cation-exchange resin column with those of lanthanide elements having known ionic radii. Comparisons are made to the ionic radii of the heavy actinides, Am 3+ through Es 3+ , obtained by x-ray diffraction methods, and to Md 3+ and Fm 3+ which were determined in the same manner as Lr 3+ . The hydration enthalpy of -3622 kJ/mol was calculated from the crystal ionic radius using an empirical form of the Born equation. Comparisons to the spacings between the ionic radii of the heaviest members of the lanthanide series show that the 2Z spacing between Lr 3+ and Md 3+ is anomalously small, as the ionic radius of Lr 3+ of 0.0886 nm is significantly smaller than had been expected. The chemical properties of Ha were determined relative to the lighter homologs in group 5, Nb and Ta. Group 4 and group 5 tracer activities, as well as Ha, were absorbed onto glass surfaces as a first step toward the determination of the chemical properties of Ha. Ha was found to adsorb on surfaces, a chemical property unique to the group 5 elements, and as such demonstrates that Ha has the chemical properties of a group 5 element. A solvent extraction procedure was adapted for use as a micro-scale chemical procedure to examine whether or not Ha displays eka-Ta-like chemical under conditions where Ta will be extracted into the organic phase and Nb will not. Under the conditions of this experiment Ha did not extract, and does not show eka-Ta-like chemical properties

First successful ionization of Lr (Z = 103) by a surface-ionization technique

Energy Technology Data Exchange (ETDEWEB)

Sato, Tetsuya K., E-mail: sato.tetsuya@jaea.go.jp; Sato, Nozomi; Asai, Masato; Tsukada, Kazuaki; Toyoshima, Atsushi; Ooe, Kazuhiro; Miyashita, Sunao; Schädel, Matthias [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), 2-4 Shirakata-shirane, Tokai-mura, Ibaraki 319-1195 (Japan); Kaneya, Yusuke; Nagame, Yuichiro [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), 2-4 Shirakata-shirane, Tokai-mura, Ibaraki 319-1195 (Japan); Graduate School of Science and Engineering, Ibaraki University, 2-1-1, Bunkyo, Mito, Ibaraki 310-8512 (Japan); Osa, Akihiko [Department of Research Reactor and Tandem Accelerator, Japan Atomic Energy Agency (JAEA), 2-4 Shirakata shirane, Tokai-mura, Ibaraki 319-1195 (Japan); Ichikawa, Shin-ichi [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), 2-4 Shirakata-shirane, Tokai-mura, Ibaraki 319-1195 (Japan); Nishina Center for Accelerator-Based Science, RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Stora, Thierry [ISOLDE, CERN, CH-1211 Geneva 23 (Switzerland); Kratz, Jens Volker [Institut für Kernchemie, Universität Mainz, D-55099 Mainz (Germany)

2013-02-15

We have developed a surface ionization ion-source as part of the JAEA-ISOL (Isotope Separator On-Line) setup, which is coupled to a He/CdI{sub 2} gas-jet transport system to determine the first ionization potential of the heaviest actinide lawrencium (Lr, Z = 103). The new ion-source is an improved version of the previous source that provided good ionization efficiencies for lanthanides. An additional filament was newly installed to give better control over its operation. We report, here, on the development of the new gas-jet coupled surface ion-source and on the first successful ionization and mass separation of 27-s {sup 256}Lr produced in the {sup 249}Cf + {sup 11}B reaction.

257__Omar_Tatsewarki

African Journals Online (AJOL)

User

IRRIGATED FLUVISOLS ALONG RIVER TATSEWARKI, KANO, NIGERIA ... concentrations of heavy metals in wastewater irrigated Fluvisols and in the ..... Effects of. Wastewater Discharge on Heavy Metals. Pollution in Fadama Soils in Kano ...

Electronic structure, fluorescence and photochemistry of the uranyl ion, and comparison with octahedral uranium (VI), ruthenyl (VI), rhenium (V) and osmium (VI) complexes

Energy Technology Data Exchange (ETDEWEB)

Joergensen, C K [Geneva Univ. (Switzerland)

1977-01-01

The highly anisotropic uranyl complexes (with very short U-O distances and very long distances to the ligating atoms in the equatorial plane) are compared with trans-dioxo complexes of 4d/sup 2/Ru(VI) and 5d/sup 2/Re(V) and Os(VI). A major difference is the low-lying empty 5f orbitals, and the first excited state is highly oxidizing, and sufficiently long-lived to abstract hydrogen atoms from most organic molecules. It is argued that even the low concentrations of uranyl carbonate present in sea water is excited by solar radiation roughly every 10 minutes. Octahedral U(VI)O/sub 6/ in perovskites and UF/sub 6/ are also discussed, as well as trans-lawrencium chemistry.

Hepatocellular Carcinoma in the Pediatric Population: A Population Based Clinical Outcomes Study Involving 257 Patients from the Surveillance, Epidemiology, and End Result (SEER Database (1973–2011

Directory of Open Access Journals (Sweden)

Christine S. M. Lau

2015-01-01

Full Text Available Introduction. Hepatocellular carcinoma (HCC is a rare pediatric cancer accounting for 0.5% of all pediatric malignancies. This study examines a large cohort of HCC patients in an effort to define the factors impacting clinical outcomes in pediatric HCC patients compared to adults. Methods. Demographic and clinical data on 63,771 HCC patients (257 pediatric patients ≤ 19 and 63,514 adult patients age ≥ 20 were abstracted from the SEER database (1973–2011. Results. HCC was more common among males (59.5% pediatric and 75.1% adults and Caucasians (50.4% and 50.5%, p 4 cm in size (79.6% versus 62.0%, p=0.02. Pediatric HCC patients undergoing surgery (13.107 versus 8.324 years, p4 cm in Caucasian males. Children with HCC achieve significantly longer mean overall survival compared to adults with HCC, primarily attributable to the more favorable fibrolamellar histologic variant, and more aggressive surgical intervention, which significantly improves survival.

Correction: β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade.

Science.gov (United States)

Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu

2017-01-18

Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.

40 CFR Appendix II to Part 257 - Appendix II to Part 257

Science.gov (United States)

2010-07-01

... will be a minimum of five turnings of the windrow. Heat drying: Dewatered sludge cake is dried by... are only add-on in nature. Beta ray irradiation: Sludge is irradiated with beta rays from an...

Prediction of the transition energies of atomic No and Lr by the intermediate Hamiltonian coupled cluster method

International Nuclear Information System (INIS)

Borschevsky, A.; Eliav, E.; Kaldor, U.; Vilkas, M.J.; Ishikawa, Y.

2007-01-01

Complete text of publication follows: Measurements of the spectroscopic properties of the superheavy elements present a serious challenge to the experimentalist. Their short lifetimes and the low quantities of their production necessitate reliable prediction of transition energies to avoid the need for broad wavelength scans and to assist in identifying the lines. Thus, reliable high-accuracy calculations are necessary prior and parallel to experimental research. Nobelium and Lawrencium are at present the two most likely candidates for spectroscopic measurements, with the first experiments planned at GSI, Darmstadt. The intermediate Hamiltonian (IH) coupled cluster method is applied to the ionization potentials, electron affinities, and excitation energies of atomic nobelium and lawrencium. Large basis sets are used (37s31p26d21f16g11h6i). All levels of a particular atom are obtained simultaneously by diagonalizing the IH matrix. The matrix elements correspond to all excitations from correlated occupied orbitals to virtual orbitals in a large P space, and are 'dressed' by folding in excitations to higher virtual orbitals (Q space) at the coupled cluster singles-and-doubles level. Lamb-shift corrections are included. The same approach was applied to the lighter homologues of Lr and No, lutetium and ytterbium, for which many transition energies are experimentally known, in order to assess the accuracy of the calculation. The average absolute error of 20 excitation energies of Lu is 423 cm -1 , and the error limits for Lr are therefore put at 700 cm -1 . Predicted Lr excitations with large transition moments in the prime range for the planned experiment, 20,000-30,000 cm -1 , are 7p → 8s at 20,100 cm -1 and 7p →p 7d at 28,100 cm -1 . In case of Yb, the calculated ionization potential was within 20 cm -1 of the experiment, and the average error of the 20 lowest calculated excitations was about 300 cm -1 . Hence, the error limits of nobelium are set to 800 cm -1

40 CFR 257.9 - Wetlands.

Science.gov (United States)

2010-07-01

... not locate such units in wetlands, unless the owner or operator can make the following demonstrations... actions (e.g., restoration of existing degraded wetlands or creation of man-made wetlands); and (5) Sufficient information is available to make a reasonable determination with respect to these demonstrations...

17 CFR 257.2 - Schedule.

Science.gov (United States)

2010-04-01

... records (See Item 18). 4. Organization Documents: (a) Title, franchises, and licenses: (1) Certificates of... (prepared for internal administrative or operating purposes) of estimated future income, receipts and...

25 CFR 700.257 - Definitions.

Science.gov (United States)

2010-04-01

....C. 552a. (b) Individual. As used in this subpart, “individual” means a citizen of the United States... the Commission including, but not limited to, education, financial transactions, medical history, and... photograph. (e) System of records. As used in this subpart, “System of records” means a group of any records...

40 CFR 257.21 - Applicability.

Science.gov (United States)

2010-07-01

...) Site-specific field collected measurements, sampling, and analysis of physical, chemical, and... there is no potential for migration of hazardous constituents from that unit to the uppermost aquifer...; and (5) Resource value of the underlying aquifer, including: (i) Current and future uses; (ii...

40 CFR 257.2 - Definitions.

Science.gov (United States)

2010-07-01

... grease removed from a grease trap at a restaurant. Facility means all contiguous land and structures... manure spreading operations) for agricultural purposes or for treatment and disposal. Landfill means an... industrial, commercial, mining, and agricultural operations, and from community activities, but does not...

Towards radiation detected resonance ionization spectroscopy on transfermium elements in a buffer gas cell

Energy Technology Data Exchange (ETDEWEB)

Lautenschlaeger, Felix; Walther, Thomas [Institut fuer Angewandte Physik, TU Darmstadt, 64289 Darmstadt (Germany); Laatiaoui, Mustapha; Block, Michael [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz-Institut Mainz, 55128 Mainz (Germany); Lauth, Werner; Backe, Hartmut [Institut fuer Kernphysik, JGU Mainz, 55128 Mainz (Germany); Hessberger, Fritz-Peter [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, 64291 Darmstadt (Germany)

2013-07-01

The study of the atomic structure of transfermium elements like nobelium (No) and lawrencium (Lr) via Radiation Detected Resonance Ionization Spectroscopy (RADRIS) is one of the most fascinating disciplines of modern atomic physics. It allows the determination of relativistic effects at the heaviest elements and provides a critical test of theoretical predictions. For these transfermium elements no experimental data on atomic level schemes are available at present. First experiments on {sup 254}No were performed in 2007, in which a buffer gas cell with an overall efficiency of 1%. In this experiment the evaporation temperature of nobelium was determined for the first time. To increase the efficiency of the buffer gas cell, off-line measurements have been performed with nat. ytterbium, the chemical homologue of nobelium. Also on-line experiments during a parasitic beam-time in 2012 provided an insight into the critical parameters of our setup. The results of the off-line and on-line measurements are briefly summarized in this talk.

The hydration enthalpies of Md3+ and Lr3+

International Nuclear Information System (INIS)

Bruechle, W.; Schaedel, M.; Scherer, U.W.; Kratz, J.V.

1987-10-01

Lawrencium (3-min 260 Lr) and lighter actinides were produced in the bombardement of a 249 Bk target with 18 O ions and loaded onto a cation exchange column in 0.05 M α-hydroxy-isobutyrate solution at pH = 4.85 together with the radioactive lanthanide tracers 166 Ho, 171 Er, and 171 Tm. In elutions with 0.12 M α-hydroxy-isobutyrate solution (pH = 4.85) trivalent Lr was eluted exactly together with the Er tracer and Md close to Ho. Lr elutes much later than expected based on the known elution positions of the lighter actinides and the expected analogy to the elution positions of the homologous lanthanides. From the measured elution positions, ionic radii were calculated for Lr 3+ and Md 3+ . Semiempirical models allow the calculation of the heat of hydration from the ionic radii, resulting in ΔH hyd ≅ - 3654 kJ/mol for Md 3+ and ΔH hyd ≅ - 3689 kJ/mol for Lr 3+ . (orig.)

The Use of the Delphi and Other Consensus Group Methods in Medical Education Research: A Review.

Science.gov (United States)

Humphrey-Murto, Susan; Varpio, Lara; Wood, Timothy J; Gonsalves, Carol; Ufholz, Lee-Anne; Mascioli, Kelly; Wang, Carol; Foth, Thomas

2017-10-01

Consensus group methods, such as the Delphi method and nominal group technique (NGT), are used to synthesize expert opinions when evidence is lacking. Despite their extensive use, these methods are inconsistently applied. Their use in medical education research has not been well studied. The authors set out to describe the use of consensus methods in medical education research and to assess the reporting quality of these methods and results. Using scoping review methods, the authors searched the Medline, Embase, PsycInfo, PubMed, Scopus, and ERIC databases for 2009-2016. Full-text articles that focused on medical education and the keywords Delphi, RAND, NGT, or other consensus group methods were included. A standardized extraction form was used to collect article demographic data and features reflecting methodological rigor. Of the articles reviewed, 257 met the inclusion criteria. The Modified Delphi (105/257; 40.8%), Delphi (91/257; 35.4%), and NGT (23/257; 8.9%) methods were most often used. The most common study purpose was curriculum development or reform (68/257; 26.5%), assessment tool development (55/257; 21.4%), and defining competencies (43/257; 16.7%). The reporting quality varied, with 70.0% (180/257) of articles reporting a literature review, 27.2% (70/257) reporting what background information was provided to participants, 66.1% (170/257) describing the number of participants, 40.1% (103/257) reporting if private decisions were collected, 37.7% (97/257) reporting if formal feedback of group ratings was shared, and 43.2% (111/257) defining consensus a priori. Consensus methods are poorly standardized and inconsistently used in medical education research. Improved criteria for reporting are needed.

Publications | Page 257 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

A public talk with Globe and Mail journalist Doug Saunders. A third of humanity is on the move—usually from farms ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather ...

7 CFR 1944.257 - Service coordinator.

Science.gov (United States)

2010-01-01

... professional relationships with all agencies and service providers in the community, and develop a directory of...) Maintain necessary case files on each program participant, containing such information and kept in such...) Assist the grant recipient in building informal support networks with neighbors, friends and family; and...

40 CFR 257.3-6 - Disease.

Science.gov (United States)

2010-07-01

... septic tank pumpings (Interim Final). A facility or practice involving disposal of sewage sludge or septic tank pumpings shall not exist or occur unless in compliance with paragraphs (b) (1), (2) or (3) of... trenching or burial operation.) (2) Septic tank pumpings that are applied to the land surface or...

Publications | Page 257 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Any -, Central Asia, Europe, Far East Asia, Middle East, North and Central America ... Utilization of trade agreements in Sri Lanka : perceptions of exporters vs. statistical ... in diverse cropping patterns, lifestyles and social and cultural relations. ... Research assessed the level of access to sexual and reproductive health ...

Publications | Page 257 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

TTI reports on its first two years of programming. During its first two years, the Think Tank Initiative has supported 52 institutions in ... the way we acquire, disseminate, and transform knowledge. And, as a result, knowledge production is becoming closer and more directly linked to economic competitiveness. This evolution.

17 CFR 257.1 - General instructions.

Science.gov (United States)

2010-04-01

... conflict with other legal retention requirements. Optional destruction of records relevant to pending or... statements including the transactions to which such records relate. (j) Use of technical accounting terms. For purposes of the schedules, traditional accounting terms such as ledgers, journals, registers and...

38 CFR 21.257 - Self-employment.

Science.gov (United States)

2010-07-01

.... (Authority: 38 U.S.C. 3104, 3116, 3117) (f) Feasibility analysis of a proposed self-employment business plan. VA will conduct a comprehensive review and analysis of the feasibility of a proposed business plan... amended; (6) The location of the site for the proposed business and the cost of the site, if any; and (7...

40 CFR 25.7 - Advisory groups.

Science.gov (United States)

2010-07-01

... agencies involved in activities supported by EPA financial assistance under any of the three Acts. (b) Role... should monitor the progress of the project and become familiar with issues relevant to project...

14 CFR 257.5 - Notice requirement.

Science.gov (United States)

2010-01-01

... that the corporate name of the transporting carrier and any other name under which that service is held... communication in the United States with a prospective consumer and in any telephone calls placed from the United... and shall identify the transporting carrier by its corporate name and any other name under which that...

40 CFR 257.3-7 - Air.

Science.gov (United States)

2010-07-01

... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR CLASSIFICATION OF SOLID WASTE DISPOSAL FACILITIES AND PRACTICES Classification of Solid Waste Disposal Facilities... residential, commercial, institutional or industrial solid waste. This requirement does not apply to...

42 CFR 441.257 - Informed consent.

Science.gov (United States)

2010-10-01

... otherwise entitled. (ii) A description of available alternative methods of family planning and birth control... section was effectively communicated to any individual who is blind, deaf, or otherwise handicapped; (3...

262 257 Profitability Analysis of Three Met

African Journals Online (AJOL)

2008-12-02

Dec 2, 2008 ... marketing in Maiduguri Metropolitan Area in Borno State of Nigeria. ... emphasis on “convenience” foods such as Suya. (Igene ... of the businesses of the people of the State. .... are old in the business and, therefore, managed.

27 CFR 24.257 - Labeling wine containers.

Science.gov (United States)

2010-04-01

... container of beverage wine prior to removal for consumption or sale. The minimum type size for information... wines under 7 percent alcohol is under the jurisdiction of the Food and Drug Administration. (iv) The..., 5662) (Approved by the Office of Management and Budget under control number 1512-0503) [T.D. ATF-299...

24 CFR 92.257 - Faith-based activities.

Science.gov (United States)

2010-04-01

... organization retains its authority over its internal governance, and it may retain religious terms in its..., practice, and expression of its religious beliefs, provided that it does not use direct HOME funds to...

40 CFR 257.27 - Selection of remedy.

Science.gov (United States)

2010-07-01

... currently available, but which may offer significant advantages over already available technologies in terms...; (6) Resource value of the aquifer including: (i) Current and future uses; (ii) Proximity and... and those substances are present in concentrations such that cleanup of the release from the unit...

40 CFR 257.1 - Scope and purpose.

Science.gov (United States)

2010-07-01

... disposal of solid waste by underground well injection subject to the regulations (40 CFR part 146) for the Underground Injection Control Program (UICP) under the Safe Drinking Water Act, as amended, 42 U.S.C. 3007 et... intended for return to the mine site. (3) The criteria do not apply to the land application of domestic...

Progress report 1986/87 of the chemistry department

International Nuclear Information System (INIS)

Gaeggeler, H.

1988-05-01

The following fields of activity are described: SAPHIR gas-jet; experiments for chemistry of Zr and Nb; continuous aerosol measurement by the epiphaniometer; determination of fractal structural parameters of aerosol particles; sorption and desorption of barium on glaciofluvial loose rock; cyclic behavior of metals in ground water; radon at infiltration of river water into ground water - a new method for measurement of ground water flow velocity; the borehole dilution method with bromine-82 for determination of ground water flow velocity; determination of sedimentation rates in Lake of Constance with lead-210 and cesium-137; macro- and microelements in the system spruce/ground/aerosol; the ground as support of the tree; experiments for chemistry of lawrencium; determination of excitation functions for nobelium isotopes from the fusion reaction 48 Ca + 208 Pb; determination of half life for the spontaneous fission of 254 No; the nitrogen fixation potential of agriculturally used legumes; Chernobyl-fallout measurements on size-fractional aerosols; deposition of 134,137 Cs from the Chernobyl-fallout on spruce needles and its incorporation in the needles; Chernobyl-fallout in the Swiss Alps; ion chromatography on fog samples. 64 refs., 53 figs., 4 tabs

Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

Directory of Open Access Journals (Sweden)

Jun-Hui Zhang

Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

Science.gov (United States)

Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan

2013-01-01

To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

14 CFR 257.4 - Unfair and deceptive practice.

Science.gov (United States)

2010-01-01

... violation of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket... Unfair and deceptive practice. The holding out or sale of scheduled passenger air transportation...

40 CFR 180.257 - Chloroneb; tolerances for residues.

Science.gov (United States)

2010-07-01

..., sugar, tops 0.2 Cowpea, forage 2.0 Cowpea, hay 2.0 Cattle, fat 0.2 Cattle, meat 0.2 Cattle, meat byproducts 0.2 Cotton, gin byproducts 1.0 Cotton, undelinted seed 0.2 Goat, fat 0.2 Goat, meat 0.2 Goat, meat byproducts 0.2 Hog, fat 0.2 Hog, meat 0.2 Hog, meat byproducts 0.2 Horse, fat 0.2 Horse, meat 0.2 Horse, meat...

Dicty_cDB: AFG257 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanxcknldw*nyhlgsrrf*qh*kc*sqnpgqrrxxxxspx infrw*tirr...rystrstkinlcw*tirrwsxsf*lqhskgihspfssxik rxyanxcknxhw*nhhlxg*r*x*h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanx

14 CFR 257.6 - Effective and compliance dates.

Science.gov (United States)

2010-01-01

... the selling carrier is not the transporting carrier and (ii) Of the transporting carrier's identity... transportation involving a code-share arrangement of the transporting carrier's corporate name and any other name...

24 CFR 203.257 - Creation of the contract.

Science.gov (United States)

2010-04-01

... issuance of a Mortgage Insurance Certificate, from the date of the endorsement of the credit instrument, or... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...

Dicty_cDB: SHA257 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vp*thvqiqpvv*tlqsmlmiiihvl*mlvpnqqvshipq*m*mittnvqlmhvpkkvv* lilqstlmitmpvqlilvhhqxvfptpqsivmikxpvqlihvqiqlv...v*ilqxxvtiiih vlxilamt*lvvxilqsmlmiixhvpsmpvlnqqvxlipqsmxmiitnvqlixvpkkvv* lilhsilmitm

Age and growth of Labeo gonius (Cyprinidae) in Kali river, Uttar Pradesh, India

Digital Repository Service at National Institute of Oceanography (India)

Chatterji, A.

stream_size 4 stream_content_type text/plain stream_name Asian_Fish_Sci_5_257.pdf.txt stream_source_info Asian_Fish_Sci_5_257.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

First-Principles Study of Superconductivity in Ultra- thin Pb Films

Science.gov (United States)

Noffsinger, Jesse; Cohen, Marvin L.

2010-03-01

Recently, superconductivity in ultrathin layered Pb has been confirmed in samples with as few as two atomic layers [S. Qin, J. Kim, Q. Niu, and C.-K. Shih, Science 2009]. Interestingly, the prototypical strong-coupling superconductor exhibits different Tc's for differing surface reconstructions in samples with only two monolayers. Additionally, Tc is seen to oscillate as the number of atomic layers is increased. Using first principles techniques based on Wannier functions, we analyze the electronic structure, lattice dynamics and electron-phonon coupling for varying thicknesses and surface reconstructions of layered Pb. We discuss results as they relate to superconductivity in the bulk, for which accurate calculations of superconducting properties can be compared to experiment [W. L. McMillan and J.M. Rowell, PRL 1965]. This work was supported by National Science Foundation Grant No. DMR07-05941, the U.S. Department of Energy under Contract No. DE-AC02-05CH11231. Computational resources have been provided by the Lawrencium computational cluster resource provided by the IT Division at the Lawrence Berkeley National Laboratory (Supported by the Director, Office of Science, Office of Basic Energy Sciences, of the U.S. Department of Energy under Contract No. DE-AC02-05CH11231)

Browse Title Index

African Journals Online (AJOL)

Items 251 - 257 of 257 ... ... technology in accessing maternal and child health information in Nigeria, Abstract. Oluwaseun I. Obasola, Iyabo M. Mabawonku. Vol 17, No 1 (2007), Workplace, Biographical and Motivation Factors Affecting Organisational Commitment of Records Officers in Nigerian Federal Universities, Abstract.

Search Results | Page 26 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2015-04-07

Results 251 - 257 of 257 ... Putting open data into policy : lessons from leaders around the world. Open data as a policy area is not more than five years old. Published date. April 7, 2015. Journal articles. DEVELOPMENT AID CULTURAL CHANGE SOCIAL MOVEMENTS DEVELOPMENT STRATEGY ORGANIZATIONAL ...

The Eating Disorders Inventory among Asian American College Women.

Science.gov (United States)

Tsai, Grace; Gray, James

2000-01-01

Assesses the prevalence rate of bulimic disorders among 257 female Asian Americans from 18 to 30 years old. Finds that only two of the 257 women met the classification for bulimia nervosa. Contends that the findings illustrate the need for future research among culturally different populations. (CMK)

Determination of total sulfur in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry.

Science.gov (United States)

Virgilio, Alex; Raposo, Jorge L; Cardoso, Arnaldo A; Nóbrega, Joaquim A; Gomes Neto, José A

2011-03-23

The usefulness of molecular absorption was investigated for the determination of total sulfur (S) in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry. The lines for CS at 257.595, 257.958, and 258.056 nm and for SH at 323.658, 324.064, and 327.990 nm were evaluated. Figures of merit, such as linear dynamic range, sensitivity, linear correlation, characteristic concentration, limit of detection, and precision, were established. For selected CS lines, wavelength-integrated absorbance equivalent to 3 pixels, analytical curves in the 100-2500 mg L(-1) (257.595 nm), 250-2000 mg L(-1) (257.958 nm), and 250-5000 mg L(-1) (258.056 nm) ranges with a linear correlation coefficient better than 0.9980 were obtained. Results were in agreement at a 95% confidence level (paired t test) with those obtained by gravimetry. Recoveries of S in fungicide and fertilizer samples were within the 84-109% range, and the relative standard deviation (n=12) was typically <5%.

Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105

International Nuclear Information System (INIS)

Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.

1999-01-01

The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified

Radionuclides for nuclear medicine: a nuclear physicists' view

Czech Academy of Sciences Publication Activity Database

Cantone, M.; Haddad, F.; Harissopoulos, S.; Jensen, M.; Jokinen, A.; Koster, U.; Lebeda, Ondřej; Ponsard, B.; Ratzinger, U.; Stora, T.; Tarkanyi, F.; Van Duppen, P.

2013-01-01

Roč. 40, 2 Supplement (2013), S257-S257 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : nuclear physics for medicine * EANM * medical radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

OVA-specific CD8(+)T cells do not express granzyme B during anterior chamber associated immune deviation

NARCIS (Netherlands)

Ren, Y.; Yang, P.; Li, B.; Gao, Y.; Zhou, H.; Huang, X.; Zhu, L.; Kijlstra, A.

2006-01-01

To examine antigen (Ag)-specific CTL response during anterior chamber associated immune deviation (ACAID). Methods OVA or OVA257-264 peptide was injected into the anterior chamber (AC) of C57BL/6 mice. There were 16 mice in each ACAID group induced with OVA or OVA257-264 peptide. The mice were

Human recombinant antibodies against Plasmodium falciparum merozoite surface protein 3 cloned from peripheral blood leukocytes of individuals with immunity to malaria demonstrate antiparasitic properties

DEFF Research Database (Denmark)

Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali

2006-01-01

against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...

3-(2-Fluorophenylsulfinyl-2,5,7-trimethyl-1-benzofuran

Directory of Open Access Journals (Sweden)

Hong Dae Choi

2013-06-01

Full Text Available In the title compound, C17H15FO2S, the benzofuran ring system, being essentially planar, with an r.m.s. deviation from the least-squares plane of 0.009 (2 Å, makes a dihedral angle of 79.02 (5° with the plane of the 2-fluorophenyl group. In the crystal, molecules are linked by pairs of weak C—H...O hydrogen bonds into centrosymmetric dimers.

All projects related to | Page 257 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Research on the links between tobacco farming and health problems among men, women, and children in Bangladesh will examine the health and ... was a London-based news agency that bought news features from developing world correspondents and distributed them to news media organizations around the world.

Mutation in rod PDE6 linked to congenital stationary night blindness impairs the enzyme inhibition by its gamma-subunit.

Science.gov (United States)

Muradov, Khakim G; Granovsky, Alexey E; Artemyev, Nikolai O

2003-03-25

Photoreceptor cGMP phosphodiesterase (PDE6) is the effector enzyme in the vertebrate visual transduction cascade. The activity of rod PDE6 catalytic alpha- and beta-subunits is blocked in the dark by two inhibitory Pgamma-subunits. The inhibition is released upon light-stimulation of photoreceptor cells. Mutation H258N in PDE6beta has been linked to congenital stationary night blindness (CSNB) in a large Danish family (Rambusch pedigree) (Gal, A., Orth, U., Baehr, W., Schwinger, E., and Rosenberg, T. (1994) Nat. Genet. 7, 64-67.) We have analyzed the consequences of this mutation for PDE6 function using a Pgamma-sensitive PDE6alpha'/PDE5 chimera, Chi16. Biochemical analysis of the H257N mutant, an equivalent of PDE6betaH258N, demonstrates that this substitution does not alter the ability of chimeric PDE to dimerize or the enzyme's catalytic properties. The sensitivity of H257N to a competitive inhibitor zaprinast was also unaffected. However, the mutant displayed a significant impairment in the inhibitory interaction with Pgamma, which was apparent from a approximately 20-fold increase in the K(i) value (46 nM) and incomplete maximal inhibition. The inhibitory defect of H257N is not due to perturbation of noncatalytic cGMP binding to the PDE6alpha' GAF domains. The noncatalytic cGMP-binding characteristics of the H257N mutant were similar to those of the parent PDE6alpha'/PDE5 chimera. Since rod PDE6 in the Rambusch CSNB is a catalytic heterodimer of the wild-type PDE6alpha and mutant PDE6beta, Chi16 and H257N were coexpressed, and a heterodimeric PDE, Chi16/H257N, was isolated. It displayed two Pgamma inhibitory sites with the K(i) values of 5 and 57 nM. Our results support the hypothesis that mutation H258N in PDE6beta causes CSNB through incomplete inhibition of PDE6 activity by Pgamma, which leads to desensitization of rod photoreceptors.

Structure of an N276-Dependent HIV-1 Neutralizing Antibody Targeting a Rare V5 Glycan Hole Adjacent to the CD4 Binding Site

Energy Technology Data Exchange (ETDEWEB)

Wibmer, Constantinos Kurt; Gorman, Jason; Anthony, Colin S.; Mkhize, Nonhlanhla N.; Druz, Aliaksandr; York, Talita; Schmidt, Stephen D.; Labuschagne, Phillip; Louder, Mark K.; Bailer, Robert T.; Karim, Salim S. Abdool; Mascola, John R.; Williamson, Carolyn; Moore, Penny L.; Kwong, Peter D.; Morris, Lynn (NHLS-South Africa); (NIH); (Witwatersrand); (KwaZulu-Natal)

2016-08-31

All HIV-1-infected individuals develop strain-specific neutralizing antibodies to their infecting virus, which in some cases mature into broadly neutralizing antibodies. Defining the epitopes of strain-specific antibodies that overlap conserved sites of vulnerability might provide mechanistic insights into how broadly neutralizing antibodies arise. We previously described an HIV-1 clade C-infected donor, CAP257, who developed broadly neutralizing plasma antibodies targeting an N276 glycan-dependent epitope in the CD4 binding site. The initial CD4 binding site response potently neutralized the heterologous tier 2 clade B viral strain RHPA, which was used to design resurfaced gp120 antigens for single-B-cell sorting. Here we report the isolation and structural characterization of CAP257-RH1, an N276 glycan-dependent CD4 binding site antibody representative of the early CD4 binding site plasma response in donor CAP257. The cocrystal structure of CAP257-RH1 bound to RHPA gp120 revealed critical interactions with the N276 glycan, loop D, and V5, but not with aspartic acid 368, similarly to HJ16 and 179NC75. The CAP257-RH1 monoclonal antibody was derived from the immunoglobulin-variable IGHV3-33 and IGLV3-10 genes and neutralized RHPA but not the transmitted/founder virus from donor CAP257. Its narrow neutralization breadth was attributed to a binding angle that was incompatible with glycosylated V5 loops present in almost all HIV-1 strains, including the CAP257 transmitted/founder virus. Deep sequencing of autologous CAP257 viruses, however, revealed minority variants early in infection that lacked V5 glycans. These glycan-free V5 loops are unusual holes in the glycan shield that may have been necessary for initiating this N276 glycan-dependent CD4 binding site B-cell lineage.

IMPORTANCEThe conserved CD4 binding site on gp120 is a major target for HIV-1 vaccine design, but key events in the elicitation and maturation of

Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

Data.gov (United States)

U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

24 CFR 257.120 - Appreciation sharing or up-front payment

Science.gov (United States)

2010-04-01

... the Act, the amount of the appreciation in value of a property securing an H4H program mortgage that... appreciation may be established to the satisfaction of FHA: (1) In the case of— (i) A sale of the property to...'s interest in appreciation. Upon sale or disposition of a property securing an H4H program mortgage...

Nigeria: Power and Democracy in Africa. Headline Series No. 257.

Science.gov (United States)

Herskovits, Jean

This booklet traces the emergence of a democratic government in Nigeria through military dictatorship to the writing of a constitution fashioned on the American model. Chapters include: (1) "Prologue"; (2) "Nigeria Defined"; (3) "Tragedy and Recovery: The First Republic and the Federal Military Government"; (4)…

40 CFR 257.23 - Ground-water sampling and analysis requirements.

Science.gov (United States)

2010-07-01

...: (1) Sample collection; (2) Sample preservation and shipment; (3) Analytical procedures; (4) Chain of... theory test, then the data should be transformed or a distribution-free theory test should be used. If... chart and its associated parameter values shall be protective of human health and the environment. The...

40 CFR 257.28 - Implementation of the corrective action program.

Science.gov (United States)

2010-07-01

... constituents as a result of an accident or failure of a container or handling system; and (vii) Other situations that may pose threats to human health and the environment. (b) An owner or operator may determine... alternative measures prior to implementing the alternative measures has been placed in the operating record...

The impact of mechanism on the management and outcome of penetrating colonic trauma.

Science.gov (United States)

Oosthuizen, G V; Kong, V Y; Estherhuizen, T; Bruce, J L; Laing, G L; Odendaal, J J; Clarke, D L

2018-02-01

Introduction In light of continuing controversy surrounding the management of penetrating colonic injuries, we set out to compare the outcome of penetrating colonic trauma according to whether the mechanism of injury was a stab wound or a gunshot wound. Methods Our trauma registry was interrogated for the 5-year period from January 2012 to December 2016. All patients over the age of 18 years with penetrating trauma (stab or gunshot) and with intraoperatively proven colonic injury were reviewed. Details of the colonic and concurrent abdominal injuries were recorded, together with the operative management strategy. In-hospital morbidities were divided into colon-related and non-colon related morbidities. The length of hospital stay and mortality were recorded. Direct comparison was made between patients with stab wounds and gunshot wounds to the colon. Results During the 5-year study period, 257 patients sustained a colonic injury secondary to penetrating trauma; 95% (244/257) were male and the mean age was 30 years. A total of 113 (44%) sustained a gunshot wound and the remaining 56% (144/257) sustained a stab wound. Some 88% (226/257) of all patients sustained a single colonic injury, while 12% (31/257) sustained more than one colonic injury. A total of 294 colonic injuries were found at laparotomy. Multiple colonic injuries were less commonly encountered in stab wounds (6%, 9/144 vs. 19%, 22/113, P colonic stab wounds and colonic gunshot wounds are different in terms of severity of the injury and in terms of outcome. While primary repair is almost always applicable to the management of colonic stab wounds, the same cannot be said for colonic gunshot wounds. The management of colonic gunshot wounds should be examined separately from that of stab wounds.

Recent developments for high-precision mass measurements of the heaviest elements at SHIPTRAP

International Nuclear Information System (INIS)

Minaya Ramirez, E.; Ackermann, D.; Blaum, K.; Block, M.; Droese, C.; Düllmann, Ch. E.; Eibach, M.; Eliseev, S.; Haettner, E.; Herfurth, F.; Heßberger, F.P.

2013-01-01

Highlights: • Direct high-precision mass measurements of No and Lr isotopes performed. • High-precision mass measurements with a count rate of 1 ion/hour demonstrated. • The results provide anchor points for a large region connected by alpha-decay chains. • The binding energies determine the strength of the deformed shell closure N = 152. • Technical developments and new techniques will pave the way towards heavier elements. -- Abstract: Atomic nuclei far from stability continue to challenge our understanding. For example, theoretical models have predicted an “island of stability” in the region of the superheavy elements due to the closure of spherical proton and neutron shells. Depending on the model, these are expected at Z = 114, 120 or even 126 and N = 172 or 184. Valuable information on the road to the island of stability is derived from high-precision mass measurements, which give direct access to binding energies of short-lived trans-uranium nuclei. Recently, direct mass measurements at SHIPTRAP have been extended to nobelium and lawrencium isotopes around the deformed shell gap N = 152. In order to further extend mass measurements to the region of superheavy elements, new technical developments are required to increase the performance of our setup. The sensitivity will increase through the implementation of a new detection method, where observation of one single ion is sufficient. Together with the use of a more efficient gas stopping cell, this will us allow to significantly enhance the overall efficiency of SHIPTRAP

Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser

DEFF Research Database (Denmark)

Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm

2003-01-01

Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....

Statistical Inference on Memory Structure of Processes and Its Applications to Information Theory

Science.gov (United States)

2016-05-12

8217x’!will!correspond!with!the!stringoid! matrices! ! E4=C4*log(P4)! Ea4=matrix(E4[1:256])! Es4=matrix(E4[257:496])! ! EL4 =matrix(cbind(A4,E4),length...E4))! ELa4=matrix( EL4 [1:256,1:5],length(Ea4))! ELs4=matrix( EL4 [257:496,1:5],length(Es4))! ! Ea4a=matrix(rep(0,60))! for(i!in!1:256)! for(j!in!1:60

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 257 ... Query: 9 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRD...TTLSITLD 68 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLD Sbjct: 1 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFD

Outcome, Cost, and Oversight of Iraq Reconstruction Contract W914NS-04-D-0006

Science.gov (United States)

2008-01-28

Minerals HQs Building $7,928,993 2% 03 Modernize Maternity & Pediatric Hospital – Ibn Al Baladi $8,814,353 3% 04 Ministry of Health – Healthcare...Ministerial buildings 8,257,981 8,258,377 Completed Terminated for Convenience 3 Renovate Ibn Al Baladi Hospital 9,585,023 9,365,516 4 Design and...7,331,585 237,490 688,906 8,257,981 8,258,377 8,258,377 3 Renovate Ibn Al Baladi Hospital 8,251,610 320,820 1,012,593 9,585,023 9,585,023

: tous les projets | Page 257 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Sujet: URBAN AREAS, DRUG TRAFFIC, CONFLICTS, VIOLENCE, EMERGENCY RELIEF. Région: Brazil, South America, Colombia, Haiti, North and Central America, Mexico. Programme: Gouvernance et justice. Financement total : CA$ 505,000.00. Action humanitaire dans les autres situations de violence. Projet.

40 CFR Appendix I to Part 257 - Maximum Contaminant Levels (MCLs)

Science.gov (United States)

2010-07-01

... Drinking Water Act Chemical CAS No. MCL -(mg/l) Arsenic 7440-38-2 0.05 Barium 7440-39-3 1.0 Benzene 71-343... 0.004 Lead 7439-92-1 0.05 Mercury 7439-97-6 0.002 Methoxychlor 72-43-5 0.1 Nitrate 10.0 Selenium...

Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 257

National Research Council Canada - National Science Library

Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

2005-01-01

...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

TASK 2.5.7 FIELD EXPERIMENTS TO EVALUATE COOL-COLORED ROOFING

Energy Technology Data Exchange (ETDEWEB)

Miller, William A [ORNL; Cherry, Nigel J [ORNL; Allen, Richard Lowell [ORNL; Childs, Phillip W [ORNL; Atchley, Jerald Allen [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

2010-03-01

Aesthetically pleasing dark roofs can be formulated to reflect like a highly reflective white roof in the near infrared portion of the solar spectrum. New paint pigments increase the near infrared reflectance of exterior finishes by minimizing the absorption of near-infrared radiation (NIR). The boost in the NIR reflectance drops the surface temperatures of roofs and walls, which in turn reduces cooling-energy use and provides savings for the homeowner and relief for the utilities. In moderate and hot climates, a roof surface with high solar reflectance and high thermal emittance was shown by Akbari et al. (2004) and by Parker and Sherwin (1998) to reduce the exterior temperature and produce savings in comfort cooling. The new cool color pigments can potentially reduce emissions of carbon dioxide, which in turn reduces metropolitan heat buildup and urban smog. The pigments can also help conserve water resources otherwise used to clean and process fuel consumed by fossil-fuel driven power plants. Cool roofs also result in a lower ambient temperature that further decreases the need for air conditioning, retards smog formation, and improves thermal comfort. Parker, Sonne and Sherwin (2002) demonstrated that white barrel and white flat tiles reduced cooling energy consumption by 22% of the base load used by an adjacent and identical home having direct nailed dark shingles. Part of the savings was due to the reflectance of the white tiles; however, another part was due to the mass of the tile and to the venting occurring within the double batten installation. With, Cherry and Haig (2009) have studied the influence of the thermal mass and batten space ventilation and have found that, referenced to an asphalt shingle system, it can be equivalent to an additional 28 points of solar reflectivity. The double batten arrangement has wooden counter battens laid vertically (soffit-to-ridge) against the roof deck, and then the conventional battens are laid horizontally across the counter battens, providing a nailing surface for the concrete tile. This double batten construction forms an inclined air channel running from the soffit to the ridge. The bottom surface of the channel is formed by the roof decking and is relatively flat and smooth. The top surface is created by the underside of the roofing tiles, and is designed to be an air permeable covering to alleviate the underside air pressure and minimize wind uplift on the tiles. The resulting air flows also have a cooling influence which further complicates prediction of the heat penetrating through the deck because an accurate measure of the airflow is required to predict the heat transfer. Measured temperatures and heat flows at the roof surface, within the attic and at the ceiling of the houses are discussed as well as the power usage to help gauge the benefit of cool-pigmented reflective roof products fitted with and without ventilation above the roof deck. Ventilation occurring above the deck is an inherent feature for tile roof assemblies, and is formed by an air space between the exterior face of the roof sheathing and the underside of the tile. The greater the tile s profile the greater is the effect of the ventilation which herein is termed above-sheathing ventilation (ASV). However, because of the complexity of the thermally induced flow, little credit is allowed by state and federal building codes. ASHRAE (2005) provides empirical data for the effective thermal resistance of plane air spaces. A -in. (0.0191-m) plane air space inclined at 45 with the horizontal has an RUS-0.85 (RSI-0.15) . Our intent is to help further deploy cool color pigments in roofs by conducting field experiments to evaluate the new cool-colored roofing materials in the hot climate of Southern California. The collected data will be used to showcase and market the performance of new cool-roof products and also to help formulate and validate computer codes capable of calculating the heat transfer occurring within the attic and the whole building. Field measures and computer predictions showed that the demonstration home without a NIR-reflective tile coating and without above-sheathing ventilation had the greatest roof deck heat flow and subsequently the highest electrical usage. The house with both NIR paint pigments on the tile and with ASV had the least deck heat flows and therefore caused the home to consume the least amount of energy. The relative performance of the reflective coating and the ventilation individually is less obvious, but it is clear that the combination of a reflective tile with ASV is the preferred solution for the best energy saving.

47 CFR 15.257 - Operation within the band 92-95 GHz.

Science.gov (United States)

2010-10-01

... bandwidth of at least 10 MHz, or uses an equivalent measurement method. (3) The average emission limits... section are subject to the radiofrequency radiation exposure requirements specified in 47 CFR 1.1307(b), 2...

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s V583] ... Length = 72 ... Query: 257 AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 316 ... ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL Sbjct: 1 ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 60 ...

Value of repeat brain MRI in children with focal epilepsy and negative findings on initial MRI

Energy Technology Data Exchange (ETDEWEB)

Jeon, Tae Yeon; Kim, Ji Hye; Lee, Jee Hun; Yoo, So Young; Hwang, Sook Min; Lee, Mun Hyang [Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of)

2017-08-01

To evaluate the value of repeat brain magnetic resonance imaging (MRI) in identifying potential epileptogenic lesions in children with initial MRI-negative focal epilepsy. Our Institutional Review Board approved this retrospective study and waived the requirement for informed consent. During a 15-year period, 257 children (148 boys and 109 girls) with initial MRI-negative focal epilepsy were included. After re-evaluating both initial and repeat MRIs, positive results at repeat MRI were classified into potential epileptogenic lesions (malformation of cortical development and hippocampal sclerosis) and other abnormalities. Contributing factors for improved lesion conspicuity of the initially overlooked potential epileptogenic lesions were analyzed and classified into lesion factors and imaging factors. Repeat MRI was positive in 21% (55/257) and negative in 79% cases (202/257). Of the positive results, potential epileptogenic lesions comprised 49% (27/55) and other abnormalities comprised 11% of the cases (28/257). Potential epileptogenic lesions included focal cortical dysplasia (n = 11), hippocampal sclerosis (n = 10), polymicrogyria (n = 2), heterotopic gray matter (n = 2), microlissencephaly (n = 1), and cortical tumor (n = 1). Of these, seven patients underwent surgical resection. Contributing factors for new diagnoses were classified as imaging factors alone (n = 6), lesion factors alone (n = 2), both (n = 18), and neither (n = 1). Repeat MRI revealed positive results in 21% of the children with initial MRI-negative focal epilepsy, with 50% of the positive results considered as potential epileptogenic lesions. Enhanced MRI techniques or considering the chronological changes of lesions on MRI may improve the diagnostic yield for identification of potential epileptogenic lesions on repeat MRI.

Value of repeat brain MRI in children with focal epilepsy and negative findings on initial MRI

International Nuclear Information System (INIS)

Jeon, Tae Yeon; Kim, Ji Hye; Lee, Jee Hun; Yoo, So Young; Hwang, Sook Min; Lee, Mun Hyang

2017-01-01

To evaluate the value of repeat brain magnetic resonance imaging (MRI) in identifying potential epileptogenic lesions in children with initial MRI-negative focal epilepsy. Our Institutional Review Board approved this retrospective study and waived the requirement for informed consent. During a 15-year period, 257 children (148 boys and 109 girls) with initial MRI-negative focal epilepsy were included. After re-evaluating both initial and repeat MRIs, positive results at repeat MRI were classified into potential epileptogenic lesions (malformation of cortical development and hippocampal sclerosis) and other abnormalities. Contributing factors for improved lesion conspicuity of the initially overlooked potential epileptogenic lesions were analyzed and classified into lesion factors and imaging factors. Repeat MRI was positive in 21% (55/257) and negative in 79% cases (202/257). Of the positive results, potential epileptogenic lesions comprised 49% (27/55) and other abnormalities comprised 11% of the cases (28/257). Potential epileptogenic lesions included focal cortical dysplasia (n = 11), hippocampal sclerosis (n = 10), polymicrogyria (n = 2), heterotopic gray matter (n = 2), microlissencephaly (n = 1), and cortical tumor (n = 1). Of these, seven patients underwent surgical resection. Contributing factors for new diagnoses were classified as imaging factors alone (n = 6), lesion factors alone (n = 2), both (n = 18), and neither (n = 1). Repeat MRI revealed positive results in 21% of the children with initial MRI-negative focal epilepsy, with 50% of the positive results considered as potential epileptogenic lesions. Enhanced MRI techniques or considering the chronological changes of lesions on MRI may improve the diagnostic yield for identification of potential epileptogenic lesions on repeat MRI

Physiotherapy for plantar fasciitis: a UK-wide survey of current practice.

Science.gov (United States)

Grieve, Rob; Palmer, Shea

2017-06-01

To identify how United Kingdom (UK) physiotherapists currently diagnose, assess and manage plantar fasciitis in routine practice. Online questionnaire survey. Practising physiotherapists across the UK who treat patients with plantar fasciitis. Physiotherapists were approached via 'interactive Chartered Society of Physiotherapy (CSP)' online networks and an email database of clinical educators in South West England. An online questionnaire was developed by reviewing similar existing physiotherapy surveys and consultation with experienced musculoskeletal researchers/clinicians. Descriptive statistics were used to analyse the data. 285 physiotherapists responded, with 257 complete survey responses. Pain on palpation and early morning pain were the most common diagnostic criteria, with some physiotherapists using no formal test criteria. Advice (237/257, 92%), plantar fasciitis pathology education (207/257, 81%) and general stretching exercises (189/257, 74%) were most routinely used. Prefabricated orthotics, custom made orthotics and night splints were seldom always used. For the manual therapy approach, the most frequently used modalities were massage, myofascial release, specific soft tissue mobilisations and myofascial trigger point therapy. Commonly used outcome measures were pain assessment, functional tests and range of movement. Physiotherapists appeared to follow most of the established diagnostic criteria for PF, but have not followed established outcome measure guidelines. Advice as well as education with an emphasis on self-management including calf/hamstring stretching was the most commonly reported treatment approach. There was uncertainty whether this approach accurately reflected clinical practice used throughout the UK, owing to potential response bias/unknown response rate and the low number of patients with PF treated by the respondents. Copyright © 2016 Chartered Society of Physiotherapy. Published by Elsevier Ltd. All rights reserved.

Within centre evaluation of hypercalcaemia discriminant

DEFF Research Database (Denmark)

Nielsen, Bo Friis; Conradsen, Knut

1996-01-01

Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients......). The discriminant functions correctly classified 81 and 80% of the women, respectively (NS) and respectively 75% and 64% of the men (NS) in the first and second recorded populations.......Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients...

257 Etude du cycle sexuel et l'inversion sexuelle de Pagellus bellottii

African Journals Online (AJOL)

User

Résumé. Pagellus bellottii appartient à la famille des Sparidae. Il est hermaphrodite protérogyne et est fréquent dans les débarquements au Sénégal. Le but de ce travail est d'étudier la biologie de ce poisson qui présente un intérêt économique car il est consommé localement mais aussi exporté vers les pays de l'union.

Site specific modification of the human plasma proteome by methylglyoxal

International Nuclear Information System (INIS)

Kimzey, Michael J.; Kinsky, Owen R.; Yassine, Hussein N.; Tsaprailis, George; Stump, Craig S.; Monks, Terrence J.; Lau, Serrine S.

2015-01-01

Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may

Site specific modification of the human plasma proteome by methylglyoxal

Energy Technology Data Exchange (ETDEWEB)

Kimzey, Michael J.; Kinsky, Owen R. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Yassine, Hussein N. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Tsaprailis, George [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Stump, Craig S. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Southern Arizona VA Health Care System, Tucson, AZ 85723 (United States); Monks, Terrence J. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Lau, Serrine S., E-mail: lau@pharmacy.arizona.edu [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States)

2015-12-01

Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may

The recovery and study of heavy nuclides produced in a nuclear explosion - the Hutch event

International Nuclear Information System (INIS)

Hoff, R.W.; Hulet, E.K.

1970-01-01

During the explosion of the Hutch device, the target ( 238 U and 232 Th) was subjected to a very high neutron exposure, 2.4 x 10 25 neutrons /cm 2 . Multiple neutron capture reactions resulted in the production of heavy nuclides, up to and including 257Fm. Results of the search for species with A > 257 were negative. The recovery and chemical processing of kilograms of Hutch debris has resulted in the isolation of 10 10 atoms of 257Fm, which is 10 2 times more material than has been available for experimentation in the past. Experimentally significant amounts of other rare nuclides, e.g., : 254 Cf, 251 Cf, 255 -Es, and 250 Cm, have also been separated from the Hutch debris. The production of these nuclides in thermonuclear explosions is shown to be a valuable supplement to the AEC program for reactor production of transplutonium elements. The neutron flux achieved in Hutch was insufficient to even approach production of nuclides in the region of 298 114. A much more intense neutron flux is required. In future experiments, considerable attention must be given to the problem of adequate sample recovery, in order to properly use the ability to subject targets to an exceedingly intense time-integrated neutron flux. (author)

The undefined function differs from the pointwise undefined function

OpenAIRE

Dosch, Walter (Prof.)

1993-01-01

The undefined function differs from the pointwise undefined function. - In: Joint Conference on Declarative Programming : Proceedings / Maria I. Sessa ... (eds.). - Salerno : Univ. degli Studi, 1995. - S. 257-268

AcEST: DK960686 [AcEST

Lifescience Database Archive (English)

Full Text Available NVISWNAMLAAYTYCGCNDGVLELFDQMLFQ 196 V TAL+ + +L +A VF+ ++V+SWNA++A C + V + +M + Sbjct: 192 VFMTALI----RSRKLAEALEVFEACRGKDVVSWNAVMAG...D S Sbjct: 199 RSRKLAEALEVFEACRGKDVVSWNAVMAGLVQFCCGEVPGF-WRRMCCEGVKPDNFAFSG 257 Q

Search Results | Page 5 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2013-04-01

Results 41 - 50 of 257 ... Innovation and productivity in services : an impact evaluation of Colciencias funding programs in Colombia. Published date. April 1, 2013. Papers. CHILE SERVICES Innovation ...

The Conference from the Prague Perspective

Czech Academy of Sciences Publication Activity Database

Hrubec, Marek

2017-01-01

Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

Czech Academy of Sciences Publication Activity Database

Slavický, Tomáš

2013-01-01

Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

Insect hormones: more than 50-years after the discovery of insect juvenile hormobne analogues (JHA, juvenoids)

Czech Academy of Sciences Publication Activity Database

Sláma, Karel

2013-01-01

Roč. 6, č. 4 (2013), s. 257-333 ISSN 1874-9828 Institutional support: RVO:60077344 Keywords : juvenile hormone (JH) * activation neurohormone (AH) pseudojuvenile effects * terpenoid juvenoids Subject RIV: ED - Physiology

Search Results | Page 11 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 101 - 110 of 257 ... This grant will help the Norman Paterson School of International ... Understanding Southern Influence in Cyberspace Security and ... Beyond Social Protection: Labour Markets, Entrepreneurship, and Gender Equality.

The recovery and study of heavy nuclides produced in a nuclear explosion - the Hutch event

Energy Technology Data Exchange (ETDEWEB)

Hoff, R W; Hulet, E K [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)

1970-05-15

During the explosion of the Hutch device, the target ({sup 238}U and {sup 232}Th) was subjected to a very high neutron exposure, 2.4 x 10{sup 25} neutrons /cm{sup 2}. Multiple neutron capture reactions resulted in the production of heavy nuclides, up to and including 257Fm. Results of the search for species with A > 257 were negative. The recovery and chemical processing of kilograms of Hutch debris has resulted in the isolation of 10{sup 10} atoms of 257Fm, which is 10{sup 2} times more material than has been available for experimentation in the past. Experimentally significant amounts of other rare nuclides, e.g., :{sup 254}Cf, {sup 251}Cf, {sup 255}-Es, and {sup 250}Cm, have also been separated from the Hutch debris. The production of these nuclides in thermonuclear explosions is shown to be a valuable supplement to the AEC program for reactor production of transplutonium elements. The neutron flux achieved in Hutch was insufficient to even approach production of nuclides in the region of {sup 298}114. A much more intense neutron flux is required. In future experiments, considerable attention must be given to the problem of adequate sample recovery, in order to properly use the ability to subject targets to an exceedingly intense time-integrated neutron flux. (author)

Nwidu et al., Afr J Tradit Complement Altern Med. (2014) 11(2):257 ...

African Journals Online (AJOL)

cadewumi

... semi-preparative HPLC, and the structures established by NMR (Nwidu et al., 2012b). ... fingerprint of the ESE, preliminary phyto-chemical screening, elemental and ..... Prostaglandins and serotonin: Non-peptide diarrheagenic hormones.

Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C

Indian Academy of Sciences (India)

Synthesis of spodumene and spodumene-zirconia composite ... were prepared using aqueous sol-gel method employing lithium formate, aluminium formate, ... synthesis and the processing of spodumene using different precursor compounds.

Formins: Linking Cytoskeleton and Endomembranes in Plant Cells

Czech Academy of Sciences Publication Activity Database

Cvrčková, F.; Oulehlová, Denisa; Žárský, Viktor

2015-01-01

Roč. 16, č. 1 (2015), s. 1-18 E-ISSN 1422-0067 Institutional support: RVO:61389030 Keywords : formin * actin * microtubules Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.257, year: 2015

A review of the peri-operative management of paediatric burns ...

African Journals Online (AJOL)

adversely affect surgical and anaesthetic outcomes were identified. Results. There were 257 males and .... morphine, this allowed for a higher turnover of patient numbers. Table 3 displays the total .... psychological effects. Premedication was.

Pregnancy Outcome among Patients with Sickle Cell Disease in Jos

African Journals Online (AJOL)

Zamzar

The antenatal complications included anaemia (62.9%), vaso-oclusive. (bone pain) ... Conclusion: Pregnancy in sickle cell disease patients is associated with high maternal and perinatal morbidity .... and malaria (25.7%) were other common.

Changes in γ-secretase activity and specificity caused by the introduction of consensus aspartyl protease active motif in Presenilin 1

Directory of Open Access Journals (Sweden)

Zhou Xiangdong

2008-05-01

Full Text Available Abstract Presenilin (PS1 or PS2 is an essential component of the active γ-secretase complex that liberates the Aβ peptides from amyloid precursor protein (APP. PS1 is regarded as an atypical aspartyl protease harboring two essential aspartic acids in the context of the sequence D257LV and D385FI, respectively, rather than the typical DTG...DTG catalytic motif of classical aspartyl proteases. In the present studies, we introduced the sequence DTG in PS1 at and around the catalytic D257 and D385 residues to generate three PS1 mutants: D257TG, D385TG, and the double-mutant D257TG/D385TG. The effects of these changes on the γ-secretase activity in the presence or absence of γ-secretase inhibitors and modulators were investigated. The results showed that PS1 mutants having D385TG robustly enhanced Aβ42 production compared to the wild type (wt, and were more sensitive than wt to inhibition by a classical aspartyl protease transition state mimic, and fenchylamine, a sulfonamide derivative. Unlike wt PS1 and some of its clinical mutants, all three PS1 artificial mutants decreased cleavage of Notch S3-site, suggesting that these artificial mutations may trigger conformational changes at the substrate docking and catalytic site that cause alteration of substrate specificity and inhibition pattern. Consistent with this notion, we have found that NSAID enzymatic inhibitors of COX, known modulators of the γ-secretase activity, cause PS1 mutants containing D385TG to produce higher levels of both Aβ38 and Aβ42, but to reduce levels of Aβ39, showing a pattern of Aβ formation different from that observed with wild type PS1 and its clinical mutants. This study provides an important structural clue for the rational design of drugs to inhibit processing of APP at the γ-site without interfering with Notch processing.

TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...

African Journals Online (AJOL)

GRACE

Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...

Search Results | Page 13 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 121 - 130 of 257 ... The Caribbean is a diverse group of countries, both culturally and ... unemployment and an underdeveloped formal (private) sector. ... has reduced poverty and increased labour market opportunities in Latin America.

Search Results | Page 6 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 51 - 60 of 257 ... Linking communities of practice with value chain development in ... Recognizing that value chains involve complex social and economic relationships, there ... development dynamics that lead to economic growth, poverty ...

Histopathologic Patterns of Breast Lesions in Northern Saudi Arabia

Directory of Open Access Journals (Sweden)

Hussain Gadelkarim Ahmed

2017-10-01

Full Text Available Objective: The aim of this study was to find out the prevalence rates of common types of breast cancer in Northern Saudi Arabia. Methodology: A retrospective cohort study was carried out over a five-year period in two referral hospitals. In this study 257 files were retrieved from departments of Surgery from different hospitals in Hail region, Kingdom of Saudi Arabia (KSA. Results: Of the 257 samples diagnosed using Fine Needle Aspiration Cytology (FNAC, histopathological diagnosis was confirmed for 158 patients. Of the 158 diagnosed samples, 46/158 (23.2% were ductal carcinoma, 7/158 (4.4% were lobular carcinoma, 3/158 (1.9% were mixed tumours, and 102/158 (64.6 were fibroadenoma. Conclusion: Fibroadenoma and ductal carcinoma are the prevalent breast lesions in Hail Region of Saudi Arabia.

Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm

Science.gov (United States)

Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir

2017-10-01

Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm-1 (at the 458-nm laser excitation) which shifts to 1630 cm-1 at the 257-nm laser excitation. Contrary to sp2-bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm-1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.

Search Results | Page 8 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 71 - 80 of 257 ... Integrated "farm to fork approach" to improving food and nutrition security in the Caribbean by linking agricultural ... Findings showed market-based barriers to technology adoption by farmers: ... Creating global citizens?

Search Results | Page 2 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 11 - 20 of 257 ... Harnessing big data to meet the Sustainable Development Goals ... official statistics, and facilitate development in sectors such as health, ... promoting gender equality is central to global development policy and practice.

Isolating dividing neural and brain tumour cells for gene expression profiling

Czech Academy of Sciences Publication Activity Database

Endaya, B.; Cavanagh, B.; Alowaidi, F.; Walker, T.; de Pennington, N.; Ng, J.-M.; Lam, P.Y.P.; Mackay-Sim, A.; Neužil, Jiří; Meedeniya, A.C.B.

2016-01-01

Roč. 257, JAN 15 2016 (2016), s. 121-133 ISSN 0165-0270 Institutional support: RVO:86652036 Keywords : Cell division * Click chemistry * FACS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.554, year: 2016

75 FR 25890 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

Science.gov (United States)

2010-05-10

... MNKD MannKind Corp... 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc.. 257 HK Petrohawk Energy Corp... Kinross Gold Corp. 213 MRVL Marvell 273 EP El Paso Corp. Technology Group Ltd. 215 XLP Consumer Staples...

75 FR 26312 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

Science.gov (United States)

2010-05-11

... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...

Elemental characterization of the new Czech meteorite "Morávka" by neutron and photon activation analysis

Czech Academy of Sciences Publication Activity Database

Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav

2003-01-01

Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003

a comparative study of student academic performance in on-campus

African Journals Online (AJOL)

User

demic performance (Cumulative Weighted Average Scores) between distance and on-campus students. ... one of the several programmes that is offered ... and women in the two courses in health care ..... cation for Business 77 (5):257-263.

Search Results | Page 16 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 151 - 160 of 257 ... Multi-donor Research Platform on Social Protection, Financial Inclusion and ... Child Support, Poverty and Gender Equality in the Caribbean - Phase II ... Sector within Urban Policies in Latin America and the Caribbean.

Use of the industrial yeast Candida utilis for cadmium sorption

Czech Academy of Sciences Publication Activity Database

Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel

2006-01-01

Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006

Search Results | Page 20 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 191 - 200 of 257 ... Involving urban communities in controlling dengue fever in Latin America ... For most countries, raising the minimum wage has long been considered a way ... Evaluating vocational training program for women in Brazil.

Search Results | Page 17 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 161 - 170 of 257 ... This project will focus on understanding governance issues related to ... adopting information and communication technologies (ICTs) in the process of ... Nurses are the largest single group of health professionals who ...

Komentované fytocenologické snímky z České republiky. 1.

Czech Academy of Sciences Publication Activity Database

Dřevojan, P.; Novák, P.; Sádlo, Jiří

2016-01-01

Roč. 52, č. 2 (2016), s. 257-267 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : plant communities * plant ecology * syntaxonomy Subject RIV: EF - Botanics

Search Results | Page 14 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 131 - 140 of 257 ... Filter by region .... Resilient Cities Initiative on Climate Change in Latin America and the Caribbean. This joint initiative between IDRC and the Climate and Development Knowledge Network will help strengthen ...

Agro-Science Journal of Tropical Agriculture, Food, Environment ...

African Journals Online (AJOL)

PC USER

Agro-Science Journal of Tropical Agriculture, Food, Environment and Extension. Volume 14 ... 3Department of Home Science, Nutrition and Dietetics, University of Nigeria, Nsukka,. Nigeria ..... work was found to be 25.7%. This value is higher.

Experimental in Situ Transformation of Pb Smelter Fly Ash in Acidic Soils

Czech Academy of Sciences Publication Activity Database

Ettler, V.; Mihaljevič, M.; Šebek, O.; Matys Grygar, Tomáš; Klementová, Mariana

2012-01-01

Roč. 46, č. 19 (2012), s. 10539-10548 ISSN 0013-936X Institutional research plan: CEZ:AV0Z40320502 Keywords : pollution -control residues Subject RIV: CA - Inorganic Chemistry Impact factor: 5.257, year: 2012

Drug: D04478 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D04478 Drug Hydroxypropylcellulose (JP17); Hydroxypropyl cellulose (NF); Low substituted hydroxypropylcellu...lose (JP17); Lacrisert (TN) ... CAS: 9004-64-2 PubChem: 47206330 DrugBank: DB00840 NIKKAJI: J257.400D ...

75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

Science.gov (United States)

2010-05-11

... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

Application of polyaniline dispersions by means of screen printing

Czech Academy of Sciences Publication Activity Database

Držková, M.; Peřinka, N.; Hajná, Milena; Kaplanová, M.; Stejskal, Jaroslav

2013-01-01

Roč. 19, č. 2013 (2013), s. 257-268 ISSN 1211-5541 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * colloids * screen printing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

Download this PDF file

African Journals Online (AJOL)

Uwaifoh

2012-04-30

Apr 30, 2012 ... ... by their reduced palatability, diet-induced anorexia, or systemic toxicity as reported by .... papaya (L.) in renal and DOCA-induced hypertension in the rat. ... International Journal of Crude Drug Research, 28(4): 257-266.

Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

Czech Academy of Sciences Publication Activity Database

Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

2001-01-01

Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

Antiperspirants/Deodorants and Breast Cancer

Science.gov (United States)

... measurements and mechanisms of toxicological actions on breast biology. Journal of Inorganic Biochemistry 2013; 128:257-261. [PubMed Abstract] Willhite CC, Karyakina NA, Yokel RA, et al. Systematic review of potential health risks posed by pharmaceutical, ...

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

Vocalisations of the silvery mole-rat: comparasion of vocal repertoires in subterrane an rodents with different socials systems

Czech Academy of Sciences Publication Activity Database

Knotková, E.; Veitl, S.; Šumbera, R.; Sedláček, František; Burda, H.

2009-01-01

Roč. 18, č. 3 (2009), s. 241-257 ISSN 0952-4622 Institutional research plan: CEZ:AV0Z60870520 Keywords : silvery mole-rat * bathyergidae * vocal communication Subject RIV: EG - Zoology Impact factor: 1.050, year: 2009

Clean Hands Count

Medline Plus

Full Text Available ... Gorin 243,451 views 2:57 Hand Hygiene Dance - Duration: 3:15. mohd hafiz 34,146 views ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

Polyethylene flame retarded with expandable graphite and a novel intumescent additive

CSIR Research Space (South Africa)

Focke, WW

2014-07-01

Full Text Available A novel intumescent additive was synthesized by neutralizing 3,5-diaminobenzoic acid hydrochloride salt with ammonium dihydrogen phosphate. This compound, which melts at 257 C, decomposes concurrently to release carbon dioxide gas. The flame...

CYP/PON genetic variations as determinant of organophosphate ...

Indian Academy of Sciences (India)

GURPREET KAUR

ticular disease and others do not (Rose et al. 2005). ..... Polycystic ovary syndrome,. Dadachanji et al. ..... early microvascular complications in type 1 diabetes. Diabetic ..... 257–261. Shenhar-Tsarfaty S., Waiskopf N., Ofek K., Shopin L., Usher.

Ultra violet resonance Raman spectroscopy in lignin analysis: determination of characteristic vibrations of p-hydroxyphenyl, guaiacyl, and syringyl lignin structures.

Science.gov (United States)

Saariaho, Anna-Maija; Jääskeläinen, Anna-Stiina; Nuopponen, Mari; Vuorinen, Tapani

2003-01-01

Raman spectroscopy of wood and lignin samples is preferably carried out in the near-infrared region because lignin produces an intense laser-induced fluorescence background at visible excitation wavelengths. However, excitation of aromatic and conjugated lignin structures with deep ultra violet (UV) light gives resonance-enhanced Raman signals while the overlapping fluorescence is eliminated. In this study, ultra violet resonance Raman (UVRR) spectroscopy was used to define characteristic vibration bands of model compounds of p-hydroxyphenyl, guaiacyl, and syringyl lignin structures at three excitation wavelengths (229, 244, and 257 nm). The intensities of each band, relative to the intensity of the aromatic vibration band at 1600 cm-1, were defined and the most suitable excitation wavelength was suggested for each structure. p-Hydroxyphenyl structures showed intensive characteristic bands at 1217-1214 and 1179-1167 cm-1 with excitation at 244 nm, whereas the bands of guaiacyl structures were more intensive with 257 nm excitation. Most intensive characteristic bands of guaiacyl structures were found at 1289-1279, 1187-1185, 1158-1155, and 791-704 cm-1. Syringyl structures had almost identical spectra with 244 and 257 nm excitations with characteristic bands at 1514-1506, 1333-1330, and 981-962 cm-1. The characteristic bands of the three structural units were also found from the compression wood, softwood, and hardwood samples, indicating that UVRR spectroscopy can be applied for the determination of chemical structures of lignin.

Biohydrology research after Landau 2013 conference

Czech Academy of Sciences Publication Activity Database

Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

2014-01-01

Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

Radioactive waste management and advanced nuclear fuel cycle technologies

International Nuclear Information System (INIS)

2007-01-01

In 2007 ENEA's Department of Nuclear Fusion and Fission, and Related Technologies acted according to national policy and the role assigned to ENEA FPN by Law 257/2003 regarding radioactive waste management and advanced nuclear fuel cycle technologies

Search Results | Page 25 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 241 - 250 of 257 ... ... poor, combined with less education and limited access to healthcare services. ... Overall maternal and child health indicators are among the worst in ... Influencing eating behaviors in early childhood can have a huge ...

Browse Title Index

African Journals Online (AJOL)

Items 151 - 200 of 257 ... ... of extension advisors on privatization and outsourcing as an option for ... Vol 28 (1999), Small-scale farming and extension in South Africa's ... Vol 37 (2008), Socio-economic determinants of farmers\\' adoption of ...

Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm.

Science.gov (United States)

Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir

2017-10-10

Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm -1 (at the 458-nm laser excitation) which shifts to 1630 cm -1 at the 257-nm laser excitation. Contrary to sp 2 -bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm -1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.

Recurrent Novae in M31

Czech Academy of Sciences Publication Activity Database

Shafter, A.W.; Henze, M.; Rector, T. A.; Schweizer, F.; Hornoch, Kamil; Orio, M.; Pietsch, W.; Darnley, M.J.; Williams, S.C.; Bode, M.F.; Bryan, J.

2015-01-01

Roč. 216, č. 2 (2015), 34/1-34/35 ISSN 0067-0049 Institutional support: RVO:67985815 Keywords : individual (M31) galaxies * stellar content * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

From P T -symmetric quantum mechanics to conformal field theory · Patrick Dorey Clare Dunning ... pp 251-257. Statistical features of quantum evolution · Sudhir R ... Sturm–Schrödinger equations: Formula for metric · Miloslav Znojil Hendrik B ...

LEVELS OF CHLORPYRIFOS AND ITS DEGRADATION PRODUCT 3,5,6-TRICHLORO-2-PYRIDINOL IN THE HOMES, DAY CARE CENTERS, AND URINE OF 130 NORTH CAROLINA PRESCHOOL CHILDREN

Science.gov (United States)

This study examined the aggregate exposures of 257 preschool children to pollutants commonly found in their everyday environments. A primary objective was to identify important sources and routes that contribute to the children's exposures in these environments. Participants w...

Determining the Relationship between the Use of Fixed Appliances ...

African Journals Online (AJOL)

Mike Saghiri

2011-10-07

Oct 7, 2011 ... Periodontal disease is one of the major problem and concern ... Gingival bleeding. Gingival recession. Gingival hyperplasia. No. Yes. No ... had no history of smoking. .... 15.3 years (minimum 11.6 and maximum 25.7). In all.

Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi

Czech Academy of Sciences Publication Activity Database

Voleková, Kateřina

2017-01-01

Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics

Advantages of breath testing for the early diagnosis of lung cancer

Czech Academy of Sciences Publication Activity Database

Smith, D.; Španěl, Patrik; Sule-Suso, J.

2010-01-01

Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010

Additional file 2

Indian Academy of Sciences (India)

Administrator

41, Fatty acid degradation, KEGG PATHWAY, oas00071, 13, 43, 0.10466, 0.90655 ...... 257, Hepatitis C, KEGG PATHWAY, oas05160, 20, 132, 0.86387, 0.96769 ... 264, Vitamin digestion and absorption, KEGG PATHWAY, oas04977, 2, 22 ...

Search Results | Page 3 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 21 - 30 of 257 ... Scaling open data for development in Latin America. Latin America is the most unequal region in the world and faces complex development challenges. ... Digital marketplace platforms like AirBnB and Uber, sometimes ...

Morphology of the Local Supercluster

International Nuclear Information System (INIS)

Tully, R.B.

1983-01-01

The intent of this brief note is to summarize some of the fundamental properties of the region, rich in galaxies, in which we live. A more complete account can be found in Astrophys. J., 257, p. 389, 1982. (Auth.)

Prevalence and immediate outcomes of hypoxic Ischaemic ...

African Journals Online (AJOL)

research and Publications via the Office of the Head,. Department Of Paediatrics and ... thank the nurses of neonatal ward for their assistance during data collection. ... Birth asphyxia: A review. East Asian Medical Journal 1985; 72:252 – 257. 2.

Effects of an inorganic insecticide (boric acid) against Blattella ...

African Journals Online (AJOL)

ufuoma

2013-05-01

May 1, 2013 ... Data on ovarian .... The overall data suggested an interference of boric acid with the ... solutions as baits for management of German cockroaches .... Comp. Biochem. Physiol. 135C:257-267. Tine S, Aribi N, Soltani N (2011).

Effects of Boreal Timber Rafting on the Composition of Arctic Driftwood

Czech Academy of Sciences Publication Activity Database

Hellmann, L.; Kirdyanov, A. V.; Büntgen, Ulf

2016-01-01

Roč. 7, č. 11 (2016), č. článku 257. ISSN 1999-4907 Institutional support: RVO:67179843 Keywords : boreal rivers * Arctic driftwood * timber logging * industrial floating * Siberia Subject RIV: GK - Forestry Impact factor: 1.951, year: 2016

Theoretical studies of the active-site structure, spectroscopic and thermodynamic properties, and reaction mechanism of multicopper oxidases

Czech Academy of Sciences Publication Activity Database

Rulíšek, Lubomír; Ryde, U.

2013-01-01

Roč. 257, č. 2 (2013), s. 445-458 ISSN 0010-8545 Institutional support: RVO:61388963 Keywords : multi-copper oxidases * QM/MM calculations * multireference calculations * the oretical spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 12.098, year: 2013

Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

Czech Academy of Sciences Publication Activity Database

Brankatschk, Katja; Martínek, František; Futtera, Ladislav

2017-01-01

Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

Gebed en die vorming van Christelike identiteit in Openbaring

African Journals Online (AJOL)

31 Jul 2015 ... 111.3 – Johns 2003). Deur die ... David Aune (2006:107) merk tereg op dat ... Stevenson 1995:257–272). ... sien Stevenson (2001:234). 6. ...... McKinnon, J., 1987, Music in early chrisfian worship, Cambridge University Press,.

EST Table: AV403752 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

Cost-utility of quadrivalent versus trivalent influenza vaccine in Brazil – comparison of outcomes from different static model types

Directory of Open Access Journals (Sweden)

Laure-Anne Van Bellinghen

2018-01-01

Conclusion: All three models predicted a cost per quality-adjusted life year gained for quadrivalent versus trivalent influenza vaccine in the range of R$19,257 (FLORENCE to R$22,768 (FLORA with the best available data in Brazil (Appendix A.

Towards a genetic architecture of cryptic genetic variation and ...

Indian Academy of Sciences (India)

Unknown

reprinted in this issue as a J. Genet. classic, pages 227–257). IAN DWORKIN* ... In this commentary, I will discuss the context of this work examining the genetic ... mental buffering where development was channelled in one of several ...

Complexity in behavioural organization and strongylid infection among wild chimpanzees

Czech Academy of Sciences Publication Activity Database

Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.

2017-01-01

Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

Complexity in behavioural organization and strongylid infection among wild chimpanzees

Czech Academy of Sciences Publication Activity Database

Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.

2017-01-01

Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016

On the Eulerian formulation of a stress induced platelet activation function

Czech Academy of Sciences Publication Activity Database

Bodnár, Tomáš

2014-01-01

Roč. 257, November (2014), s. 91-95 ISSN 0025-5564 Institutional support: RVO:61388998 Keywords : blood flow * platelet * stress * activation Subject RIV: BK - Fluid Dynamics Impact factor: 1.303, year: 2014 http://www.sciencedirect.com/science/article/pii/S0025556414001163

Long-term effects of CO2 enrichment on bud phenology and shoot growth patterns of Norway spruce juvenile trees

Czech Academy of Sciences Publication Activity Database

Pokorný, Radek; Tomášková, Ivana; Drápelová, I.; Kulhavý, J.; Marek, Michal V.

2010-01-01

Roč. 56, č. 6 (2010), s. 251-257 ISSN 1212-4834 R&D Projects: GA AV ČR IAA600870701 Institutional research plan: CEZ:AV0Z60870520 Keywords : bud * elevated CO2 * Norway spruce Subject RIV: EH - Ecology, Behaviour

International Journal of Natural and Applied Sciences - Vol 7, No 3 ...

African Journals Online (AJOL)

Effects of spent engine oil pollution on arable soil of Nekede Mechanic Village Owerri, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AC Udebuani, CI Okoli, H Nwigwe, PTE Ozoh, 257 – 260 ...

High-temperature oxidation of silicide-aluminide layer on the TiAl6V4 alloy prepared by liquid-phase siliconizing

Czech Academy of Sciences Publication Activity Database

Kubatík, Tomáš František

2016-01-01

Roč. 50, č. 2 (2016), s. 257-261 ISSN 1580-2949 Institutional support: RVO:61389021 Keywords : TiAl6V4 * silicides * high-temperature oxidation * liquid-phase silicon izing Subject RIV: JG - Metallurgy Impact factor: 0.436, year: 2016

Search Results | Page 12 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 111 - 120 of 257 ... The human ecological footprint exceeds what the planet can ... people in Latin America (28% of its population) live in poverty. ... This project seeks to empower women as social scientists to increase their visibility and ...

Simulation of Seed Digestion by Birds: How Does It Reflect the Real Passage Through a Pigeon's Gut?

Czech Academy of Sciences Publication Activity Database

Vazačová, Kristýna; Münzbergová, Zuzana

2013-01-01

Roč. 48, č. 2 (2013), s. 257-269 ISSN 1211-9520 R&D Projects: GA ČR GAP505/10/0593 Institutional support: RVO:67985939 Keywords : Canary Islands * endozoochory * scarification Subject RIV: EF - Botanics Impact factor: 1.612, year: 2013

Is PT -symmetric quantum theory false as a fundamental theory?

Czech Academy of Sciences Publication Activity Database

Znojil, Miloslav

2016-01-01

Roč. 56, č. 3 (2016), s. 254-257 ISSN 1210-2709 R&D Projects: GA ČR GA16-22945S Institutional support: RVO:61389005 Keywords : quantum mechanics * PT-symmetric representations of observables * masurement outcomes Subject RIV: BE - Theoretical Physics

QTL list: ldr1.3 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT64344 Cucumis sativus Cucurbitaceae ldr1.3 Mean length:diameter ratio over three... harvests little-leaf (ll) trait (ldr1.3) 1,6 ... LG_01 ... 25.7 4.6 ... 10.1007/s00122-003-1277-1 12827247

Ruth Benedictová v Československu (léto 1948)

Czech Academy of Sciences Publication Activity Database

Kubáčková, Patricie

2015-01-01

Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics

Energy transfer processes in Ca.sub.3./sub.Tb.sub.2-x./sub.Eu.sub.x./sub.Si.sub.3./sub.O.sub.12./sub. (x = 0–2)

Czech Academy of Sciences Publication Activity Database

Carrasco, I.; Bartosiewicz, Karol; Nikl, Martin; Piccinelli, F.; Bettinelli, M.

2015-01-01

Roč. 48, Oct (2015), s. 252-257 ISSN 0925-3467 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : phosphors * silico-carnotite * luminescence * energy transfer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.183, year: 2015

Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals

Czech Academy of Sciences Publication Activity Database

Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.

2004-01-01

Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004

Search Results | Page 913 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 9121 - 9130 of 9601 ... ... RESEARCH NETWORKS (257) Apply RESEARCH NETWORKS filter .... Intellectual property rights in regional trade agreements of ... Research findings and recommendations emanating from the case study of ... Regional cooperation for improvement of trade procedures : the case of Japan.

Apoteóza Sokola, armády a nového člověka: rané recepce Janáčkovy Sinfonietty

Czech Academy of Sciences Publication Activity Database

Zapletal, Miloš

2016-01-01

Roč. 53, 2/3 (2016), s. 257-287 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Leoš Janáček * Sinfonietta * reception of music * Janáček reception * reception studies Subject RIV: AL - Art, Architecture, Cultural Heritage

Gastrointestinal helminths of resident wildlife at the Federal ...

African Journals Online (AJOL)

ADEYEYE

2014-08-12

Aug 12, 2014 ... 2012) In Nigeria there is still a lacuna of data on the diseases and parasites ... management of zoological exhibits (Hotez et al.,. 2008; Thompson et al., ..... Coimbatore, Zoo's Print Journal, 15(5): 257-. 258. Wenz A, Heymenn ...

Knihy kuchyňských účtů z let 1705-1706 z fondu Šternberk-Manderscheid jako pramen k dějinám aristokratických dvorů. Několik předběžných poznámek

Czech Academy of Sciences Publication Activity Database

Franc, Martin

2002-01-01

Roč. 52, č. 1 (2002), s. 257-277 ISSN 0036-5246 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z8063914 Keywords : Sternberg-Manderscheid Archive * court management Subject RIV: AB - History

SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies

Energy Technology Data Exchange (ETDEWEB)

Amro, H; Chetty, I; Gordon, J; Wen, N [Henry Ford Health System, Detroit, MI (United States)

2014-06-01

Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation.

Magnetic properties of PrMn2-xFexGe2-57Fe Moessbauer spectroscopy

International Nuclear Information System (INIS)

Wang, J L; Campbell, S J; Cadogan, J M; Tegus, O; Studer, A J; Hofmann, M

2006-01-01

We have investigated the magnetic behaviour of PrMn 2-x Fe x Ge 2 compounds with x = 0.4, 0.6 and 0.8 over the temperature range 4.2-350 K using ac magnetic susceptibility, dc magnetization and 57 Fe Moessbauer effect spectroscopy, as well as neutron diffraction for the PrMn 1.2 Fe 0.8 Ge 2 compound. Replacement of Mn with Fe leads to contraction of the unit cell and a shortening of the Mn-Mn spacing, resulting in modification of the magnetic structure. PrMn 1.6 Fe 0.4 Ge 2 is an intralayer antiferromagnet at room temperature and ferromagnetic below T C inter ∼230 K with additional ferromagnetic ordering of the Pr sublattice detected below T C Pr ∼30 K. Re-entrant ferromagnetism has been observed in PrMn 1.4 Fe 0.6 Ge 2 with four magnetic transitions (T N intra ∼333 K, T C inter ∼168 K, T N inter ∼152 K and T C Pr ∼40 K). Moreover, it was found that T C inter and T C Pr increase with applied field while T N inter decreases. PrMn 1.2 Fe 0.8 Ge 2 is antiferromagnetic with T N intra ∼242 K and T N inter ∼154 K. The magnetic transition temperatures for all compounds are also marked by changes in the 57 Fe magnetic hyperfine field and the electric quadrupole interaction parameters. The 57 Fe transferred hyperfine field at 4.5 K in PrMn 1.6 Fe 0.4 Ge 2 and PrMn 1.4 Fe 0.6 Ge 2 is reduced (below the ordering temperature of the Pr sublattice) compared with that at 80 K (above T C Pr ), indicating that the transferred hyperfine field from Pr acts in the opposite direction to that from the Mn atoms. The neutron data for PrMn 1.2 Fe 0.8 Ge 2 demonstrate that an anisotropic thermal expansion occurs within the interplanar antiferromagnetic range

SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies

International Nuclear Information System (INIS)

Amro, H; Chetty, I; Gordon, J; Wen, N

2014-01-01

Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation

Outwards pointing hysteresis operators and asymptotic behaviour of evolution equations

Czech Academy of Sciences Publication Activity Database

Klein, O.; Krejčí, Pavel

2003-01-01

Roč. 4, č. 5 (2003), s. 755-785 ISSN 1468-1218 Keywords : hysteresis operators * Prandtl-Ishlinskii operator * asymptotic behaviour Subject RIV: BA - General Mathematics Impact factor: 0.257, year: 2003 http://www.wias-berlin.de/preprint/748/wias_preprints_748.pdf

Reliability and Validity of a Prototype Fluid Intake Monitor

National Research Council Canada - National Science Library

Tharion, William J; Karis, Anthony J; Hoyt, Reed W

2009-01-01

.... There was no difference in mean sip volume measured using the FIM vs. the scale (25.7 + 10.7 ml vs. 25.6 + 8.7 ml, respectively). Field Test Results: of 31 trials, 4 trials under-measured water consumption in excess of 15...

Jiří George Kukla a velká klimatologie globálních změn

Czech Academy of Sciences Publication Activity Database

Cílek, Václav

2003-01-01

Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf

Unit Ministry Team Religious Support to Casualties on the Airland Battlefield

Science.gov (United States)

1987-10-28

Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

Ontological Proofs of Existence and Non-Existence

Czech Academy of Sciences Publication Activity Database

Hájek, Petr

2008-01-01

Roč. 90, č. 2 (2008), s. 257-262 ISSN 0039-3215 R&D Projects: GA AV ČR IAA100300503 Institutional research plan: CEZ:AV0Z10300504 Keywords : ontological proofs * existence * non-existence * Gödel * Caramuel Subject RIV: BA - General Mathematics

QTL list: sex1.2 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available QT64750 Cucumis sativus Cucurbitaceae sex1.2 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_01 ... 25.7 7.3 ... 10.1007/s00122-003-1277-1 12827247

Nutritive evaluation of Telfairia occidentalis leaf protein concentrate ...

African Journals Online (AJOL)

STORAGESEVER

2008-08-04

Aug 4, 2008 ... The details determination of amino acids is as described elsewhere ... photometry (Jenway Ltd, Dunmond, Essex, UK) while phosphorus .... Zinc. 79.6. 21.5. 25.7. Magnesium. 18.1. 2.33. 0.8. Anti-nutrients (mg 100mg-1 DM).

Prediction of Improved Performance of Catalytic Hydrogenation Reactor by Periodic Modulation of the Feed Rate

Czech Academy of Sciences Publication Activity Database

Staněk, Vladimír; Hanika, Jiří; Jiřičný, Vladimír; Stavárek, Petr; Tukač, V.; Lederer, J.

2009-01-01

Roč. 23, č. 3 (2009), s. 251-257 ISSN 1451-9372 R&D Projects: GA MPO FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : trickle bed * feed modulation * catalytic reactor Subject RIV: CI - Industrial Chemistry, Chemical Engineering

Bivariate and Multivariate Associations between Trait Listening Goals and Trait Communicator Preferences

Science.gov (United States)

Keaton, Shaughan A.; Keteyian, Robert V.; Bodie, Graham D.

2014-01-01

This article provides validity evidence for a measure of listening goals by showing theoretically consistent relationships with an existing communication preference questionnaire. Participants (N = 257) were administered trait measures for listening goals and communicator preferences. The four listening goals--relational, task-oriented,…

Contrasting petrogenesis of spatially related carbonatites from Samalpatti and Sevattur, Tamil Nadu, India

Czech Academy of Sciences Publication Activity Database

Ackerman, Lukáš; Magna, T.; Rapprich, V.; Upadhyay, D.; Krátký, O.; Čejková, B.; Erban, V.; Kochergina, Y. V.; Hrstka, Tomáš

284/285, 1 July (2017), s. 257-275 ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : carbonatite * geochemistry * Samalpatti * Sevattur * silicocarbonatite * Sr–Nd–Pb–C–O isotopic systematics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

Making Dutch pupils media conscious: preadolescents' self-assessment of possible media risks and the need for media education

NARCIS (Netherlands)

Küter-Luks, Theresa; Heuvelman, A.; Peters, O.

2011-01-01

Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of

Effectiveness of a worksite mindfulness-related multi-component health promotion intervention on work engagement and mental health: Results of a randomized controlled trial

NARCIS (Netherlands)

Berkel, J. van; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; Beek, A.J. van der

2014-01-01

Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two

Effectiveness of a Worksite Mindfulness-Related Multi-Component Health Promotion Intervention on Work Engagement and Mental Health: Results of a Randomized Controlled Trial

NARCIS (Netherlands)

van Berkel, J.; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; van der Beek, A.J.

2014-01-01

Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two

E-beam and UV induced fabrication of CeO2, Eu2O3 and their mixed oxides with UO2

Czech Academy of Sciences Publication Activity Database

Pavelková, T.; Vaněček, V.; Jakubec, Ivo; Čuba, V.

2016-01-01

Roč. 124, JUL (2016), s. 252-257 ISSN 0969-806X Institutional support: RVO:61388980 Keywords : E-beam * Nuclear fuels * Radiation synthesis * Cerium(IV) oxide * Europium(III) oxide * Uranium (IV) oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 1.315, year: 2016

Search Results | Page 7 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 61 - 70 of 257 ... Extraterritorial investments, environmental crisis, and collective action in ... The second cohort of the Open Data Leaders Network convened at the ... This presentation defines open data, and shares examples of potential social and economic benefits. ... Capacity building Evaluation COMMUNICATION ...

Zmenšení dynamických účinků na předpjatých mostech

Czech Academy of Sciences Publication Activity Database

Frýba, Ladislav

2005-01-01

Roč. 14, č. 9 (2005), s. 257-260 ISSN 1210-4027 R&D Projects: GA MDS (CZ) 1F45D/013/120 Institutional research plan: CEZ:AV0Z20710524 Keywords : prestressed bridges * dynamics * prestressed strings Subject RIV: JM - Building Engineering

EFSA CEF Panel (Panel on Food Contac t Materials, Enzymes, Flavourings and Processing Aids , 2013. Scientific Opinion on Flavouring Group Evaluation 2 07 (FGE.2 07 )

DEFF Research Database (Denmark)

Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of one flavouring substance, 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931], from subgroup 1.1.2 of FGE.19, which...... is considered to be representative for four substances, 12-beta-santalen-14-ol [FL-no: 02.216], 12-alpha-santalen-14-ol [FL-no: 02.217], santalyl acetate [FL-no: 09.034] and santalyl phenylacetate [FL-no: 09.712], from subgroup 2.1 of FGE.19. The Flavour Industry has provided genotoxicity studies......-no: 09.034] and santalyl phenylacetate [FL-no: 09.712] from FGE.19 subgroup 2.1 for which 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931] is representative. © European Food Safety Authority, 2013...

Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM

Posouzení vlivu simulovaného poškození listové plochy na výnos a kvalitu cukrovky

Czech Academy of Sciences Publication Activity Database

Cerkal, R.; Dvořák, J.; Kamler, Jiří; Hřivna, L.

2006-01-01

Roč. 122, 9-10 (2006), s. 257-261 ISSN 1210-3306 R&D Projects: GA MZe QF4192 Institutional research plan: CEZ:AV0Z60930519 Keywords : sugar beet Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.078, year: 2004

Proceedings – Mathematical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.

Proceedings – Mathematical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Proceedings – Mathematical Sciences. Basudeb Datta. Articles written in Proceedings – Mathematical Sciences. Volume 112 Issue 2 May 2002 pp 257-281. Two-Dimensional Weak Pseudomanifolds on Eight Vertices · Basudeb Datta Nandini Nilakantan · More Details Abstract Fulltext PDF. We explicitly ...

Microbial colonization of silicone voice prostheses used in laryngectomized patients

NARCIS (Netherlands)

Eerenstein, S. E.; Grolman, W.; Schouwenburg, P. F.

1999-01-01

The aim of this study was to identify the microbial colonization of dysfunctioning voice prostheses in laryngectomized patients and determine the influence of patient radiation therapy on prosthesis life span. In a 40-month period, 257 outpatient voice prosthesis replacements were carried out in a

77 FR 25088 - Extension of the Commission's Rules Regarding Outage Reporting to Interconnected Voice Over...

Science.gov (United States)

2012-04-27

...: Gregory Intoccia, Special Counsel, Cybersecurity and Communications Reliability Division, Public Safety... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC 20554, or online at http://transition.fcc.gov/Daily_Releases/Daily_Business...

78 FR 11227 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

Science.gov (United States)

2013-02-15

... 11, 2011. 82,239 Hewlett Packard Santa Monica, CA....... December 10, 2011. Enterprise Services, LLC, Technical/ Enterprise Services Division, SAIT Services. 82,250 YP Western Directory Anaheim, CA December 12, 2011. LLC, Anaheim California Div., Publishing Operation, YP Western Holding YP Advertising. 82,257...

Iranian Sanctions: An Actor-Centric Analysis

Science.gov (United States)

2012-03-01

cultivated to counterbalance other actors in the system who opposed Khamenei’s ascension, based on his weak religious credentials.42 These security...trumped up religious infraction.256 The bonyads are the Iranian economy’s dominating revenue generating entity outside the oil sector,257 mushrooming in

Low-temperature time-resolved spectroscopic study of the major light-harvesting complex of Amphidinium carterae

Czech Academy of Sciences Publication Activity Database

Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš

2013-01-01

Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013

Predictors of Secondary Traumatic Stress among Children's Advocacy Center Forensic Interviewers

Science.gov (United States)

Bonach, Kathryn; Heckert, Alex

2012-01-01

This study examined various predictor variables that were hypothesized to impact secondary traumatic stress in forensic interviewers (n = 257) from children's advocacy centers across the United States. Data were examined to investigate the relationship between organizational satisfaction, organizational buffers, and job support with secondary…

The politics of fiscal federalism in Nigeria | Duru | Lwati: A Journal of ...

African Journals Online (AJOL)

257. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/lwati.v4i1.36834 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

Performance of commercial laying hen genotypes on free range and organic farms in Switzerland, France and The Netherlands

NARCIS (Netherlands)

Leenstra, F.R.; Maurer, V.; Bestman, M.W.P.; Sambeek van, F.; Zeltner, E.; Reuvekamp, B.F.J.; Galea, F.; Niekerk, van T.G.C.M.

2012-01-01

1. A total of 257 farmers with free ranging laying hens (organic and conventional) in Switzerland, France and The Netherlands with 273 flocks were interviewed to determine the relationships between the genotype of the hens, management conditions and performance. 2. Almost 20 different genotypes

Mitogenomic phylogenetics of the bank vole Clethrionomys glareolus, a model system for studying end-glacial colonization of Europe

Czech Academy of Sciences Publication Activity Database

Filipi, Karolína; Marková, Silvia; Searle, J. B.; Kotlík, Petr

2015-01-01

Roč. 82, PA (2015), s. 245-257 ISSN 1055-7903 R&D Projects: GA ČR GAP506/11/1872 Institutional support: RVO:67985904 Keywords : adaptation * glacial refugia * mitogenome * mtDNA * Myodes glareolus * Numt Subject RIV: EG - Zoology Impact factor: 3.792, year: 2015

Pukupuku arunachalensis sp. nov. (Coleoptera, Scarabaeidae, Rutelinae) from Arunachal Pradesh, India

Czech Academy of Sciences Publication Activity Database

Gupta, D.; Chandra, K.; Bezděk, Aleš

2017-01-01

Roč. 2017, č. 257 (2017), s. 1-11 ISSN 2118-9773 Institutional support: RVO:60077344 Keywords : new species * taxonomy * Northeast India Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.649, year: 2016 http://www.europeanjournaloftaxonomy.eu/index.php/ejt/issue/view/264

Thermal stability of alumina thin films containing γ-Al.sub.2./sub.O.sub.3./sub. phase prepared by reactive magnetron sputtering

Czech Academy of Sciences Publication Activity Database

Musil, Jindřich; Blažek, J.; Zeman, P.; Prokšová, Š.; Šašek, M.; Čerstvý, R.

2010-01-01

Roč. 257, č. 3 (2010), s. 1058-1062 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100520 Keywords : Al 2 O 3 (alumina) * annealing * thermal stability * nanocrystalline material * sputtering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.795, year: 2010

Differences in students' school motivation : A latent class modelling approach

NARCIS (Netherlands)

Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct

Assessing the Quantitative Relationships between Preschool Children's Exposures to Bisphenol A by Route and Urinary Biomonitoring

Science.gov (United States)

Limited published information exists on young children’s exposures to bisphenol A (BPA) in the United States using urinary biomonitoring. In a previous project, we quantified the aggregate exposures of 257 preschool children to BPA in environmental and personal media over 48-h pe...

Social Support from Parents and Friends for Chinese Adolescents in Singapore

Science.gov (United States)

Cheung, Hoi Shan; Sim, Tick Ngee

2017-01-01

This study tested the situational hypothesis, by examining the perceived availability of three types of social support (emotional, informational, and instrumental) from parents and friends, with respect to occupational and interpersonal relationships issues. Participants were 257 Chinese Singaporean adolescents (120 males, 137 females) between…

Geomorphological research of large-scale slope instability at Machu Picchu, Peru

Czech Academy of Sciences Publication Activity Database

Vilímek, V.; Zvelebil, J.; Klimeš, Jan; Patzelt, Z.; Astete, F.V.; Kachlík, F.; Hartvich, Filip

2007-01-01

Roč. 89, č. 3-4 (2007), s. 241-257 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30460519 Keywords : natural hazard * Machu Picchu * landslides Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.854, year: 2007 www.elsevier.com/locate/geomorphology

Das Luthertum in Böhmen und seine (Nicht)Reflexion bei den Nuntien am Kaiserhof

Czech Academy of Sciences Publication Activity Database

Černušák, Tomáš

2018-01-01

Roč. 18, č. 2 (2018), s. 257-267 ISSN 1805-790X Keywords : Nuncius * Papacy * Bohemian lands * Lutheranism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Two-year oscillation cycle in abundance of soybean aphid in Indiana

Czech Academy of Sciences Publication Activity Database

Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.

2010-01-01

Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010

Predicting Alcohol, Cigarette, and Marijuana Use from Preferential Music Consumption

Science.gov (United States)

Oberle, Crystal D.; Garcia, Javier A.

2015-01-01

This study investigated whether use of alcohol, cigarettes, and marijuana may be predicted from preferential consumption of particular music genres. Undergraduates (257 women and 78 men) completed a questionnaire assessing these variables. Partial correlation analyses, controlling for sensation-seeking tendencies and behaviors, revealed that…

Plasmid-encoded diacetyl (acetoin) reductase in Leuconostoc pseudomesenteroides

DEFF Research Database (Denmark)

Rattray, Fergal P; Myling-Petersen, Dorte; Larsen, Dianna

2003-01-01

A plasmid-borne diacetyl (acetoin) reductase (butA) from Leuconostoc pseudomesenteroides CHCC2114 was sequenced and cloned. Nucleotide sequence analysis revealed an open reading frame encoding a protein of 257 amino acids which had high identity at the amino acid level to diacetyl (acetoin...

Adsorption of copper, cadmium and silver from aqueous solutions onto natural carbonaceous materials

Czech Academy of Sciences Publication Activity Database

Hanzlík, P.; Jehlička, J.; Weishauptová, Zuzana; Šebek, O.

2004-01-01

Roč. 50, č. 6 (2004), s. 257-264 ISSN 1214-1178 R&D Projects: GA AV ČR IAA3111306 Institutional research plan: CEZ:AV0Z3046908 Keywords : activated carbon * metal-cations * removal Subject RIV: DD - Geochemistry Impact factor: 0.170, year: 2004

Search Results | Page 15 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 141 - 150 of 257 ... In the Caribbean islands, climate change is affecting freshwater availability and other ecosystem services in complex ways. ... IDRC's Democratic Governance, Women's Rights and Gender Equality initiative is supporting a body of comparative research on whether and how democratic processes ...

Neither hippurate-negative Brachyspira pilosicoli nor Brachyspira pilosicoli type strain caused diarrhoea in early-weaned pigs by experimental infection

DEFF Research Database (Denmark)

Fossi, M.; Ahlsten, K.; Pohjanvirta, T.

2005-01-01

Fossi M, Ahlsten K, Pohjanvirta T, Anttila M, Kokkonen T, Jensen TK, Boye M, Sukura A, Pelkola K, Pelkonen S: Neither hippurate-negative Brachyspira pilosicoli nor Brachyspira pilosicoli type strain caused diarrhoea in early-weaned pigs by experimental infection. Acta vet. scand. 2005, 46, 257...

40 CFR 51.121 - Findings and requirements for submission of State implementation plan revisions relating to...

Science.gov (United States)

2010-07-01

... Carolina, Ohio, Pennsylvania, Rhode Island, South Carolina, Tennessee, Virginia, West Virginia, and the...,406 New Jersey 96,876 New York 240,322 North Carolina 165,306 Ohio 249,541 Pennsylvania 257,928 Rhode..., Russell, St. Clair, Shelby, Sumter, Talladega, Tallapoosa, Tuscaloosa, Walker, and Winston. (C) [Reserved...

Download this PDF file

African Journals Online (AJOL)

GEORGE

Department of Urban and Regional Planning, Abia State Polytechnic Aba, Nigeria. Received 16 ... Squatter development in Southern Aba Region of Nigeria ... respondents was determined from the study population of 125,257 using the Taro Yamane model for .... networks or near industrial areas and market places, and.

KAPPA: A Package for Synthesis of Optically Thin Spectra for the Non-Maxwellian kappa-distributions Based on the Chianti Database

Czech Academy of Sciences Publication Activity Database

Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena

2015-01-01

Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

Humor and College Adjustment: The Predictive Nature of Humor, Academic Achievement, Authoritative Parenting Styles on the Initial Adjustment of Male and Female First-Year College Students

Science.gov (United States)

Hickman, Gregory P.; Andrews, David W.

2003-01-01

A self-report questionnaire on academic achievement, birth order, and family structure; the Student Adaptation to College Questionnaire; the Parental Authority Questionnaire; and the Coping Humor Scale were administered to 257 first-year college students. Researchers examined the relationships among (a) authoritative parenting style, (b) family…

High-E.sub.T./sub. isolated-photon plus jets production in pp collisions at √s = 8 TeV with the ATLAS detector

Czech Academy of Sciences Publication Activity Database

Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Hladík, Ondřej; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

2017-01-01

Roč. 918, May (2017), s. 257-316 ISSN 0550-3213 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics OBOR OECD: Particles and field physics Impact factor: 3.678, year: 2016

Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

Czech Academy of Sciences Publication Activity Database

Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

10 CFR 25.27 - Reopening of cases in which requests for access authorizations are canceled.

Science.gov (United States)

2010-01-01

... authorizations are canceled. 25.27 Section 25.27 Energy NUCLEAR REGULATORY COMMISSION ACCESS AUTHORIZATION Access Authorizations § 25.27 Reopening of cases in which requests for access authorizations are canceled. (a) In... cases were previously canceled, new fingerprint cards (FD-257) in duplicate and a new Security...

Interaction of polyunsaturated fatty acids and sodium butyrate during apoptosis in HT-29 human colon adenocarcinoma cells

Czech Academy of Sciences Publication Activity Database

Hofmanová, Jiřina; Vaculová, Alena; Lojek, Antonín; Kozubík, Alois

2005-01-01

Roč. 44, č. 1 (2005), s. 40-51 ISSN 1436-6207 R&D Projects: GA ČR(CZ) GA525/01/0419 Institutional research plan: CEZ:AV0Z50040507 Keywords : colon cancer * diet * butyrate Subject RIV: BO - Biophysics Impact factor: 2.257, year: 2005

An annotated checklist of the vascular flora of Washington County Mississippi

Science.gov (United States)

Field explorations have yielded 257 species new to Washington County, Mississippi and Calandrinia ciliata (Ruiz & Pav.) DC. and Ruellia nudiflora (Engelm. & Gray) Urban new to the state. An annotated list of 796 taxa for Washington County is provided and excludes 62 species that were reported from ...

EST Table: FS871051 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available aa ref|NP_001139536.1| mortality factor 4-like [Bombyx mori] gb|ABJ99463.1| mrg15-like protein [Bombyx mori...FS871051 E_FL_fner_44F14_R_0 11/12/09 GO hit GO:0005634(nucleus) 10/09/28 100 %/257

Skill/Knowledge Commonalities in Selected Electronics Specialties.

Science.gov (United States)

1986-10-01

Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles

The financial feasibility of producing fish and vegetables through aquaponics

NARCIS (Netherlands)

Bosma, Roel H.; Lacambra, Lysette; Landstra, Ynze; Perini, Chiara; Poulie, Joline; Schwaner, Marie J.; Yin, Yi

2017-01-01

Aquaponics, producing fish and vegetables in a closed-loop water system, reduces fertilizer use and water discharge, and is therefore promoted as a sustainable venture. A recent global study found that the majority of 257 surveyed aquaponics farms made losses, but the reasons have been poorly

Influence of Teachers' Teaching Experience on Students' Learning ...

African Journals Online (AJOL)

This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior secondary certificate (SSC) examinations in the ...

Differences in pathogenicity among strains of the same or different avian leukosis virus subgroups

Czech Academy of Sciences Publication Activity Database

Průková, Dana; Vernerová, Z.; Pilčík, Tomáš; Stepanets, Volodymyr; Indrová, Marie; Geryk, Josef; Plachý, Jiří; Hejnar, Jiří; Svoboda, Jan

2007-01-01

Roč. 36, č. 1 (2007), s. 15-27 ISSN 0307-9457 R&D Projects: GA ČR GA523/04/0489 Institutional research plan: CEZ:AV0Z50520514 Keywords : chicken * wasting disease * ALV Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

Effects of nutrient and water level changes on the composition and size structure of zooplankton communities in shallow lakes under different climatic conditions: a pan-European mesocosm experiment

Czech Academy of Sciences Publication Activity Database

Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.

2017-01-01

Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016

Estimating the community-level impact of the riparian alien species Mimulus guttatus by using a replicated BACI field experiment

Czech Academy of Sciences Publication Activity Database

Hejda, Martin; Pyšek, Petr

2008-01-01

Roč. 7, - (2008), s. 250-257 ISSN 1619-0033 R&D Projects: GA ČR(CZ) GA206/05/0323 Grant - others:ALARM(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * impact * species diversity Subject RIV: EF - Botanics

Prevalence and drug resistance in bacteria of the urinary tract ...

African Journals Online (AJOL)

Objective: To obtain data on the prevalence of antibiotic resistance in bacteria isolated from patients with suspected urinary tract infection in Bulawayo province, Zimbabwe. Method: Over a period of one year, 257 urine samples were analyzed for bacteria by standard procedures. Antimicrobial susceptibility testing of isolated ...

New methodology for capillary electrophoresis with ESI-MS detection: Electrophoretic focusing on inverse electromigration dispersion gradient. High-sensitivity analysis of sulfonamides in waters

Czech Academy of Sciences Publication Activity Database

Malá, Zdeňka; Gebauer, Petr; Boček, Petr

2016-01-01

Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016

Search Results | Page 23 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 221 - 230 of 257 ... ... Economic and social development filter · RESEARCH NETWORKS 9 Apply ... Impact of maternal and child health private expenditure on ... Food security radio programme and videos : overview (annex 32 of final technical report) ... of growth media, and adoption of water management strategies, ...

Factors influencing observed and self-reported functional ability in women with chronic widespread pain: A cross-sectional study

DEFF Research Database (Denmark)

Amris, Kirstine; Wæhrens, Eva Ejlersen; Stockmarr, Anders

2014-01-01

-sectional with systematic data collection in a clinical setting. Subjects: A total of 257 consecutively enrolled women with chronic widespread pain. Methods: Multidimensional assessment using self-report and observation-based assessment tools identified to cover ICF categories included in the brief ICF Core Set for chronic...

24 CFR 4001.403 - Prohibitions on interested parties in insured mortgage transaction.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Prohibitions on interested parties... under section 257 of the Act shall not improperly influence or attempt to improperly influence through..., inducement, intimidation, nonpayment for services rendered, or bribery, the development, reporting, result or...

Exploring exercise behavior, intention and habit strength relationships

NARCIS (Netherlands)

de Bruijn, G.J.; Rhodes, R.E.

2011-01-01

The purpose of this study was to explore the relevance of integrating exercise habit strength within the framework of the theory of planned behavior. Data were obtained from 538 undergraduate students [mean age=21.19 (SD=2.57); 28.4% males] using validated questionnaires and analyzed using

Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy

NARCIS (Netherlands)

Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.

2006-01-01

Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally

Different responses of soybean cyst nematode resistance between ...

Indian Academy of Sciences (India)

2016-12-02

Dec 2, 2016 ... 3Crop Research Institute, Shandong Academy of Agricultural Sciences, Jinan, Shandong 250100, People's Republic of ... SCN race 1 (HG types 2.5.7), while 7605 is highly susceptible. ... nomical and environmental friendly method to control ..... analysis and qualitative mapping of a major partial-resistance.

Temporal and spatial variations in particulate matter, particulate organic carbon and attenuation coefficient in Cochin Backwaters

Digital Repository Service at National Institute of Oceanography (India)

Devi, K.S.

Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

Comparison of intraspinal and intrathecal implantation of induced pluripotent stem cell-derived neural precursors for the treatment of spinal cord injury in rats

Czech Academy of Sciences Publication Activity Database

Amemori, Takashi; Růžička, Jiří; Romanyuk, Nataliya; Jhanwar-Uniyal, M.; Syková, Eva; Jendelová, Pavla

2015-01-01

Roč. 6, Dec (2015), s. 257 ISSN 1757-6512 R&D Projects: GA MŠk(CZ) LH12024 Institutional support: RVO:68378041 Keywords : spinal cord injury * human induced pluripotent stem cells * cell therapy * cell application route Subject RIV: FH - Neurology Impact factor: 4.504, year: 2015

ESR and TSL study of hole and electron traps in LuAG:Ce,Mg ceramic scintillator

Czech Academy of Sciences Publication Activity Database

Hu, C.; Liu, S.-P.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.

2015-01-01

Roč. 45, Jul (2015), s. 252-257 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : LuAG * scintillator * codoping * Ce3+ * O- center Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

Note on the distribution of Garveia franciscana (Torrey, 1902) and Cordylophora caspia (Pallas, 1771) in the Netherlands

NARCIS (Netherlands)

Vervoort, W.

1964-01-01

INTRODUCTION In 1956 Kinne (1956, p. 257) published the description of a new athecate hydroid, Perigonimus megas, discovered by him in the Nordostseekanal, a canal connecting the North Sea with the Baltic. Kinne's new species resembles a well known and widely distributed fresh- and brackish-water

Search Results | Page 4 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 31 - 40 of 257 ... ... and social development filter · RESEARCH NETWORKS 9 Apply ... While many private companies have made strides in building ... This presentation defines open data, and shares examples of potential social and economic benefits. ... and diversity on small holder farms to school feeding programs.

Temporal and spatial variations in hydrographic conditions of Mandovi estuary

Digital Repository Service at National Institute of Oceanography (India)

Varma, K.K.; Rao, L.V.G.; Cherian, T.

Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

Uniformed Services Worldwide Legal Assistance & Reserve Components Office Directory. Revised.

Science.gov (United States)

1999-11-01

257-1829 Commander (dl) 14th Coast Guard District Prince Kalanianaole Federal Building 300 Ala Moana Blvd, 9th Floor Honolulu, Hawaii 96850-4982...a),aarons.org Practice Area: 351 - Criminal Law - Defense, 400 - General Practice Bars Admitted: NM County of Practice: Santa Fe, Rio Arriba , Los

76 FR 58040 - Certain Coaxial Cable Connectors and Components Thereof and Products Containing Same; Notice of...

Science.gov (United States)

2011-09-19

...://edis.usitc.gov . Hearing-impaired persons are advised that information on this matter can be obtained... Industry, Co., Ltd. and Gem Electronics, Inc. (``the active respondents''), remained active. On October 13... found infringement of the `257 patent by the defaulting respondents and no infringement by the active...

Photoacoustic Detection of Terahertz Radiation for Chemical Sensing and Imaging Applications

Science.gov (United States)

2013-03-01

ISSN 2229-5518 [39] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic emission through terahertz-field driven electron...materials,” Journal of Electroceramics, vol. 2: p. 257-272, 2009. [47] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic

Electrospinning of reactive mesogens

NARCIS (Netherlands)

Yao, J.; Picot, O.T.; Hughes-Brittain, N.F.; Bastiaansen, C.W.M.; Peijs, T.

2016-01-01

The reinforcement potential of reactive liquid crystals or reactive mesogens (RMs) in electrospun fibers was investigated through the blending of two types of RMs (RM257 and RM82) with two types of thermoplastics; polyamide 6 (PA6) and poly(methyl methacrylate) (PMMA). Polymer/RM blends were

76 FR 81004 - Culturally Significant Objects Imported for Exhibition Determinations: “Woman in Blue, Against...

Science.gov (United States)

2011-12-27

... DEPARTMENT OF STATE [Public Notice: 7739] Culturally Significant Objects Imported for Exhibition Determinations: ``Woman in Blue, Against Blue Water'' by Edvard Munch SUMMARY: Notice is hereby given of the..., Delegation of Authority No. 257 of April 15, 2003), I hereby determine that the object ``Woman in Blue...

I psychologové mají svou olympiádu. Úspěch české psychologie na mezinárodním fóru

Czech Academy of Sciences Publication Activity Database

Klicperová-Baker, Martina

(2016) ISSN 2336-257X R&D Projects: GA MŠk LG15038 Institutional support: RVO:68081740 Keywords : psychologists * Czech psychology * international forum Subject RIV: AN - Psychology http://veda-a-technika.eurozpravy.cz/veda/165538-i-psychologove-maji-svou-olympiadu-uspech-ceske-psychologie-na-mezinarodnim-foru/

K B Shaik

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...

Angle dependent laser nanopatterning of poly(ethylene terephthalate) surfaces

Czech Academy of Sciences Publication Activity Database

Slepička, P.; Chaloupka, A.; Sajdl, P.; Heitz, J.; Hnatowicz, Vladimír; Svorcik, V.

2011-01-01

Roč. 257, č. 14 (2011), s. 6021-6025 ISSN 0169-4332 R&D Projects: GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : POLYMER SURFACES * THIN-FILM * RADIATION Subject RIV: BO - Biophysics Impact factor: 2.103, year: 2011

Clinical utility of serum folate measurement in tertiary care patients: Argument for revising reference range for serum folate from 3.0 ng/mL to 13.0 ng/mL

Directory of Open Access Journals (Sweden)

Gurmukh Singh

2015-04-01

Full Text Available Objective: Assess the need for folate testing, frequency of corrective action, and determine reference level for serum folate. Methods: Serum folate levels in 5313 samples from 4448 patients, and clinical data were reviewed for patient characteristics and for (a evidence of corrective action in patients with serum folate values 25.7 ng/mL. Results: The prevalence of serum folate levels, in patients, 25.7 ng/mL the sample was collected after supplementation with folic acid. Of the 128 patients with serum folate 60% of the patients. Since serum folate levels ≥13.0 ng/mL are needed for optimal prevention of neural tube defects in the embryo/fetus, we propose that normal serum folate level should be designated to be ≥13.0 ng/mL. Keywords: Serum folate, Prevalence of folate deficiency, Neural tube defects, Optimum serum folate level, Utility of folate testing

Charge distributions of fission fragments of low- and high-energy fission of Fm, No, and Rf isotopes

Science.gov (United States)

Paşca, H.; Andreev, A. V.; Adamian, G. G.; Antonenko, N. V.

2018-03-01

The charge (mass) distributions of fission fragments resulting from low- and high-energy fission of the even-even nuclei 254 -260 ,264Fm , 258 -264No , and 262 -266Rf are studied with the statistical scission-point model. The calculated results are compared with the available experimental data. In contrast to the experimental data, the calculated mass distribution for 258Fm (s.f.) is strikingly similar to the experimental one for 257Fm (s.f.). The transformation of the shape of charge distribution with increasing isospin and excitation energy occurs gradually and in a similar fashion like that of the mass distribution, but slower. For 254Fm(i.f.), 257Fm(nt h,f), and 260Fm (s.f.), the unexpected difference (symmetric or asymmetric) between the shapes of charge and mass distributions is predicted for the first time. At some critical excitation energy, the saturation of the symmetric component of charge (mass) yields is demonstrated.

Irradiation of sewage sludge using cesium-137: a comparative assessment

International Nuclear Information System (INIS)

1980-06-01

Irradiation using 137 CS is a recently developed process for disinfecting sewage sludge before applying it to the land. Irradiation, composting, and heat drying are Processes to Further Reduce Pathogens (PFRP) when operated to meet the guidelines set forth under Title 40, Code of the Federal Register, Part 257 (40 CFR 257). This report identifies and develops technical, operational, and environmental considerations for sludge handling systems incorporating these PFRP to determine the economic advantages of each process. The results indicate that sludge irradiation systems are cost-competitive with composting and heat drying systems for wastewater treatment plants with or without existing anaerobic digesters. Irradiation can thus be considered for new as well as upgrading existing facilities for sludge disinfection. An attractive aspect of the irradiation process is that significantly less conventional energy is used for operation when compared to composting and heat drying. In the final analysis, however, the applicability and desirability of any process is best determined by more evaluations specific to a given community

The target theory applied to the analysis of irradiation damages in organic detectors

International Nuclear Information System (INIS)

Mesquita, Carlos Henrique de

2005-01-01

The Target Theory was used to explain the radiation damage in samples containing 1% (g//L) of 2,5-diphenyl-oxazolyl (PPO) diluted in toluene and irradiated with 60 Co (1.8 Gy/s). The survival molecules of irradiated PPO obeys the bi-exponential mathematical model [74.3 x exp(-D/104.3) + 25.7 x exp(-D/800,0)]. It indicates that 74.3% of the molecules decay with D37=104.3 kGy and 25.7% decay with D37=800 kGy. From the Target Theory it was inferred the energies involved in the irradiation damages which were 0.239 ± 0.031 eV (G=418.4 ± 54.1. damages/100 eV) and 1.83 ± 0.30 eV (54.5 ± 8.9 damages/100 eV). The diameter of PPO molecule estimated from the Target Theory is in the interval of 45.5 to 64.9 angstrom. (author)

Moisture dependence of positron lifetime in Kevlar-49

Science.gov (United States)

Singh, Jag J.; Holt, William H.; Mock, Willis, Jr.

1984-01-01

Because of filamentary character of Kevlar-49 aramid fibers, there is some concern about the moisture uptake and its effect on plastic composites reinforced with Kevlar-49 fibers. As part of continuing studies of positron lifetime in polymers, we have measured positron lifetime spectra in Kevlar-49 fibers as a function of their moisture content. The long lifetime component intensities are rather low, being only of the order of 2-3 percent. The measured values of long component lifetimes at various moisture levels in the specimens are as follows: 2072 +/- 173 ps (dry); 2013 +/- 193 ps (20.7 percent saturation); 1665 +/- 85 ps (25.7 percent saturation); 1745 +/- 257 ps (32.1 percent saturation); and 1772 +/- 217 ps (100 percent saturation). It is apparent that the long component lifetime at first decreases and then increases as the specimen moisture content increases. These results have been compared with those inferred from Epon-815 and Epon-815/K-49 composite data.

Formal and Informal Employment Growth in Manufacturing (India ...

International Development Research Centre (IDRC) Digital Library (Canada)

Agent(e) responsable du CRDI. Rodriguez, Mr. Edgard. Financement total. CAD$ 257,300. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde. Chargé(e) de projet. Dr. Sandip Sarkar. Institution. Institute for Human Development. Pays d' institution. India. Extrants. Documents. Employment problem in India ...

Synthesis of Highly Symmetrical Triptycene Tetra- and Hexacarboxylates

Czech Academy of Sciences Publication Activity Database

Rybáčková, Markéta; Bělohradský, Martin; Holý, Petr; Pohl, Radek; Dekoj, Václav; Závada, Jiří

-, č. 10 (2007), s. 1554-1558 ISSN 0039-7881 R&D Projects: GA ČR GA203/03/0087 Institutional research plan: CEZ:AV0Z40550506 Keywords : carboxylic acids * Diels - Alder reaction s * oxidations * triptycenes * arynes Subject RIV: CC - Organic Chemistry Impact factor: 2.257, year: 2007

Pages 550 - 559.pmd

African Journals Online (AJOL)

Administrator

2 Department of Population Studies, University of Botswana, Private Bag 00705, Gaborone, Botswana ... Methods: The study used cross-sectional data from the Botswana AIDS Impact Survey III on 1,257 men aged 15 years ... is unknown and are having sex with circumcised men. ...... Global HIV prevention working group.

Work and Rest Patterns and Psychomotor Vigilance Performance of Crewmemebers of the USS Jason Dunham: A Comparison of the 3/9 and 6/6 Watchstanding Schedules

Science.gov (United States)

2014-12-31

4, 257–271. Albertsen, K., Rafnsdóttir, G. L., Grimsmo, A., Tómasson, K., & Kauppinen, K. (2008). Workhours and worklife balance . Scandinavian...consequences on balancing work and home life. Scientific evidence suggests that shift work has a negative influence on children’s well-being and on

Karpenkoite, Co.sub.3./sub.(V.sub.2./sub.O.sub.7./sub.)(OH).sub.2./sub..2H.sub.2./sub.O, a cobalt analogue of martyite from the Little Eva mine, Grand County, Utah, USA

Czech Academy of Sciences Publication Activity Database

Kasatkin, A.V.; Plášil, Jakub; Pekov, V.I.; Belakovskiy, D. I.; Nestola, F.; Čejka, J.; Vigasina, M.F.; Zorzi, F.; Thorne, B.

2015-01-01

Roč. 60, č. 4 (2015), s. 251-257 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : karpenkoite * new mineral * cobalt divanadate * powder diffraction * Little Eva mine * Utah Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

Gabonese French Dictionaries: Survey and Perspectives*

African Journals Online (AJOL)

Gabonese French Dictionaries: Survey and Perspectives. 257 ... be regarded, according to Gouws (2007: 314), as externally motivated products. .... Fair attention is given to different style or normative levels, i.e. .... differs enough from standard French to be regarded as a new emerging lan- ..... Tous les leaders des par-.

GMES Sentinel-1 Analysis of Marine Applications Potential (AMAP)

Science.gov (United States)

2008-10-01

Synthetic Aperture Radar (EUSAR 2008), 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 1, 179-182. VDE Verlag, Berlin, ISBN 978-3-8007-3084-1...European Conference on Synthetic Aperture Radar (EUSAR 2008), on CD-ROM. 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 2, 257-260. VDE Verlag

Does Burnout Begin with Student-Teaching? Analyzing Efficacy, Burnout, and Support during the Student-Teaching Semester

Science.gov (United States)

Fives, Helenrose; Hamman, Doug; Olivarez, Arturo

2007-01-01

The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…

Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

Czech Academy of Sciences Publication Activity Database

Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.

2015-01-01

Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015

The Predictive Nature of Humor, Authoritative Parenting Style, and Academic Achievement on Indices of Initial Adjustment and Commitment to College among College Freshmen

Science.gov (United States)

Hickman, Gregory P.; Crossland, Garnet L.

2004-01-01

Through the administration of self-report surveys, this study examined the relationships among a) parenting styles, b) family structure, c) academic achievement, d) birth order, e) gender, and f) humor on the initial personal-emotional, social, academic, and commitment to college adjustment among 257 first-quarter college freshmen. Multiple…

Surface refinement and electronic properties of graphene layers grown on copper substrate: An XPS, UPS and EELS study

Czech Academy of Sciences Publication Activity Database

Siokou, A.; Ravani, F.; Karakalos, S.; Frank, Otakar; Kalbáč, Martin; Galiotis, C.

2011-01-01

Roč. 257, č. 23 (2011), s. 9785-9790 ISSN 0169-4332 R&D Projects: GA MŠk LC510; GA AV ČR IAA400400911 Institutional research plan: CEZ:AV0Z40400503 Keywords : graphene * XPS * EELS Subject RIV: CG - Electrochemistry Impact factor: 2.103, year: 2011

Use of biocides for the control of fungal outbreaks in subterranean environments: The case of the Lascaux Cave in France

Czech Academy of Sciences Publication Activity Database

Martín-Sánchez, P.M.; Nováková, Alena; Bastian, F.; Alabouvette, C.; Saiz-Jimenez, C.

2012-01-01

Roč. 46, č. 7 (2012), s. 3762-3770 ISSN 0013-936X Grant - others:Spanish Ministry of Science and Innovation (ES) TCP CSD2007-00058 Institutional support: RVO:60077344 Keywords : fungal outbreaks * subterranean environments * Lascaux Cave Subject RIV: EH - Ecology, Behaviour Impact factor: 5.257, year: 2012

Radiation stability tests of the SMELS materials in the LVR-15 experimental reactor at Řež

Czech Academy of Sciences Publication Activity Database

Kučera, Jan; Eguskiza, M.; De Corte, F.; Rabouch, P.

2003-01-01

Roč. 257, č. 3 (2003), s. 677-682 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z1048901 Keywords : standardization * neutron activation analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.472, year: 2003

Solvent extraction of strontium into nitrobenzene using hydrogen dicarbollylcobaltate in the presence of 12-crown-4

Czech Academy of Sciences Publication Activity Database

Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

2003-01-01

Roč. 257, č. 2 (2003), s. 437-440 ISSN 0236-5731 R&D Projects: GA MŠk LN00B084 Institutional research plan: CEZ:AV0Z4031919; CEZ:MSM 230000009 Keywords : strontium * extraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.472, year: 2003

Empathy without borders? Cross-cultural heart and mind-reading in ...

African Journals Online (AJOL)

Background: This cross-cultural study was designed to examine cultural differences in empathy levels of first-year medical students. Methods: A total of 257 students from the academic year 2010/11, 131 at Jimma University, Ethiopia, and 126 at the Ludwig Maximilian University, Munich, Germany, completed the Balanced ...

Annual Review of Progress in Applied Computational Electromagnetics (6th), Held in Monterey, California on March 19-22, 1990

Science.gov (United States)

1990-01-01

enhanced by using variable length, width and color. " Contour maps, color or grayscale maps, and hedgehog charts for scalar quantities on any surface. All...a com- munications guardian transputer, and a communications spine . Users currently have a choice of Occam, C, or Fortran. 257 3.2 Five Processor

Acridizinium-Substituted Dendrimers As a New Potential Rewritable Optical Data Storage Material for Blu-ray

DEFF Research Database (Denmark)

Lohse, Brian; Vestberg, Robert; Ivanov, Mario T.

2008-01-01

A second-generation (acridizinium)12-dendrimer based on a poly(2,2-bis(hydroxymethylpropionic acid)) [bis-MPA] scaffold which can undergo photoinduced (4n + 4n) cycloaddition reactions on exposure to blue-violet light at 405 nm, and be reversed upon irradiation at 257 nm, has been synthesized...

Molecular Studies of HTLV-1 Infection in Newly Recognized High Risk Population

Science.gov (United States)

1993-07-10

members. Members of this community continued to marry close relatives for over the next 150 years. Markers of consanguinity are high among Mashadi...Caribbean region, and relationship to adult T cell leukemia/lymphoma. Int J Cancer 1982;30:257-264. 51. Hattori T, Uchiyama T, Topibana K, Takatsuki K

78 FR 29063 - Survey of Urban Rates for Fixed Voice and Fixed Broadband Residential Services

Science.gov (United States)

2013-05-17

... the USF/ICC Transformation Order. DATES: Effective May 17, 2013. This Order contains information... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... released the USF/ICC Transformation Order and FNPRM, 76 FR 73830, November 29, 2011, which comprehensively...

78 FR 33654 - Reassessment of Exposure to Radiofrequency Electromagnetic Fields Limits and Policies

Science.gov (United States)

2013-06-04

... available for inspection and copying during normal business hours in the FCC Reference Center (Room CY-A257... and supported statements. I. Notice of Proposed Rulemaking (Further NPRM) A. Definition of Terms... definitions for ``power'' in its RF-exposure related rules, it is proposing explicit and consistent power...

77 FR 468 - Revision of the Commission's Program Carriage Rules

Science.gov (United States)

2012-01-05

... the following methods: Federal eRulemaking Portal: http://www.regulations.gov . Follow the... business hours in the FCC Reference Center, Portals II, 445 12th Street SW., Room CY-A257, Washington, DC... (``NCTA''), Media Access Project, and Public Knowledge filed a joint request to extend the reply comment...

Asmare * Moges Abey **

African Journals Online (AJOL)

dell

little or no significant behavioral change. This research is further aimed to bridge this gap. Concerning .... Posters. No. 63. 10. 4. 5. 82. 53.9. As it can be seen in table 4, the most widely used .... words only 25.7% of the respondents take in to ...

The Relations between the Organizational Happiness and the Organizational Socialization Perceptions of Teachers: The Sample of Physical Education and Sport

Science.gov (United States)

Tosten, Rasim; Avci, Yunus Emre; Sahin, Erhan

2018-01-01

The main purpose of this research is to examine the relationship between levels of organizational happiness and organizational socialization of physical education and sport teachers. The research is quantitative and correlational model. The population of the research is composed of 257 physical education and sports teachers working in Siirt…

78 FR 38227 - Connect America Fund

Science.gov (United States)

2013-06-26

... and reviewed publicly available data sources to ensure that the particular locations it plans to serve... for public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445... make broadband-capable networks available to as many unserved locations as possible in those areas. In...

Prevalence of Sexual Activity and Outcome among Female ...

African Journals Online (AJOL)

Sexual activity among 534 Nigerian female secondary school students was studied using self-administered questionnaire. Prevalence of sexual intercourse was 25.7%. There was no significant difference between the junior (48.2%) and senior (51.8%) students (p > 0.05). Seventeen (12.4%) students had initiated sexual ...

New Fellows and Honorary Fellow

Indian Academy of Sciences (India)

Fellow Profile. Elected: 1975 Section: General Biology. Maitra, Prof. Pabitra Kumar D.Phil. (Calcutta), FNA. Date of birth: 1 November 1932. Date of death: 4 September 2007. Specialization: Biochemistry, Molecular Biology and Genetics Last known address: CJ-257, Salt Lake, Kolkata 700 091. YouTube; Twitter; Facebook ...

Transvesical prostatectomy in the management of benign prostatic ...

African Journals Online (AJOL)

2014-06-02

Jun 2, 2014 ... only occurred in 76 patients (25.7%); acute urinary retention was seen in 106 patients (35.7%). Chronic ... prostatic hyperplasia (BPH) is a common problem in the ... of the drugs, open prostatectomy or transurethral resection .... Storage LUTS. 37 ... there was paucity of data about prostatectomy specimen.

The religious lives of students at a South African university

African Journals Online (AJOL)

2016-04-08

Apr 8, 2016 ... homosexual people (Altemeyer & Hunsberger 1992). Other .... Furthermore, results show that this scale represents a reliable measure ... services on the radio or television, taking part in religious or rituals and fasting ...... African Americans', Journal of Psychology and Theology 33(4), 251–257. Van Breda ...

Involvement of carotenoids in the synthesis and assembly of protein subunits of photosynthetic reaction centers of Synechocystis sp. PCC 6803

Czech Academy of Sciences Publication Activity Database

Sozer, O.; Komenda, Josef; Ughy, B.; Domonkos, I.; Laczkó-Dobos, H.; Malec, P.; Gombos, Z.; Kis, M.

2010-01-01

Roč. 51, č. 5 (2010), s. 823-835 ISSN 0032-0781 R&D Projects: GA AV ČR IAA400200801 Institutional research plan: CEZ:AV0Z50200510 Keywords : Carotenoidless mutant * crtB * Membrane protein synthesis Subject RIV: EE - Microbiology, Virology Impact factor: 4.257, year: 2010

76 FR 72144 - Standardized and Enhanced Disclosure Requirements for Television Broadcast Licensee Public...

Science.gov (United States)

2011-11-22

... be convenient--during regular business hours. Making the information available online will provide 24... in an online public file to be hosted on the Commission's Web site. DATES: Comments for this... business hours in the FCC Reference Center, Federal Communications Commission, 445 12th Street SW., CY-A257...

Browse Title Index

African Journals Online (AJOL)

Items 201 - 250 of 257 ... Vol 30 (2001), The effects of unavailability of technical storage facilities to the marketing of fruits and vegetables for economic development in Morogoro .... Vol 42, No 2 (2014), Towards assessing managerial competencies and leadership styles required for successful game ranch management in the ...

Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

Czech Academy of Sciences Publication Activity Database

Hlobil, Ivo

2013-01-01

Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx

Social Appraisal of Adult ADHD: Stigma and Influences of the Beholder's Big Five Personality Traits

Science.gov (United States)

Canu, Will H.; Newman, Matthew L.; Morrow, Tara L.; Pope, Daniel L. W.

2008-01-01

Objective: This study investigates social stigma associated with a diagnosis of ADHD in adulthood and whether Big Five personality traits predict appraisals of affected individuals. Method: A sample of 257 undergraduates rate the desirability of targets with ADHD, minor medical problems, and with no appreciable weakness, across several social…

Applying the Diagnosis Antisocial Personality to Imprisoned Offenders: Looking for Hay in a Haystack.

Science.gov (United States)

Stevens, Gail Flint

1993-01-01

Assessed differences between inmates (n=381) diagnosed antisocial personality and inmates (n=257) with other diagnoses. Found that inmates diagnosed antisocial personality did not differ from other diagnosed inmates in terms of background characteristics, except race, but did differ in terms of criminal histories. Findings suggest that standards…

A radiographic study of nasopalatine duct cysts

Energy Technology Data Exchange (ETDEWEB)

Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral Radiology, College of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)

1993-02-15

The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.

A radiographic study of nasopalatine duct cysts

International Nuclear Information System (INIS)

Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae

1993-01-01

The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.

The 257 MeV 19/2/sup -/ two-phonon octupole state in /sup 147/Gd

CERN Document Server

Kleinheinz, P; Kortelahti, M; Piiparinen, M; Styczen, J

1981-01-01

The half-life of the (vf/sub 7/2/*3/sup -/*3/sup -/)/sub 19/2-/ two- phonon octupole states at 2.572 MeV in /sup 147/Gd was measured as T /sub 1/2/=0.37(8) ns, which gives a transition strength of 52(15) WU for the 1525 keV E3 transition to the 0.997 MeV (vf/sub 7/2/*3/sup -/) /sub 13/2+/ one transition to the 0.997 MeV ( nu f/sub 7/2/*3/sup -/) /sub 13/2+/ one phonon excitation. The nu i/sub 13/2/ admixture in the 13/2/sup +/ one-phonon state, as well as the dominant pi h/sub 11/2/d /sub 5//sup -1/2/ component of the /sup 146/Gd 3/sup -/ state give rise to large anharmonicities for the two-phonon excitation. An estimate of the energy shifts based on empirical coupling matrix elements gives 2.66 MeV excitation for the 19/2/sup -/ two-phonon state, in good agreement with the observed energy of that state. (9 refs).

75 FR 78029 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List the North...

Science.gov (United States)

2010-12-14

... Pearson 1972, pp. 254-257). Litters are born from mid-February through March, containing one to five kits... several reasons. Wolverines tend to live in remote and inhospitable places away from human populations... human population density and the lack of suitable habitat suggests that wolverines did not exist in this...

Reconstruction of Acute Traumatic Tibial Fractures with the Ilizarov ...

African Journals Online (AJOL)

The average time for application of the apparatus to fracture healing was 4.3 months. One fracture required autogenous bone graft for union. One patient is undergoing callus transportation for bone replacement. The most common complication was pin tract infection seen in nine (25.7%) patients. Conclusion: We treated 35 ...

Kreslení strukturních vzorců

Czech Academy of Sciences Publication Activity Database

Řápková, R.; Holý, P.; Vyskočil, V.; Podešva, Jiří; Drašar, P.

2018-01-01

Roč. 112, č. 4 (2018), s. 257-261 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : chemical structures * recommendations, graphical Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/ view /3071

Scoping Report: AI-Driven Wargame Replicator

Science.gov (United States)

2010-12-01

Connectionist Learning with Adaptive Rule Induction On-line (CLARION) CLARION, with its root in neural networks, is a hybrid architecture that incorporates...www.dsto.defence.gov.au/publications/2655/DSTO-TN-0534.pdf. [257] Stokes, A.E. and Kite, K. (2000). Op grasping a nettle and becoming emotional. In Peter A

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 257 ... Vol 42, No 2 (2014), A comparative analysis of two land reform models: The Mashishimale Farm Management Model and the Nkumbuleni Strategic ... Vol 43, No 2 (2015), Adapted SERVQUAL for evaluating the provision of information as an agricultural extension service in South Africa, Abstract PDF.

Issues of Anger in the Workplace: Do Gender and Gender Role Matter?

Science.gov (United States)

Gianakos, Irene

2002-01-01

To examine the influence of gender and gender role on anger experiences in the workplace, 257 adult students completed narratives describing their anger-provoking issues and anger expression. Analyses revealed that gender did not influence the types of issues cited or workers' anger expressions. (Contains 39 references and an appendix.) (GCP)

Search Results | Page 21 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 201 - 210 of 257 ... Farm to fork—improving eating habits and nutrition education in the Caribbean ... The high and growing incidence of obesity among young children and adolescents is ... Garbage separation: a livelihood option for poor men and women ... Improving food security in Latin America and the Caribbean ...

Search Results | Page 19 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 181 - 190 of 257 ... The IDRC-supported “Labour markets for inclusive growth” project, coordinated by the Centre for Distributive Labor and Social Studies (CEDLAS) at Universidad Nacional de La Plata in Argentina, is generating rigorous and policy-relevant evidence on how labour markets and social protection work ...

HlyA knock out yields a safer Escherichia coli A0 34/86 variant with unaffected colonization capacity in piglets

Czech Academy of Sciences Publication Activity Database

Sheshko, Valeria; Hejnová, Jana; Řeháková, Z.; Šinkora, J.; Faldyna, M.; Alexa, P.; Felsberg, Jürgen; Němcová, R.; Bomba, A.; Šebo, Peter

2006-01-01

Roč. 48, - (2006), s. 257-266 ISSN 0928-8244 R&D Projects: GA ČR GA523/03/0186 EU Projects: European Commission(XE) 503240 - MUVAPRED Institutional research plan: CEZ:AV0Z50200510 Keywords : escherichia coli * haemolysin * colonization Subject RIV: EE - Microbiology, Virology Impact factor: 2.281, year: 2006

Sadhana | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

Frequency Rates and Correlates of Contrapower Harassment in Higher Education

Science.gov (United States)

DeSouza, Eros R.

2011-01-01

The current study investigated incivility, sexual harassment, and racial-ethnic harassment simultaneously when the targets were faculty members and the perpetrators were students (i.e., academic contrapower harassment; ACH). The sample constituted 257 faculty members (90% were White and 53% were women) from a medium-sized state university in the…

Effects of melatonin on ischemia and reperfusion injury of the rat heart

Czech Academy of Sciences Publication Activity Database

Szárszoi, Ondrej; Asemu, Girma; Vaněček, Jiří; Ošťádal, Bohuslav; Kolář, František

2001-01-01

Roč. 15, č. 3 (2001), s. 251-257 ISSN 0920-3206 R&D Projects: GA ČR GA306/98/0470; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.009, year: 2001

Making Dutch Pupils Media Conscious: Preadolescents' Self-Assessment of Possible Media Risks and the Need for Media Education

Science.gov (United States)

Kuter-Luks, Theresa; Heuvelman, Ard; Peters, Oscar

2011-01-01

Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of television and the internet, and the need for media…

Aksoy Nigar Yildirim Variational problem with complex co-efficient of ...

Indian Academy of Sciences (India)

user1

Abbaspour Mohammad Hassan see Ghaffarzadeh Ghodrat. 329. Abhyankar Shreeram S. Rees valuations. 525. Agarwal A K. seeAnand S. 23. Aithal A R. On the extrema of Dirichlet's first eigen- value of a family of punctured regular polygons in two dimensional space forms. 257. Aksoy Nigar Yildirim. Variational problem ...

78 FR 5750 - Data Specifications for Collecting Study Area Boundaries

Science.gov (United States)

2013-01-28

... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC... reforms adopted as part of the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011. In the USF/ICC Transformation Order, the Commission comprehensively reformed universal service funding for high...

77 FR 1637 - Connect America Fund; Developing an Unified Intercarrier Compensation Regime; Lifeline and Link Up

Science.gov (United States)

2012-01-11

... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... of the USF/ICC Transformation Order, 76 FR 73830, November 18, 2011. 2. In the USF/ICC Transformation... the USF/ICC Transformation Order, as well as such carriers that had previously obtained ETC...

Cryoseston of the Pirin Mountains, Bulgaria

Czech Academy of Sciences Publication Activity Database

Cepák, Vladislav; Lukavský, Jaromír

2013-01-01

Roč. 72, č. 2 (2013), s. 257-268 ISSN 0365-0588 R&D Projects: GA TA ČR TE01020080; GA TA ČR TA03011027 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlainomonas * Pirin * Bulgaria Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.449, year: 2013

75 FR 39940 - Notice of Debarment; Schools and Libraries Universal Service Support Mechanism

Science.gov (United States)

2010-07-13

... business hours at the FCC Reference Information Center, Portal II, 445 12th Street, SW., Room CY-A257... regular business hours at the contractor, Best Copy and Printing, Inc., Portal II, 445 12th Street, SW... civil judgment for attempt or commission of criminal fraud, theft, embezzlement, forgery, bribery...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

pp 257-266 Full Papers ... complexes of rhodium - Synthesis, structure and, spectral and electrochemical properties ... pp 267-273 Full Papers ... pp 275-281 Full Papers ... Yuliang Che Hua Yang Hongxiao Jin Chunxin Lu Ziyang Liu ... Excited state dynamics of 9,9'-bianthryl in room temperature ionic liquids as revealed by ...

Synthesis, crystal structure and DFT calculations of a new Hg (II) metal-organic polymer

Czech Academy of Sciences Publication Activity Database

Mirtamizdoust, B.; Roodsari, M.S.; Shaabani, B.; Dušek, Michal; Fejfarová, Karla

2016-01-01

Roč. 15, č. 3 (2016), s. 257-266 ISSN 1024-1221 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : mercury (II) iodide * coordination polymer * square planar * tetrahedral geometry * density functional calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.565, year: 2016

IL-1β level in Sudanese patients with atherosclerotic coronary heart ...

African Journals Online (AJOL)

McRoy

studies investigating inflammatory cytokines in atherosclerotic patients with coronary heart disease (CHD).[2,5-7]. However, systemic level of IL-1β may still be unreliable marker for atherosclerosis. This is because systemic level of IL-1β could not faithfully reflect the local inflammatory process near the atheromatous lesions.

Isoflurane as a solvent for electrochemistry. Electrooxidation study of icosahedral carborane anions in four different solvents

Czech Academy of Sciences Publication Activity Database

Wahab, Abdul; Kvapilová, Hana; Klíma, Jiří; Michl, Josef; Ludvík, Jiří

2013-01-01

Roč. 689, JAN 2013 (2013), s. 257-261 ISSN 1572-6657 R&D Projects: GA MŠk ME09002; GA ČR GC203/09/J058 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : isoflurane * relative permitivity * icosahedral carborane anions Subject RIV: CG - Electrochemistry Impact factor: 2.871, year: 2013

Detection of ultra-high energy cosmic ray showers with a single-pixel fluorescence telescope

Czech Academy of Sciences Publication Activity Database

Fujii, T.; Malacari, M.; Bertaina, M.; Casolino, E.; Dawson, B.; Horváth, P.; Hrabovský, M.; Jiang, J.; Mandát, Dušan; Matalon, A.; Matthews, J.N.; Motloch, P.; Palatka, Miroslav; Pech, Miroslav; Privitera, P.; Schovánek, Petr; Takizawa, Y.; Thomas, S.B.; Trávníček, Petr; Yamazaki, K.

2016-01-01

Roč. 74, Feb (2016), s. 64-72 ISSN 0927-6505 R&D Projects: GA MŠk(CZ) LG13007 Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * fluorescence detector * extensive air shower Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

pp 223-226 Commentary on J. Genet. Classic. Towards a genetic architecture of cryptic genetic variation and genetic assimilation: the contribution of K. G. Bateman · Ian Dworkin · More Details Fulltext PDF. pp 227-257 J. Genet. Classic. The Genetic Assimilation of Four Venation Phenocopies (Published on 1959 J. Genet.

7 CFR 1726.27 - Contractor's bonds.

Science.gov (United States)

2010-01-01

... 7 Agriculture 11 2010-01-01 2010-01-01 false Contractor's bonds. 1726.27 Section 1726.27... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES General § 1726.27 Contractor's bonds. (a) RUS Form 168b, Contractor's Bond, shall be used when a contractor's bond is required by RUS Forms 200, 257...

Search Results | Page 24 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 231 - 240 of 257 ... Even where quota systems are in place, there has been slow progress in increasing women''s leadership in formal politics, suggesting that a range of ... Results show the power of agroecological practices to improve livelihoods and food security, limited by situations where most agroecological ...

Voltammetry on Mercury and Carbon Electrodes as a Tool for Studies of Metallothionein Interactions with Metal Ions

Czech Academy of Sciences Publication Activity Database

Šestáková, Ivana; Mader, P.

2000-01-01

Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000

Surabhi Potnis

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education. Surabhi Potnis. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 257-268 General Article. From Carbon to Buckypaper · Surabhi Potnis · More Details Abstract Fulltext PDF. This article aims to highlight the amazing ...

Why Did This Happen to Me? Cognitive Schema Disruption and Posttraumatic Stress Disorder in Victims of Sexual Trauma

Science.gov (United States)

Wright, Caroline Vaile; Collinsworth, Linda L.; Fitzgerald, Louise F.

2010-01-01

Many trauma researchers have proposed cognitive schemas as a heuristic device to understand the elusive process of integrating traumatic events. We examined the schemas of a sample (N = 257) of female participants classified by exposure to sexual trauma, nonsexual trauma, and no trauma experience. Cognitive schema was assessed with the Traumatic…

P Chatterjee

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. P Chatterjee. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 251-257 Experimental Techniques. Voigt modelling of size–strain analysis: Application to -Al2O3 prepared by combustion technique · K Santra P Chatterjee S P Sen Gupta.

Search Results | Page 18 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 171 - 180 of 257 ... ... Safe and Inclusive Cities 1 Apply Safe and Inclusive Cities filter · Technology ... Regional Dialogue on the Information Society Network (Latin ... engaged in international cooperation for development but don't have ... The study's author, Stacie Travers, also carried out four case studies on Canadian ...

Effect of different treatments of copper surface on its total hemispherical absorptivity bellow 77 K

Czech Academy of Sciences Publication Activity Database

Musilová, Věra; Králík, Tomáš; Hanzelka, Pavel; Srnka, Aleš

2007-01-01

Roč. 47, č. 4 (2007), s. 257-261 ISSN 0011-2275 R&D Projects: GA AV ČR IBS2065109 Institutional research plan: CEZ:AV0Z20650511 Keywords : metals * structural materials * heat transfer * radiant properties * cryostats Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.981, year: 2007

Quality Control for Ordnance

Science.gov (United States)

1957-01-01

R. H. Morgan, "Screen Intensification Systems and Their Lirnita- tions," Amtvican J w n u l of Roenlgenology and Radizcm Therapy , Vol. LXII, No...443. (1 10) Kurt Matthaes, " Magneto -Inductive Testing of Stcel," Zeitschrgt filr Melnll- kunde, Vol. 39, September, 1948, p]). 257- 272. (1 11

Gas barrier properties of nanocomposites based on in situ polymerized poly(n-butyl methacrylate) in the presence of surface modified montmorillonite

Czech Academy of Sciences Publication Activity Database

Herrera-Alonso, J. M.; Sedláková, Zdeňka; Marand, E.

2010-01-01

Roč. 349, 1-2 (2010), s. 251-257 ISSN 0376-7388 R&D Projects: GA AV ČR KAN100500651; GA MŠk ME09058 Institutional research plan: CEZ:AV0Z40500505 Keywords : barrier membranes * nanocomposites * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.673, year: 2010

Dynamický impaktní test – unikátní metoda analýzy ochranných vrstev

Czech Academy of Sciences Publication Activity Database

Fořt, Tomáš; Grossman, Jan; Sobota, Jaroslav; Daniel, Josef

2017-01-01

Roč. 62, č. 10 (2017), s. 257-260 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : dynamical impact test * thin films * protective coatings * wear-resistance * fatigue tests Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Audio engineering, reliability analysis

Trematode diversity in freshwater fishes of the Globe I: ‘Old World’

Czech Academy of Sciences Publication Activity Database

Scholz, Tomáš; Besprozvannykh, V. V.; Boutorina, T.E.; Choudhury, A.; Cribb, T.H.; Ermolenko, A. V.; Faltýnková, Anna; Shedko, M.B.; Shimazu, T.; Smit, N.J.

2016-01-01

Roč. 93, č. 3 (2016), s. 257-269 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR GA15-14198S Institutional support: RVO:60077344 Keywords : life cycle * Digenea * parasite communite Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

Czech Academy of Sciences Publication Activity Database

Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk

2014-01-01

Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP -MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

Analysis of Principals' Managerial Competencies for Effective Management of School Resources in Secondary Schools in Anambra State, Nigeria

Science.gov (United States)

Victor, Akinfolarin Akinwale

2017-01-01

This study analyses principals' managerial competencies for effective management of school resources in secondary schools in Anambra State. The study was conducted in Anambra State. The study population comprised 257 principals in public secondary schools in the State. The study adopted a descriptive survey design. A 24 items researcher developed…

78 FR 64404 - Next Generation 911; Text-to-911; Next Generation 911 Applications

Science.gov (United States)

2013-10-29

... business hours in the FCC's Reference Information Center at Portals II, CY-A257, 445 12th Street SW... provider. CTIA claims that in current network architecture for Short Message Service (SMS) texting, only... consumer. Changes to this architecture, T-Mobile argues, are ``simply not feasible.'' T-Mobile opines that...

Redescription of the Holotype of Culex (Culex) Peus Speiser and Taxonomy of Culex (Culex) Stigmatosoma Dyar and Thriambus Dyar (Diptera: Culicidae)

Science.gov (United States)

1988-10-12

Ver- teneuil, Brussels. 257 pp. + 5 pls. Forattini, 0. P. 1965. Entomologia Medica. 2” Vol- ume_ Editora da Universidade de Sao Paulo. 506 PP...Publica, Boletines T&r& cos, Serie A: Entomologia Medica y Parasitologia No. 1. 66 pp. Matheson, R. 1944. Handbook of the Mosquitoes of North America

Anxiety and Depression in Breast Cancer Survivors of Different Sexual Orientations

Science.gov (United States)

Boehmer, Ulrike; Glickman, Mark; Winter, Michael

2012-01-01

Objective: We conducted a study comparing anxiety and depression by sexual orientation in long-term breast cancer survivors, testing the hypothesis that sexual minority women (e.g., lesbian and bisexual women) have greater levels of anxiety and depression. Method: From a state cancer registry, we recruited 257 heterosexual and 69 sexual minority…

Differences in Students' School Motivation: A Latent Class Modelling Approach

Science.gov (United States)

Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje

2015-01-01

In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct motivation profiles within our sample, using the…

The Self-Esteem, Perceived Social Support and Hopelessness in Adolescents: The Structural Equation Modeling

Science.gov (United States)

Savi Cakar, Firdevs; Karatas, Zeynep

2012-01-01

In this study, a developed model to explain a causal relationship between adolescent's self-esteem, perceived social support and hopelessness is tested. The purpose of the study is to explore the relationship between self-esteem, perceived social support and hopelessness in adolescents. A total of 257 adolescents, including 143 female and 114…

47 CFR 90.238 - Telemetry operations.

Science.gov (United States)

2010-10-01

... MHz band (as available in the Public Safety Pool for bio-medical telemetry operations). (i) For... with § 90.257 and subject to the rules governing the use of that band). (b) 154.45625, 154.46375, 154...-470 MHz band, telemetry operations will be authorized on a secondary basis with a transmitter output...

Impact of Calcium and Two Doses of Vitamin D on Bone Metabolism in the Elderly

DEFF Research Database (Denmark)

Rahme, Maya; Sharara, Sima Lynn; Baddoura, Rafic

2017-01-01

The optimal dose of vitamin D to optimize bone metabolism in the elderly is unclear. We tested the hypothesis that vitamin D, at a dose higher than recommended by the Institute of Medicine (IOM), has a beneficial effect on bone remodeling and mass. In this double-blind trial we randomized 257 ove...

The pig as an experimental model for clinical craniofacial research

Czech Academy of Sciences Publication Activity Database

Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

2012-01-01

Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

Functioning Before and After Total Hip or Knee Arthroplasty

NARCIS (Netherlands)

I.B. de Groot (Ingrid)

2009-01-01

textabstractOsteoarthritis (OA) of the hip or knee is a common locomotor disease characterized by degradation of articular cartilage. In the Netherlands, in the year 2000 about 257,400 persons above the age of 55 years had hip OA and about 335,700 persons had knee OA. Because the prevalence of OA

Search Results | Page 9 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 81 - 90 of 257 ... Home; West Indies ... Middle East 261 Apply Middle East filter · United Kingdom 108 Apply .... and monitors the progress made by different countries over time, as well as ... This supplement contains working papers distributed prior to the ... related to small-scale fisheries and coastal management in th.

Theoretical modeling of influence of the structural disorder on the charge carrier mobility in triphenylene stacks

Czech Academy of Sciences Publication Activity Database

Mikolajczyk, M.; Toman, Petr; Bartkowiak, W.

2010-01-01

Roč. 485, 1-3 (2010), s. 253-257 ISSN 0009-2614 R&D Projects: GA MŠk MEB050815; GA AV ČR IAA401770601 Institutional research plan: CEZ:AV0Z40500505 Keywords : triphenylene * charge carrier mobility * tight-binding approximation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.282, year: 2010

Low temperature delayed recombination decay in complex oxide scintillating crystals

Czech Academy of Sciences Publication Activity Database

Mihóková, Eva; Jarý, Vítězslav; Schulman, L. S.; Nikl, Martin

2014-01-01

Roč. 61, č. 1 (2014), 257-261 ISSN 0018-9499 R&D Projects: GA MŠk LH12150; GA MŠk LH12185 Grant - others:AVČR(CZ) M100101212 Institutional support: RVO:68378271 Keywords : luminescence * oxides * scintillator * tunneling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.283, year: 2014

Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

Czech Academy of Sciences Publication Activity Database

Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk

2006-01-01

Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

Transfer to hospital in planned home births

DEFF Research Database (Denmark)

Blix, Ellen; Kumle, Merethe; Kjærgaard, Hanne

2014-01-01

was chosen. RESULTS: Fifteen studies were eligible for inclusion, containing data from 215,257 women. The total proportion of transfer from home to hospital varied from 9.9% to 31.9% across the studies. The most common indication for transfer was labour dystocia, occurring in 5.1% to 9.8% of all women...

Levels of Satisfaction with Leisure Time in Foreign Students

Science.gov (United States)

Akdeniz, Hakan; Simsek, Sinem Didem; Kavi, Onur; Uzuner, Muhammet Eyup; Sekban, Gulsah

2018-01-01

The aim of this study was to investigate levels of satisfaction with leisure time in foreign students of Kocaeli University. In the collection of the data, the Leisure Satisfaction Scale (LSS) and demographic status questionnaire were used; 257 male and 103 female students participated. In the LSS scores for the separate domains, participants…

Maximum entropy analysis of cosmic ray composition

Czech Academy of Sciences Publication Activity Database

Nosek, D.; Ebr, Jan; Vícha, Jakub; Trávníček, Petr; Nosková, J.

2016-01-01

Roč. 76, Mar (2016), s. 9-18 ISSN 0927-6505 R&D Projects: GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * extensive air showers * cosmic ray composition Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016

Histopathology of carp (Cyprinus carpio L.) larvae exposed to Cyanobacteria extract

Czech Academy of Sciences Publication Activity Database

Palíková, M.; Navrátil, S.; Tichý, F.; Štěrba, F.; Maršálek, Blahoslav; Bláha, L.

2004-01-01

Roč. 73, - (2004), s. 253-257 ISSN 0001-7213 R&D Projects: GA AV ČR KSK6005114; GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z6005908 Keywords : microcystins * embryo-larval test * liver damage Subject RIV: EF - Botanics Impact factor: 0.449, year: 2004

75 FR 46885 - Satellite Television Extension and Localism Act of 2010 and Satellite Home Viewer Extension and...

Science.gov (United States)

2010-08-04

... some point in the future and a prediction from the updated model indicates that the location can..., to ``develop and prescribe by rule a point-to-point predictive model for reliably and presumptively... business hours in the FCC Reference Center (Room CY-A257), 445 12th Street, SW., Washington, DC 20554. The...

Optimizing Cognitive Load for Learning from Computer-Based Science Simulations

Science.gov (United States)

Lee, Hyunjeong; Plass, Jan L.; Homer, Bruce D.

2006-01-01

How can cognitive load in visual displays of computer simulations be optimized? Middle-school chemistry students (N = 257) learned with a simulation of the ideal gas law. Visual complexity was manipulated by separating the display of the simulations in two screens (low complexity) or presenting all information on one screen (high complexity). The…

76 FR 30605 - Assessment and Collection of Regulatory Fees For Fiscal Year 2011

Science.gov (United States)

2011-05-26

..., 1999). The Small Business Act contains a definition of ``small-business concern,'' which the RFA incorporates into its own definition of ``small business.'' See 15 U.S.C. 632(a) (``Small Business Act''); 5 U... during normal business hours in the FCC Reference Center, 445 Twelfth Street, SW., Room CY-A257, Portals...

University Students' Views of a Public Service Graduation Requirement

Science.gov (United States)

Moely, Barbara E.; Ilustre, Vincent

2011-01-01

As New Orleans began to rebuild after Hurricane Katrina, Tulane University also began its recovery process. A new initiative in the recovery was the establishment of a public service graduation requirement for undergraduate students. Attitudes toward the requirement were assessed for 290 first-year and 257 advanced students in fall 2006. The…

Differences in the Morale of Older, Rural Widows and Widowers.

Science.gov (United States)

Scott, Jean Pearson; Kivett, Vira R.

1985-01-01

Examined effect of sex differences on morale of 257 older rural widows and widowers. Sex of respondent was not found to affect morale; however, perceived financial status and self-rated health had significant direct effects. Widows and widowers reporting higher morale had higher perceived financial status and rated their health as good.…

The Effects of Hydrodynamic Stretch on the Flame Propagation Enhancement of Ethylene by Addition of Ozone

Science.gov (United States)

2015-07-13

dimensional simulations were performed using the unsteady ignition and combustion with reactions ( UNICORN ) model [28,33–36]. UNICORN only requires the inflow...Katta VR. 1998 Role of flow visualization in the development of UNICORN . J. Vis. 2, 257–272. (doi:10.1007/BF03181442) 34. Katta VR, Goss LP, Roquemore WM

Effect of nifedipine, imipramine and sertraline on the antidepressant ...

African Journals Online (AJOL)

DR ORIAFOH

2012-06-28

Jun 28, 2012 ... Ann. Nuclear Med. 11(3): 213-218. Kozisek ME, Middlemas D, Bylund DB (2008). The differential regulation of BDNF and TrkB levels in juvenile rats after four days of escitalopram and desipramine treatment. Neuropharmacol. 54(2):. 251-257. Kreydiyyeh SI (2000). Cyclic AMP and furosemide stimulate the ...

78 FR 2571 - Special Access for Price Cap Local Exchange Carriers; AT&T Corporation Petition for Rulemaking To...

Science.gov (United States)

2013-01-11

...., observed sales and purchases). This allows for an analysis that controls for factors that may vary widely... those factors that affect providers' decisions to expand existing networks, e.g., the non-price factors... Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best Copy and...

78 FR 67053 - Special Access for Price Cap Local Exchange Carriers; AT&T Corporation Petition for Rulemaking To...

Science.gov (United States)

2013-11-08

... characteristics of the purchased service; and (4) other factors that influence the pricing decisions of special..., 445 12th Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best... competition and pricing decisions. Under each category, most of which would be collected from Providers, the...

Comité Scientifique de la Revue des Sciences et de la Technologie ...

African Journals Online (AJOL)

MICROSIM

Ecological Indicators,1, 261 – 270. [11] Wekbeker G. & Cory G., 1988. Robo nucleotide reductase activity and growth of glutathione depleted mouse leukemia 1210 cells in vitro. Cancer letters, 40, 257 – 264. [12] Bradford M., 1976. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing ...

Magnetic phase transitions in ferrimagnetic DyFe.sub.5./sub.Al.sub.7./sub. near the compensation point

Czech Academy of Sciences Publication Activity Database

Mushnikov, N. V.; Rozenfeld, E.V.; Gorbunov, Denis; Andreev, Alexander V.

2014-01-01

Roč. 115, č. 3 (2014), s. 257-267 ISSN 0031-918X R&D Projects: GA ČR GAP204/12/0150 Institutional support: RVO:68378271 Keywords : rare- earth intermetallic compounds * ferrimagnetism * compensation temperature * magnetic anisotropy * magnetic phase transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.761, year: 2014

Program DEIMOS32 for gamma-ray spectra evalution

Czech Academy of Sciences Publication Activity Database

Frána, Jaroslav

2003-01-01

Roč. 257, č. 3 (2003), s. 583-587 ISSN 0236-5731. [International Conference Ko-users Workshop /3./. Bruges, 23.09.2001-28.09.2001] Institutional research plan: CEZ:AV0Z1048901 Keywords : gamma-ray spectra * software Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.472, year: 2003

Mesoporous molecular sieves as advanced supports for olefin metathesis catalysts

Czech Academy of Sciences Publication Activity Database

Balcar, Hynek; Čejka, Jiří

2013-01-01

Roč. 257, 21-22 (2013), s. 3107-3124 ISSN 0010-8545 R&D Projects: GA AV ČR IAA400400805; GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Olefin metathesis * mesoporous molecular sieves * Heterogeneous catalysts Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 12.098, year: 2013

Author Impact Metrics in Communication Sciences and Disorder Research

Science.gov (United States)

Stuart, Andrew; Faucette, Sarah P.; Thomas, William Joseph

2017-01-01

Purpose: The purpose was to examine author-level impact metrics for faculty in the communication sciences and disorder research field across a variety of databases. Method: Author-level impact metrics were collected for faculty from 257 accredited universities in the United States and Canada. Three databases (i.e., Google Scholar, ResearchGate,…

An Afterschool Program for Economically Disadvantaged Youth: Perceptions of Parents, Staff, and Students

Science.gov (United States)

Hall, Katrina W.; Williams, Lunetta M.; Daniel, Larry G.

2010-01-01

The present study investigated perceived effects of an afterschool program located in 6 Title 1 schools on students' achievement, self-esteem, and attitudes. Data sources comprised surveys (n = 257), 5 focus groups (n= 23), and an individual interview with the program director (n = 1). Survey data indicated overall satisfaction with the program.…

Statistical analysis and optimization of copper biosorption capability ...

African Journals Online (AJOL)

These three variables were further adopted by the three-level Box– Behnken design to correlate between the three variables and to estimate the optimal conditions required for Cu2+ biosorption. Although the maximum value for Cu2+ biosorption was 85%, the calculated optimum percentage was 72%, which was a 2.57-fold ...

Search Results | Page 10 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 91 - 100 of 257 ... Enhanced Preservation of Fruits Using Nanotechnology (CIFSRF Phase 2). Poor handling of fruit results in post-harvest losses of nearly 40% in tropical ... New research aims to help control malaria in one watershed in northern Peru. Malaria is widespread in Peru's arid North Coast because of the ...

News and Announcements

Science.gov (United States)

1999-05-01

Supplementary Materials The number of supplementary materials that accompany print articles has grown and also become more varied. The new guidelines for lab experiments call for supplementary materials in most cases, so that the actual materials used in lab can be made available. The From Past Issues column edited by Kathryn Williams and many of the technology columns frequently have supplements for JCE Online. An especially interesting supplement that we would like to call to the attention of readers is a collection of videos from the E. O. Lawrence Berkeley National Laboratory, based on interviews with nuclear chemists who have discovered and studied the heaviest elements. These movies accompany the Viewpoints article, "Chemistry of the Heaviest Elements-One Atom at a Time" by Darleane C. Hoffman and Diana M. Lee. The titles of the movies are listed below; illustrative stills are shown at the bottom of the page. Researchers involved with the segments about Lawrencium include Robert Silva, Torbjorn Sikkeland, Matti Nurmia, Robert Latimer, and Albert Ghiorso, all of whom are from the Lawrence Berkeley Laboratory. (QuickTime 3 is needed in order to view the videos; it can be downloaded free from http://www.apple.com.) A Brief Note about Plutonium, by Glenn Seaborg Plutonium and Why It Was Kept a Secret The Prediction of the Actinide Series, by Glenn Seaborg First Chemical Separation of Lawrencium at Lawrence Radiation Laboratory in 1970 The HILAC or Heavy-Ion Linear Accelerator Discovery of Lawrencium How To Collect Lawrencium Atoms The Discovery of Element 106-Finally The Naming of Element 106 The Limits of Discovering the Heavy Elements What Good Is a Heavy Element? To see these videos, view the Supplements of http://JChemEd.chem.wisc.edu/Journal/Issues/1999/Mar/abs331.html. People: Glenn Seaborg Glenn Seaborg, frequent contributor and faithful supporter of this Journal, died February 25, 1999, at his home in Lafayette, California, at the age of 86. At the Fall

U-Pb and Rb-Sr geochronology of the Wedgeport granitoid pluton, southwestern Nova Scotia

International Nuclear Information System (INIS)

Cormier, R.F.; Keppie, J.D.; Odom, A.L.

1988-01-01

Zircons from biotite monzogranite of the Wedgeport Pluton, intrusive into deformed metasediments of the Cambrian(?) Goldenville formation in the southwestern Meguma Terrane of Nova Scotia, yield concordant U-Pb ages of 316 ± 5 Ma. This is interpreted as the time of intrusion and crystallization. Within the error limits, the 323 ± 0.0056 Rb-Sr analyses of mineral separates of biotite, potassium feldspar, and quartz-plagioclase from several samples yield subparallel, internal isochrons with an average age of 257 ± 8 Ma. Initial ratios of the internal isochrons range from 0.716 to 0.759. A slow-cooling model for the latter data is discarded because the mineral data fall on straight lines. Instead, a reheating event related to plutonism ca 257 Ma ago, which was sufficient to cause local grain-to-grain migration and reequilibration of strontium and rubidium but not large-scale redistribution, is invoked. This reheating is also inferred to be responsible for the hydrothermal alteration and Sn-U mineralization concentrated along the northwestern margin of the pluton. A dextral northeast-southeast shear zone cutting the pluton is also inferred to be ca. 257 Ma old. It may be related to the last stages of westward abduction of the Meguma Terrane. These results provide a clear example of Permo-Carboniferous plutonism in the southwestern Meguma Terrane and suggest a similar interpretation may apply to other anomalously young ages recorded in this area. In light of these results, the Permo-Carboniferous age of the large East Kemptville tin deposit and its location in a dextral shear zone suggest that the association of younger plutonism and shear zones may be a significant factor for economic mineralization. (22 refs., 4 tabs., 3 figs.)

Hydraulic performance of locally made LDPE-Pipes for drip irrigation systems

International Nuclear Information System (INIS)

Aslam, M.; Mangrio, A.G.; Ibrar, S.U.

2007-01-01

LDPE pipes give controlled and efficient irrigation practices for plant-water requirement. All five sizes of pipes i.e. 13.0, 25.7, 31.5, 38 and 50 mm with wall thicknesses of 1.4, 1.8, 2.0, 2.5 and 3.0 mm respectively in 100 and 200 m lengths were selected for determination of pressure-discharge relationships, manufacturing coefficient of variation and friction coefficient. The pipes were operated at pressure ranging from 10 to 50 psi (7.00 -35.00 meter head) with an increment of 5 psi. The discharge of different sizes of LDPE pipes was measured under various pressures. The average discharge of the pipes with 13.0, 25.7, 31.5, 38 and 50 mm pipe sizes between 10 to 50 psi pressure heads were 0.058, 0.301, 0.402, 0.909 and 2.076 lps respectively for 100 meter pipe length and 0.056, 0.10, 0.13, 0.45 and 1.993 lps respectively for 200 meter pipe length. The average friction head loss of the pipes with 13.0, 25.7, 31.5, 38 and 50 mm pipe sizes between 10 to 50 psi pressure heads were 3.21, 2.51, 1.66, 3.99 and 3.64 meter per 100 meter pipe length and 6.44, 5.03, 3.15, 6.79 and 6.85 meter per 200 meter pipe length respectively. The average C-value of all sizes of selected pipes for both lengths between 10-50 psi was indicated 18% less than the recommend value. Results indicated that the discharge, friction head losses and friction coefficient increased with the increase in pressure. This study helped describe the optimal pressure requirement to achieve the desirable discharge low friction head losses and minimum friction coefficients. (author)

Virulence and site of infection of the fungus, Hirsutella thompsonii, to the honey bee ectoparasitic mite, Varroa destructor.

Science.gov (United States)

Peng, Christine Y S; Zhou, Xinsheng; Kaya, Harry K

2002-11-01

The Varroa mite, Varroa destructor, is recognized as the most serious pest of both managed and feral Western honey bee (Apis mellifera) in the world. The mite has developed resistance to fluvalinate, an acaricide used to control it in beehives, and fluvalinate residues have been found in the beeswax, necessitating an urgent need to find alternative control measures to suppress this pest. Accordingly, we investigated the possibility of using the fungus, Hirsutella thompsonii, as a biocontrol agent of the Varroa mite. Among the 9 isolates of H. thompsonii obtained from the University of Florida and the USDA, only the 3 USDA isolates (ARSEF 257, 1947 and 3323) were infectious to the Varroa mite in laboratory tests. The mite became infected when it was allowed to walk on a sporulating H. thompsonii culture for 5 min. Scanning electron micrographs revealed that the membranous arolium of the mite leg sucker is the focus of infection where the fungal conidia adhered and germinated. The infected mites died from mycosis, with the lethal times to kill 50% (LT(50)s) dependent on the fungal isolates. Thus, the LT(50)s were 52.7, 77.2, and 96.7h for isolates 3323, 257, and 1947, respectively. Passage of H. thompsonii through Varroa mite three times significantly reduced the LT(50)s of isolates 257 and 1947 (P<0.05) but not the LT(50) of isolate 3323. The fungus did not infect the honey bee in larval, prepupal, pupal, and adult stages under our laboratory rearing conditions. Our encouraging results suggest that some isolates of H. thompsonii have the potential to be developed as a biocontrol agent for V. destructor. However, fungal infectivity against the mites under beehive conditions needs to be studied before any conclusion can be made.

Comparative evaluation of reproductive parameters between the automatic GEDIS cervical insemination method and the traditional in multicolor bristles

Directory of Open Access Journals (Sweden)

Núñez-Torres Oscar Patricio

2017-04-01

Full Text Available The research was carried out in Ecuador, in the province of Tungurahua, Cevallos county. A comparison of reproductive parameters between the cervical self insemination method and the traditional one in multiparous sows was performed using 12 sows (hybrid females between the second and fourth calving, dividing In two groups of 6 sows respectively, using the insemination protocol 12h - 24h - 36h. Fresh semen was prepared with long-term diluent + bidistilled water, at a concentration of 3 x 109 spermatozoa/mL in total volume per 100 mL straw. At the time of insemination the amount of seminal reflux was determined and when the Student's T test was applied with paired observations in the results, they statistically reported a significant difference at 5% among the evaluated methods, the calculated T value was 9.50 Which is greater than the T of tables at 5% of 2.57. The duration of each method was determined, results that reported similarity between the two methods (15 min. At 21 days post insemination pregnancy was diagnosed by ultrasound and evaluation of no return of heat, results that reported in both methods 100% effectiveness. Subsequently, at the time of delivery, the number of total born piglets was evaluated, using the Student's T-test with paired observations that statistically there was no significant difference at 5% between the two methods, the calculated T value was 0, 14 which is less than the T of tables at 5% of 2.57. We also determined the weight of piglets at birth, reported by Student's t-test with paired observations that there is a statistically significant difference to 5% among the evaluated methods, the calculated T value was 5.17, which is higher than the T Of tables at 5% of 2.57. As for costs there is no considerable difference.

Genetic variation within clonal lineages of Phytophthora infestans revealed through genotyping-by-sequencing, and implications for late blight epidemiology

Science.gov (United States)

Genotyping-by-sequencing (GBS) was performed on 257 Phytophthora infestans isolates belonging to four clonal lineages to study within-lineage diversity. The four lineages used in the study included US-8 (n=28), US-11 (n=27), US-23 (n=166), and US-24 (n=36), with isolates originating from 23 of the U...

Report of the NIH Panel to Define Principles of Therapy of HIV Infection and Guidelines for the Use of Antiretroviral Agents in HIV-Infected Adults and Adolescents. Vol. 47/No. RR-5.

Science.gov (United States)

1998-04-25

1991;5:1-14. 85. Kinloch-de Loes S, de Saussure P, Saurat JH, Stalder H, Hirschel B, Perrin LH. Symptomatic primary infection due to human imm...epidemiologic features of primary HIV infection. Ann Intern Med 1996;125:257-64. 17. Kinloch-de Loes S, de Saussure P, Saurat J, Stalder H, Hirschel B, Perrin

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

These results suggest that sexual preference may be influenced in a significant proportion of homosexual men by a biological/genetic factor that also controls direction of hair-whorl rotation. pp 257-263 Research Article. Cloning of a novel gene, Cymg1, related to family 2 cystatins and expressed at specific stages of mouse ...

Mechanistic Study of 17 alpha-Ethinylestradiol Biodegradation by Pleurotus ostreatus: Tracking of Extracelullar and Intracelullar Degradation Mechanisms

Czech Academy of Sciences Publication Activity Database

Křesinová, Zdena; Moeder, M.; Ezechiáš, Martin; Svobodová, Kateřina; Cajthaml, Tomáš

2012-01-01

Roč. 46, č. 24 (2012), s. 13377-13385 ISSN 0013-936X R&D Projects: GA TA ČR TA01020804; GA ČR GAP503/10/0408 Institutional support: RVO:61388971 Keywords : WHITE-ROT FUNGI * ENDOCRINE-DISRUPTING CHEMICALS * PERSONAL CARE PRODUCTS Subject RIV: EE - Microbiology, Virology Impact factor: 5.257, year: 2012

Preparation of Mn-Zn ferrite nanoparticles and their silica-coated clusters: magnetic properties and transverse relaxivity

Czech Academy of Sciences Publication Activity Database

Kaman, Ondřej; Kuličková, Jarmila; Herynek, Vít; Koktan, Jakub; Maryško, Miroslav; Dědourková, T.; Knížek, Karel; Jirák, Zdeněk

2017-01-01

Roč. 427, Apr (2017), s. 251-257 ISSN 0304-8853 Institutional support: RVO:68378271 ; RVO:68378041 Keywords : magnetic nanoparticles * Mn-Zn ferrite * hydrothermal synthesis * magnetic resonance imaging * transverse relaxivity Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016

A multiplex set of microsatellite markers for the scarlet rosefinch (Carpodacus erythrinus)

Czech Academy of Sciences Publication Activity Database

Poláková, Radka; Vyskočilová, Martina; Martin, J.-F.; Mays Jr., H. L.; Hill, G. E.; Bryja, Josef; Albrecht, Tomáš

2007-01-01

Roč. 7, č. 6 (2007), s. 1375-1378 ISSN 1471-8278 R&D Projects: GA ČR GA206/06/0851 Grant - others:NSF(US) DEB-0077804 Institutional research plan: CEZ:AV0Z60930519 Keywords : Carpodacus * cross-amplification * heterozygosity * microsatellites Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007

To Ink or Not to Ink: The Meaning of Tattoos among College Students

Science.gov (United States)

Dickson, Lynda; Dukes, Richard L.; Smith, Hilary; Strapko, Noel

2015-01-01

We examine the process of getting a tattoo and its meaning among 195 tattooed and 257 non-tattooed undergraduates. Most tattooed respondents contemplate getting a tattoo for months, get a professional tattoo, can cover it easily, and like it. Respondents acquire first tattoos to represent important role transitions and as a form of identity and…

40 CFR 421.266 - Pretreatment standards for new sources.

Science.gov (United States)

2010-07-01

... Subcategory Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of... day Maximum for monthly average mg/troy ounce of precious metals, in the granulated raw material... average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide (total) 0.740 0.296...

40 CFR 421.263 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

... for any 1 day Maximum for monthly average mg/troy ounce of precious metals, including silver.../troy ounce of precious metals in the granulated raw material Copper 0.819 0.390 Cyanide (total) 0.128 0... Maximum for monthly average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide...

Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

Czech Academy of Sciences Publication Activity Database

Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

2009-01-01

Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei

Directory of Open Access Journals (Sweden)

Diego Símini

2015-01-01

Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.

Occurrence of Exercise Dependence in a College-Aged Population

Science.gov (United States)

Garman, J. F.; Hayduk, D.M.; Crider, D. A.; Hodel, M. M.

2004-01-01

Students (n = 257) were evaluated for scope and commitment to physical activity by use of self-reported data that assessed amount of activity per week and the obligatory or pathological nature of their activity patterns. Exhibiting atypical activity patterns, 21.8% of the students in the sample exercised 360 or more minutes per week and…

Germination, growth and physiological responses of Senegalia ...

African Journals Online (AJOL)

For plants growth and physiological responses, seedlings were individually cultivated in plastic bags (25×12 cm) containing non-sterile soil and watered with four salt solutions (0, 86, 171 and 257 mM NaCl). Four months after the plants' cultivation, the results showed that for all species, the salinity reduced significantly the ...

Surgical decompression for traumatic spinal cord injury in a tertiary ...

African Journals Online (AJOL)

The spectrum of injuries included cervical 27 (77.1%), thoracic 7 (20.0%), and lumbar vertebrae 1 (2.9%). The outcome as measured by Frankel's grade at 6 months after surgery showed improvement in 9 (25.7%) patients following intervention. All patients who presented with Frankel's Grade C and D improved to Grade E ...

Reaching the superlinear convergence phase of the CG method

Czech Academy of Sciences Publication Activity Database

Axelsson, Owe; Karátson, J.

2014-01-01

Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

Hormonal regulation of response to oxidative stress in insects - an update

Czech Academy of Sciences Publication Activity Database

Kodrík, Dalibor; Bednářová, Andrea; Zemanová, Milada; Krishnan, N.

2015-01-01

Roč. 16, č. 10 (2015), s. 25788-25816 E-ISSN 1422-0067 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:60077344 Keywords : adipokinetic hormones (AKH) * AKH gene * anti-oxidative mechanisms Subject RIV: ED - Physiology Impact factor: 3.257, year: 2015 http://www.mdpi.com/1422-0067/16/10/25788

Counterinsurgency in the Philippines. Problems and Prospects

Science.gov (United States)

1989-10-01

funds and the farmer-producers in the rural areas are practically begging for start-up funds with which to finance a backyard poultry farm, a cottage...257-70. Burton, Sandra. "Aquino’s Philippines: The Center Holds." Foreign Affairs 65:3 (America and the World 1986): 524-37. Butcher , Scott. U.S

Regioselective alcoholysis of silychristin acetates catalyzed by lipases

Czech Academy of Sciences Publication Activity Database

Vavříková, Eva; Gavezzotti, P.; Purchartová, Kateřina; Fuksová, Kateřina; Biedermann, David; Kuzma, Marek; Riva, S.; Křen, Vladimír

2015-01-01

Roč. 16, č. 6 (2015), s. 11983-11995 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-03037S; GA MŠk(CZ) LD14096; GA MŠk LH13097 Institutional support: RVO:61388971 Keywords : acetylation * alcoholysis * lipase Subject RIV: CC - Organic Chemistry Impact factor: 3.257, year: 2015

Ultraviolet laser-induced fluorescence detection strategies in capillary electrophoresis: determination of naphthalene sulphonates in river water.

NARCIS (Netherlands)

Kok, S.J.; Isberg, I.C.K.; Gooijer, C.; Brinkman, U.A.T.; Velthorst, N.H.

1998-01-01

Various UV-laser-induced fluorescence detection strategies for capillary electrophoresis (CE) are compared, i.e. two UV-laser systems (a pulsed laser providing up to 25 mW of tunable emission, applied at 280, 290 and 325 nm, and a continuous wave (cw) laser providing up to 100 mW of 257 nm emission)

Maybe it's not Python that sucks, maybe it's my code

CERN Multimedia

CERN. Geneva

2015-01-01

Did you know that in Python integers from -5 to 257 are preallocated? Reusing them 1000 times, instead of allocating memory for a bigger integer, saves a whopping 1 millisecond of code's execution time! Isn't that thrilling? Well, before you get that crazy, learn some basic performance tricks that you can start using today.

Probabilistic precipitation nowcasting based on an extrapolation of radar reflectivity and an ensemble approach

Czech Academy of Sciences Publication Activity Database

Sokol, Zbyněk; Mejsnar, Jan; Pop, Lukáš; Bližňák, Vojtěch

2017-01-01

Roč. 194, 15 September (2017), s. 245-257 ISSN 0169-8095 Institutional support: RVO:68378289 Keywords : scale-dependence * forecast * predictability * images * model * rainfall * weather * analogs * motion Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.778, year: 2016 http://www.sciencedirect.com/science/article/pii/S0169809516305142

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 257 ... Vol 22, No 1 (2012), Awareness and Incidence of Plagiarism among Undergraduates in a Nigerian Private University, Abstract. Y T Babalola. Vol 12, No 2 (2002), Book Publishing Patterns in Uganda: Challenges and Prospects, Abstract. Stephen M. Mutula, Mabel M.T. Nakitto. Vol 15, No 1 (2005), Book ...

77 FR 62167 - World Trade Center Health Program; Addition of Certain Types of Cancer to the List of WTC-Related...

Science.gov (United States)

2012-10-12

... stricken. Digestive System [ssquf] The ICD-9 heading code 154.8 should have been included for ``malignant... digestive system,'' and ``ill-defined sites within the digestive system'' should be 159.0, 159.8, and 159.9... DEPARTMENT OF HEALTH AND HUMAN SERVICES 42 CFR Part 88 [Docket No. CDC-2012-0007; NIOSH-257] RIN...

Uniformity of the soft-x-ray emissions from gold foils irradiated by OMEGA laser beams determined by a two-mirror normal-incidence microscope with multilayer coatings

International Nuclear Information System (INIS)

Seely, John F.; Boehly, Thomas; Pien, Gregory; Bradley, David

1998-01-01

A two-mirror normal-incidence microscope with multilayer coatings was used to image the soft-x-ray emissions from planar foils irradiated by OMEGA laser beams. The bandpass of the multilayer coatings was centered at a wavelength of 48.3 Angstrom (257-eV energy) and was 0.5 Angstrom wide. Five overlapping OMEGA beams, without beam smoothing, were typically incident on the gold foils. The total energy was 1500 J, and the focused intensity was 6x10 13 Wcm -2 . The 5.8x magnified images were recorded by a gated framing camera at various times during the 3-ns laser pulse. A pinhole camera imaged the x-ray emission in the energy range of >2 keV. On a spatial scale of 10 μm, it was found that the soft-x-ray images at 257 eV were quite uniform and featureless. In contrast, the hard-x-ray images in the energy range of >2 kev were highly nonuniform with numerous features of size 150 μm. copyright 1998 Optical Society of America

Eating attitudes, body image satisfaction and self-esteem of South ...

African Journals Online (AJOL)

BMI was positively associated with self-esteem (p = 0.01, r = 0.134) and negatively with dieting behaviour in White boys (p = 0.004, r = −0.257), and with lower EAT-26 bulimic and oral control scores in Black boys. In conclusion, the findings highlight ethnic differences and a need to better understand cultural differences that ...

Teachers' Teaching Experience and Students' Learning Outcomes in Secondary Schools in Ondo State, Nigeria

Science.gov (United States)

Adeyemi, T. O.

2008-01-01

This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools in the State. This population was made up of 147 rural schools and 110 urban schools. It was also made up of 12 single sex…

Candidate gene linkage approach to identify DNA variants that predispose to preterm birth

DEFF Research Database (Denmark)

Bream, Elise N A; Leppellere, Cara R; Cooper, Margaret E

2013-01-01

Background:The aim of this study was to identify genetic variants contributing to preterm birth (PTB) using a linkage candidate gene approach.Methods:We studied 99 single-nucleotide polymorphisms (SNPs) for 33 genes in 257 families with PTBs segregating. Nonparametric and parametric analyses were...... through the infant and/or the mother in the etiology of PTB....

Mechanism of selenium hydride atomization, fate of free atoms and temperature distribution in an argon shielded, highly fuel-rich, hydrogen-oxygen diffusion micro-flame studied by atomic absorption spectrometry

Czech Academy of Sciences Publication Activity Database

D'Ulivo, A.; Dědina, Jiří; Lampugnani, L.; Matoušek, Tomáš

2002-01-01

Roč. 17, č. 3 (2002), s. 253-257 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453; GA ČR GA203/98/0754 Institutional research plan: CEZ:AV0Z4031919 Keywords : hydride atomization * hydride generation * atomic absorption spectrometry Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.250, year: 2002

Financial Stress in the Czech Republic: Measurement and Effects on the Real Economy

Czech Academy of Sciences Publication Activity Database

Horváth, Roman; Malega, J.

2017-01-01

Roč. 2017, č. 3 (2017), s. 257-268 ISSN 1210-0455 R&D Projects: GA ČR GA15-10331S Institutional support: RVO:67985556 Keywords : financial stress indicator * vector autoregression * Czech Republic Subject RIV: AH - Economics OBOR OECD: Finance Impact factor: 0.710, year: 2016 http://library.utia.cas.cz/separaty/2017/E/horvath-0466511.pdf

Accommodation, Cafes and Restaurants. Industry Training Monograph No. 8.

Science.gov (United States)

Dumbrell, Tom

Australia's accommodation, cafes, and restaurants industry represents more than half of the nation's total tourism and hospitality employment. It accounts for roughly 4.5% of all jobs in Australia (400,000 workers). Since 1987, the number of jobs in the sector has risen from about 257,000 to about 372,000. Approximately 57% of employees are…

A Randomized Trial of a Multifaceted Intervention to Reduce Falls among Community-Dwelling Adults

Science.gov (United States)

Fox, Patrick J.; Vazquez, Laurie; Tonner, Chris; Stevens, Judy A.; Fineman, Norman; Ross, Leslie K.

2010-01-01

Using a randomized controlled trial, we tested the efficacy of a fall prevention intervention to reduce falls among adults in a community-based health promotion program. Adults aged 65 and older within two counties were recruited (control n = 257; intervention n = 286). After 12 months, there was a significant decrease in the number of falls in…

The Upgraded DØ detector

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav

2006-01-01

Roč. 565, - (2006), s. 463-537 ISSN 0168-9002 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : Fermilab * DZero * DØ * detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.185, year: 2006

Effects of long-term immobilization and recovery on human triceps surae and collagen turnover in the Achilles tendon in patients with healing ankle fracture

DEFF Research Database (Denmark)

Christensen, Britt; Dyrberg, Eva; Aagaard, Per

2008-01-01

increased (PINP: 257 vs. 56 ng/ml; ICTP: 9.8 vs. 2.1 microg/l) in the immobilized leg compared with the control leg after the 7 wk of immobilization, and levels decreased again in the immobilized leg during the recovery period (PINP: 103 vs. 44 ng/ml; ICTP: 4.2 vs. 1.9 microg/l). A significant reduction...

Development of Creative Behavior Observation Form: A Study on Validity and Reliability

Science.gov (United States)

Dere, Zeynep; Ömeroglu, Esra

2018-01-01

This study, Creative Behavior Observation Form was developed to assess creativity of the children. While the study group on the reliability and validity of Creative Behavior Observation Form was being developed, 257 children in total who were at the ages of 5-6 were used as samples with stratified sampling method. Content Validity Index (CVI) and…

76 FR 72715 - Agency Information Collection Activities: Cargo Manifest/Declaration, Stow Plan, Container Status...

Science.gov (United States)

2011-11-25

... information (a total capital/startup costs and operations and maintenance costs). The comments that are... of total annual responses was lowered from 11,300,000 to 8,100,000. Vessel Stow Plan: the number of... 74 to 60, and the number of total responses was raised from 72,121,193 to 257,100,000. Type of Review...

First report of metacercariae of Cyathocotyle prussica parasitising a fish host in the Czech Republic, Central Europe

Czech Academy of Sciences Publication Activity Database

Kvach, Yuriy; Ondračková, Markéta; Jurajda, Pavel

2016-01-01

Roč. 53, č. 3 (2016), s. 257-261 ISSN 0440-6605 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR(CZ) GAP505/12/2569 Institutional support: RVO:68081766 Keywords : Cyathocotyle prussica * Proterorhinus semilunaris * metacercariae * morphology * first finding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.472, year: 2016

21 CFR 184.1660 - Propyl gallate.

Science.gov (United States)

2010-04-01

... alcohol. (b) The ingredient meets the specifications of the “Food Chemicals Codex,” 3d Ed. (1981), pp. 257... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Propyl gallate. 184.1660 Section 184.1660 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

24 CFR 4001.102 - Cross-reference.

Science.gov (United States)

2010-04-01

... section 203 of the National Housing Act (12 U.S.C. 1709) apply to mortgages on one-family dwellings to be insured under section 257 of the National Housing Act (12 U.S.C. 1701z-22), except the following... contract regarding use of dwelling for transient or hotel purposes; 203.17(d) Maturity; 203.18 Maximum...

Cell Growth Arrest Mediated by STAT Proteins in Breast Cancer Cells

Science.gov (United States)

1998-07-01

Wei, S., Matsusaka, T., Yoshida, K., Sudo, T., Naruto , M., and Kishimoto, T. (1994) Cellll{\\), 63-71 34. David, M., and Larner, A. C. e. a. (1992...T., Naruto , M., and Kishimoto, T. (1994) Cell 77, 63-71 34. David, M., and Lamer, A. C. (1992) Science 257, 813-815 35. Sadowski, H. B., and Gilman

Magnetically separable photocatalytic composite gamma-Fe(2)O(3)@TiO(2) synthesized by heterogeneous precipitation

Czech Academy of Sciences Publication Activity Database

Tyrpekl, Václav; Vejpravová, J.P.; Roca, A.G.; Murafa, Nataliya; Szatmáry, Lórant; Nižňanský, D.

2011-01-01

Roč. 257, č. 11 (2011), s. 4844-4848 ISSN 0169-4332 R&D Projects: GA MŠk(CZ) LC06041; GA AV ČR KAN400100653 Institutional research plan: CEZ:AV0Z40320502 Keywords : nano composite * oxides * magnetic properties * transmission electron microscopy * X-ray powder diffraction Subject RIV: CA - Inorganic Chemistry Impact factor: 2.103, year: 2011

ORF Alignment: NC_000912 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

78 FR 26269 - Connect America Fund; High-Cost Universal Service Support

Science.gov (United States)

2013-05-06

... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC...-807A1.pdf . I. Introduction 1. In the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011, the... business, will be placed in individual census blocks, and a network topology will be constructed to serve...

Chronopotentiometric sensing of anterior gradient 2 protein

Czech Academy of Sciences Publication Activity Database

Vargová, Veronika; Hrstka, R.; Hernychová, L.; Coufalová, D.; Ostatná, Veronika

2017-01-01

Roč. 240, JUN2017 (2017), s. 250-257 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00956S Institutional support: RVO:68081707 Keywords : catalyzed hydrogen evolution * mercury -electrodes * affinity tags Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016

The Impact of Stressors on Military Performance

Science.gov (United States)

2013-12-01

mechanical (vibration, eyewear , interface with other equipment); physiological (fatigue, sleep deprivation, hypoxia, medical condition...and vibration in Canadian forces armoured vehicles. Industrial Health, 45, 318-327. Nakishima, A., & Cheung, B. (2006). The effects of vibration...environments. International Journal of Industrial Ergonomics, 9, 245-257. Rash, C. E., Hiatt, K. L., Wildzunas, R., Caldwell, J. L., Caldwell, J. A

Responses to Children's Media Use in Families with and without Siblings: A Family Development Perspective

Science.gov (United States)

Davies, John J.; Gentile, Douglas A.

2012-01-01

Drawing on family development theory, this study provides insight into how family stages with and without siblings are related to media habits and effects. Two national samples (N = 527 and N = 1,257) present a cross-sectional snapshot of media uses in families across three stages of family life: families with preschoolers (2-6 years), with…

Relationship between the minimum and maximum temperature thresholds for development in insects

Czech Academy of Sciences Publication Activity Database

Dixon, Anthony F. G.; Honěk, A.; Keil, P.; Kotela, M.A.A.; Šizling, A. L.; Jarošík, Vojtěch

2009-01-01

Roč. 23, č. 2 (2009), s. 257-264 ISSN 0269-8463 R&D Projects: GA MŠk(CZ) LC06073 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z60050516 Keywords : distribution * insects * thermal requirements for development * thermal window * thermal tolerance range * ectotherms Subject RIV: EG - Zoology Impact factor: 4.546, year: 2009

Medical Students' Satisfaction and Academic Performance with Problem-Based Learning in Practice-Based Exercises for Epidemiology and Health Demographics

Science.gov (United States)

Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.

2015-01-01

The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…

Download this PDF file

African Journals Online (AJOL)

FRANK

Barro, F.I., Mbodji, S., Ndiaye, A. L., Madougou, S., Zerbo, I., Zougmore, F. and Sissoko, G., 2004. European. Photovoltaic Solar Energy Conference and Exhibition, Poster 1AV2.57. Basu, P.K. and Singh, S.N., 1994. Solar Energy Materials and Solar Cells, 33: 317-329. Betser, Y., Ritter, D., Bahir, G., Cohen, S. and Sperling, ...

Measurement of the differential cross-section for the production of an isolated photon with associated jet in p anti-p collisions at s**(1/2) = 1.96 TeV

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

2008-01-01

Roč. 666, č. 5 (2008), s. 435-445 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron, * photon Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

Measurement of the shape of the boson transverse momentum distribution in p anti-p ---> Z / gamma* ---> e+ e- + X events produced at s**(1/2) = 1.96 TeV

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

2008-01-01

Roč. 100, č. 10 (2008), 102002/1-10200/7 ISSN 0031-9007 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * boson Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...

obesity and systemic hypertension in accra communities

African Journals Online (AJOL)

SUMMARY. Thc stildy was carried out to deterninine the preva-. Icncc of obesity associated with systemic hypcr- tcnsion in four comn~unities in Accra. A total of. 598 persons, of \\\\ll~om 257 were Inale and 341 fe- male agcd 15ycar and above werc examined. Their blood prcssurc, weight, and height were measuretl; and liom ...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Author Affiliations. Romina A Frenzel1 Gustavo P Romanelli1 Mirta N Blanco1 Luis R Piz1. Centro de Investigación y Desarrollo en Ciencias Aplicadas ``Dr. Jorge J. Ronco” (CINDECA), CCT-LaPlata-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 47 N° 257 (B1900AJK) La Plata, Argentina ...

Method for Estimating Pesticide Use for County Areas of the Conterminous United States

Science.gov (United States)

2000-01-01

Vernolate 1432 Herbicide 498,688 257,728 Methazole 9096 Herbicide 491,795 859,590 Oxyfluorfen 4000 Herbicide 490,752 1,307,624 Fosetyl Al 5031 Fungicide... Oxyfluorfen Grapes 102,702 144,720 Almonds 95,932 282,152 Cotton 77,944 380,376 Apples 37,006 23,945 Pistachios 26,385 25,346 Field and Grass Seed

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Earth System Science; Volume 113; Issue 2. Volume 113, Issue 2. June 2004, pages 129-257. pp 129-138. The evaporation of the charged and uncharged water drops suspended in a wind tunnel · Rohini V Bhalwankar A B Sathe A K Kamra · More Details Abstract Fulltext PDF. A laboratory ...

A vanishing diffusion limit in a nonstandard system of phase field equations

Czech Academy of Sciences Publication Activity Database

Colli, P.; Gilardi, G.; Krejčí, Pavel; Sprekels, J.

2014-01-01

Roč. 3, č. 2 (2014), s. 257-275 ISSN 2163-2480 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : nonstandard phase field system * nonlinear partial differential equations * asympotic limit Subject RIV: BA - General Mathematics Impact factor: 0.373, year: 2014 http://aimsciences.org/journals/displayArticlesnew.jsp?paperID=9918

Market supply response of imported sardinella in Cross River State ...

African Journals Online (AJOL)

The following results were obtained; the short-run and long-run own price elasticity were 2.062 and 1.257 which were significant at the 5 percent and 1 percent levels respectively. The error correction coefficient Ect(-1) was - 1.536 which was significant at the 5 percent level. The own price long-run elasticity estimates were ...

Differential Salt-Induced Dissociation of the p53 Protein Complexes with Circular and Linear Plasmid DNA Substrates Suggest Involvement of a Sliding Mechanism

Czech Academy of Sciences Publication Activity Database

Šebest, Peter; Brázdová, Marie; Fojta, Miroslav; Pivoňková, Hana

2015-01-01

Roč. 16, č. 2 (2015), s. 3163-3177 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GAP301/11/2076; GA ČR(CZ) GBP206/12/G151 Institutional support: RVO:68081707 Keywords : TUMOR-SUPPRESSOR P53 * CISPLATIN -DAMAGED DNA * SUPERCOILED DNA Subject RIV: BO - Biophysics Impact factor: 3.257, year: 2015

Gamma-secretase activity of presenilin 1 regulates acetylcholine muscarinic receptor-mediated signal transduction

DEFF Research Database (Denmark)

Popescu, Bogdan O; Cedazo-Minguez, Angel; Benedikz, Eirikur

2004-01-01

, we studied the effect of two other FAD PS1 mutants (M146V and L250S) and two dominant negative PS1 mutants (D257A and D385N) on basal and carbachol-stimulated phosphoinositide (PI) hydrolysis and intracellular calcium concentrations ([Ca2+]i) in SH-SY5Y neuroblastoma cells. We found a significant...

Implicit Racial Biases in Preschool Children and Adults from Asia and Africa

Science.gov (United States)

Qian, Miao K.; Heyman, Gail D.; Quinn, Paul C.; Messi, Francoise A.; Fu, Genyue; Lee, Kang

2016-01-01

This research used an Implicit Racial Bias Test to investigate implicit racial biases among 3- to 5-year-olds and adult participants in China (N = 213) and Cameroon (N = 257). In both cultures, participants displayed high levels of racial biases that remained stable between 3 and 5 years of age. Unlike adults, young children's implicit racial…

Increased prevalence of coronary artery disease risk markers in patients with chronic hepatitis C

DEFF Research Database (Denmark)

Roed, Torsten; Kristoffersen, Ulrik Sloth; Knudsen, Andreas

2014-01-01

% confidence interval [CI] 0.9-2.7) and smoked more (53% versus 38%, PR 1.4; 95% CI 0.9-2.1). The two groups had similar body mass index (mean 25.0 versus 25.7 kg/m(2)), whereas those with chronic hepatitis C had less dyslipidemia (including significantly lower low-density lipoprotein and cholesterol...

Factors associated with the risk of fall in adults in the postoperative period: a cross-sectional study.

Science.gov (United States)

Mata, Luciana Regina Ferreira da; Azevedo, Cissa; Policarpo, Aryanne Gabrielle; Moraes, Juliano Teixeira

2017-06-08

to assess the factors associated with the risk of fall in patients undergoing surgical procedures. quantitative and cross-sectional study carried out with 257 adult patients in a hospital in the state of Minas Gerais, Brazil. Data were collected using the sociodemographic and clinical questionnaire, the Morse Fall Scale, and the Quality of Recovery Score. Data were submitted to descriptive statistical analysis and multinomial logistic regression. The level of significance was set at 0.05. 35.4% of patients had high risk of falls, 38.9% had moderate risk and 25.7% had low risk. The mean value in the surgical recovery scale was 175.37 points and no patient presented poor surgical recovery. Regarding the results of the bivariate analysis, it was found that age (prisk of fall, whereas cancer (p=0.004) was positively associated with moderate risk of fall. Surgical recovery (p=0,008) was inversely associated with high risk of fall. the results of this study allowed the identification of five factors associated with the risk of fall in adults in the postoperative hospital stay. These findings may support the planning of nursing actions aimed at preventing the risk of fall in the postoperative period. evaluar los factores asociados al riesgo de caída en pacientes sometidos a procedimientos quirúrgicos. estudio cuantitativo, transversal, realizado en 257 pacientes adultos en un hospital de Minas Gerais, Brasil. La recolección de datos se realizó por medio de un cuestionario sociodemográfico y clínico, Morse Fall Scale Quality of Recovery Score. Los datos fueron sometidos al análisis estadístico descriptivo y regresión logística multinomial. El nivel de significación adoptado fue de 0,05. 35,4% de los pacientes presentaron elevado riesgo de caídas, 38,9% moderado riesgo y 25,7% bajo riesgo. La escala de recuperación quirúrgica indicó valor promedio de 175,37 puntos y ningún paciente presentó recuperación quirúrgica precaria. En relación a los resultados

Defense Enterprise Accounting and Management System-Increment 1 (DEAMS Inc 1)

Science.gov (United States)

2016-03-01

information accurately and in conformance with Generally Accepted Accounting Principles , to comply with Congressional requirements of the Chief Financial ...2016 Major Automated Information System Annual Report Defense Enterprise Accounting and Management System-Increment 1 (DEAMS Inc 1) Defense...Phone: 937-257-2714 Fax: DSN Phone: 787-2714 DSN Fax: Date Assigned: August 17, 2015 Program Information Program Name Defense Enterprise Accounting

Effect of dietary yeast autolysate on performance, slaughter, and ...

African Journals Online (AJOL)

TOSHIBA

2017-05-22

May 22, 2017 ... During the study (from 1st to 42nd day), quails fed dietary treatments ... affect poultry performance parameters and carcass characteristics (Aydin & Aydin, .... Serum sample levels of AST, ALP, cholesterol, high-density lipoprotein (HDL), total ... 28th day. M 98 93.26 ± 1.97 96 97.26 ± 2.57 96 97.50 ± 2.24 99 ...

Measurement of the ratio of the p anti-p --> W+c-jet cross section to the inclusive p anti-p --> W+jets cross section

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

2008-01-01

Roč. 666, č. 1 (2008), s. 23-30 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

Strength, elasticity and failure of composites with pyrolyzed matrices based on polymethylsiloxane resins with optimized ratio of D and T components

Czech Academy of Sciences Publication Activity Database

Černý, Martin; Strachota, Adam; Chlup, Zdeněk; Sucharda, Zbyněk; Žaloudková, Margit; Glogar, Petr; Kuběna, Ivo

2013-01-01

Roč. 47, č. 8 (2013), s. 1055-1066 ISSN 0021-9983 R&D Projects: GA ČR GA106/09/1101 Institutional support: RVO:67985891 ; RVO:61389013 ; RVO:68081723 Keywords : fibre-reinforced composite * fracture toughness * mechanical properties * pyrolyzed siloxane resin Subject RIV: JI - Composite Materials Impact factor: 1.257, year: 2013 http://jcm.sagepub.com/content/47/8/1055.full.pdf+html

Complexity of deciding detectability in discrete event systems

Czech Academy of Sciences Publication Activity Database

Masopust, Tomáš

2018-01-01

Roč. 93, July (2018), s. 257-261 ISSN 0005-1098 Institutional support: RVO:67985840 Keywords : discrete event systems * finite automata * detectability Subject RIV: BA - General Mathematics OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 5.451, year: 2016 https://www. science direct.com/ science /article/pii/S0005109818301730

Monopole-antimonopole interaction potential

Science.gov (United States)

Saurabh, Ayush; Vachaspati, Tanmay

2017-11-01

We numerically study the interactions of twisted monopole-antimonopole pairs in the 't Hooft-Polyakov model for a range of values of the scalar to vector mass ratio. We also recover the sphaleron solution at maximum twist discovered by Taubes [Commun. Math. Phys. 86, 257 (1982), 10.1007/BF01206014] and map out its energy and size as functions of parameters.

Search for stopped gluinos from p-anti-p collisions at s**(1/2) = 1.96 TeV

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav

2007-01-01

Roč. 99, č. 13 (2007), 131801/1-131801/7 ISSN 0031-9007 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : supersymmetry * gluino * neutralino * D0 * DZero Subject RIV: BF - Elementary Particle s and High Energy Physics Impact factor: 6.944, year: 2007

Swimming ability and physiological response to swimming fatigue in ...

African Journals Online (AJOL)

The swimming endurance of kuruma shrimp, Marsupenaeus japonicus (11.04 ± 2.43 g) at five swimming speeds (23.0, 26.7, 31.0, 34.6 and 38.6 cm s-1) was determined in a circulating flume at 25.7 ± 0.7°C. The plasma glucose and total protein, hepatopancreas and pleopods muscle glycogen concentrations were ...

Measurement of differential Z / gamma* + jet + X cross sections in p anti-p collisions at s**(1/2) =1.96 TeV

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

2008-01-01

Roč. 669, č. 5 (2008), s. 278-286 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : differential cross * D0 detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008

Search for long-lived particles decaying into electron or photon pairs with the D0 detector

Czech Academy of Sciences Publication Activity Database

Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš

2008-01-01

Roč. 101, č. 11 (2008), 111802/1-111802/6 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * supersymmetry * quark Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008

Five years of specialised early intervention versus two years of specialised early intervention followed by three years of standard treatment for patients with a first episode psychosis

DEFF Research Database (Denmark)

Albert, Nikolai; Melau, Marianne; Jensen, Heidi

2017-01-01

, alogia, and affective blunting). Secondary outcomes were remission of both negative and psychotic symptoms, psychotic symptoms, suicidal ideation, substance abuse, compliance with medical treatment, adherence with treatment, client satisfaction, days in hospital care, and labour market affiliation...... with specialised mental health services (90.4% v 55.6%, Psatisfaction (estimated mean difference 2.57 points (95% confidence interval 1.36 to 3.79), P

Alzheimer's Disease: Mechanism and Approach to Cell Therapy

Czech Academy of Sciences Publication Activity Database

Amemori, Takashi; Jendelová, Pavla; Růžička, Jiří; Machová-Urdzíková, Lucia; Syková, Eva

2015-01-01

Roč. 16, č. 11 (2015), s. 26417-26451 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GBP304/12/G069; GA ČR(CZ) GAP304/11/0184 Institutional support: RVO:68378041 Keywords : alzheimer’s disease * tau * amyloid-β * mesenchymal stem cell s * neural stem cell s Subject RIV: FH - Neurology Impact factor: 3.257, year: 2015

Draft Genome Sequences of Vibrio alginolyticus Strains V1 and V2, Opportunistic Marine Pathogens

DEFF Research Database (Denmark)

Castillo, Daniel; D'Alvise, Paul; Kalatzis, Panos G.

2015-01-01

We announce the draft genome sequences of Vibrio alginolyticus strains V1 and V2, isolated from juvenile Sparus aurata and Dentex dentex, respectively, during outbreaks of vibriosis. The genome sequences are 5,257,950 bp with a G+C content of 44.5% for V. alginolyticus V1 and 5,068,299 bp with a G...

The Impact of Oral Rehydration Therapy on Childhood Diarrhoeal ...

African Journals Online (AJOL)

Results: Eight hundred and ninety one patients presented in the DTU over the one-year period in 1993/94 compared to 109 patients over the same period in 1997/98. There was a significantly higher mean duration of diarrhoea before presentation in the 1993/94 group (58.3 ± 13 hours) compared to the 1997/98 group (25.7 ...

Design Structure Matrix (DSM) Methods and Applications for Naval Ship Design

Science.gov (United States)

2013-05-23

Fax: 817-257-7227 E-mail: t.browninufetcu.edu Web : www. t vsonbrown i ng. com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA...mail: t.browninu(ajtcii.edu Web : www.tvsonbrownina.com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA Assistant Director of...STAKEHOLDER COM ABORDAGEM DE SISTEMAS ADAPTATIVOS A COMPLEXIDADE John Findlay, Ph D. e Abby Straus, M. Div. IMPLEMENTANDO FLEXIBILIDADE

78 FR 36543 - Sunshine Act Meeting

Science.gov (United States)

2013-06-18

... Between Natural Gas and Electricity Markets. ELECTRIC E-1 ER13-93-000 Avista Corporation. ER13-94-000 ER13... Transmission System Operator, Inc. E-6 EL13-52-000 Western Electricity Coordinating Council. E-7 RM13-8-000...-001 Idaho Wind Partners 1, LLC. HYDRO H-1 P-2144-040 City of Seattle, Washington. H-2 P-2114-257...

40 CFR 419.43 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

... asphalt processes (A) 5 21. Hydrofining 3 Total lube processes (L) 3 8. Catalytic reforming 10 Total... 0.102 Asphalt 0.226 0.055 Lube 1.055 0.257 Reforming and alkylation 0.377 0.092 Total chromium: Crude 0.030 0.011 Cracking and coking 0.340 0.118 Asphalt 0.183 0.064 Lube 0.855 0.297 Reforming and...

Seasonal and inter-annual variability of soil CO2 efflux in a Norway spruce forest over an eight-year study

Czech Academy of Sciences Publication Activity Database

Acosta, Manuel; Dařenová, Eva; Krupková, Lenka; Pavelka, Marian

256-257 (2018), s. 93-103 ISSN 0168-1923 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EF16_013/0001609 Institutional support: RVO:86652079 Keywords : Automated chamber system * Day of the year * Picea abies * Soil carbon flux * Temperature Soil water content Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.887, year: 2016