Toward single-mode random lasing within a submicrometre-sized spherical ZnO particle film

International Nuclear Information System (INIS)

Niyuki, Ryo; Fujiwara, Hideki; Sasaki, Keiji; Ishikawa, Yoshie; Koshizaki, Naoto; Tsuji, Takeshi

2016-01-01

We had recently reported unique random laser action such as quasi-single-mode and low-threshold lasing from a submicrometre-sized spherical ZnO nanoparticle film with polymer particles as defects. The present study demonstrates a novel approach to realize single-mode random lasing by adjusting the sizes of the defect particles. From the dependence of random lasing properties on defect size, we find that the average number of lasing peaks can be modified by the defect size, while other lasing properties such as lasing wavelengths and thresholds remain unchanged. These results suggest that lasing wavelengths and thresholds are determined by the resonant properties of the surrounding scatterers, while the defect size stochastically determines the number of lasing peaks. Therefore, if we optimize the sizes of the defects and scatterers, we can intentionally induce single-mode lasing even in a random structure (Fujiwara et al 2013 Appl. Phys. Lett. 102 061110). (paper)

Lasing in ZnO and CdS nanowires

Energy Technology Data Exchange (ETDEWEB)

Thielmann, Andreas; Geburt, Sebastian; Kozlik, Michael; Kuehnel, Julian; Borschel, Christian; Ronning, Carsten [Institut fuer Festkoerperphysik, Friedrich-Schiller-Universitaet Jena, Max-Wien-Platz 1, 07743 Jena (Germany)

2011-07-01

The development of nanoscaled semiconductor lasers could be the key resolution to the still persistent size mismatch between integrated microelectronic devices and semiconductor optoelectronic devices. Semiconductor nanowires offer an elegant path to the development of nanoscaled lasers as their geometry with two planar end facets naturally combines a fiber-like waveguide with an optical resonator. The possible stimulation of the material's emission processes enables lasing of resonant optical modes. ZnO and CdS nanowires of different aspect ratios have been synthesized via the VLS mechanism and were characterized by SEM, EDX and ensemble PL measurements. Power dependent PL measurements on single nanowires excited with pulsed laser light at 355 nm have been performed between 10 K and room temperature and were set in correlation to the nanowires' respective morphology. Sharp emission lines which show characteristics of Fabry-Perot modes could be observed above a power threshold. The measured power dependencies reveal amplified stimulated emission and lasing at high excitation densities.

Plasmon-exciton-polariton lasing

NARCIS (Netherlands)

Ramezani, M.; Halpin, A.; Fernandez, A. I.; Feist, J.; Rodriguez, S. R. K.; Garcia-Vidal, F. J.; J. Gomez Rivas,

2017-01-01

Metallic nanostructures provide a toolkit for the generation of coherent light below the diffraction limit. Plasmonic-based lasing relies on the population inversion of emitters (such as organic fluorophores) along with feedback provided by plasmonic resonances. In this regime, known as weak

Near-ideal lasing with a uniform wiggler

Energy Technology Data Exchange (ETDEWEB)

Warren, R.W.; Sollid, J.E.; Feldman, D.W.; Stein, W.E.; Johnson, W.J.; Lumpkin, A.H.; Goldstein, J.C.

1988-01-01

Over the years the Los Alamos FEL team has reduced or eliminated many of the experimental problems that resulted in non-ideal lasing. The major problems were accelerator instabilities that cause noise and fluctuations in current, energy, and timing; wakefield effects in the wiggler and beamline that introduce fluctuations in the beam's energy; and mirror nonlinearities caused by free carriers produced in the mirror by the high light levels, which caused extra light losses and interfered with the diagnostics. Lasing is not thought to be ideal in that it lacks major disturbing effects and is limited only by emittance, energy spread, and peak current. In this paper we describe the features of lasing that we have observed over a range of optical power of 1000, from the onset of lasing, to the threshold of the sideband instability, to the organization of regular optical spikes, to the region of chaotic spikes. Cavity-length detuning is presented as an ideal technique, in most circumstances, to completely suppress sidebands. With detuning one can easily switch operating modes from that giving the highest efficiency (chaotic spiking) to that giving the narrowest spectral line (no sidebands). Alternative techniques for sideband suppression normally use some kind of wavelength selective device (e.g., a grating) inserted in the cavity. With detuning, there is no need for such a device, and, therefore, no conflict between the wavelength control exerted by this extra optical component and that exerted by the energy of the electron beam. Lasing, therefore, starts easily, a shift in wavelength, i.e., chirp, is easily accomplished, and the consequences of inadequate control of the electron beam energy are not severe. 35 refs., 16 figs.

Random lasing in human tissues

International Nuclear Information System (INIS)

Polson, Randal C.; Vardeny, Z. Valy

2004-01-01

A random collection of scatterers in a gain medium can produce coherent laser emission lines dubbed 'random lasing'. We show that biological tissues, including human tissues, can support coherent random lasing when infiltrated with a concentrated laser dye solution. To extract a typical random resonator size within the tissue we average the power Fourier transform of random laser spectra collected from many excitation locations in the tissue; we verified this procedure by a computer simulation. Surprisingly, we found that malignant tissues show many more laser lines compared to healthy tissues taken from the same organ. Consequently, the obtained typical random resonator was found to be different for healthy and cancerous tissues, and this may lead to a technique for separating malignant from healthy tissues for diagnostic imaging

Time-reversed lasing in the terahertz range and its preliminary study in sensor applications

Energy Technology Data Exchange (ETDEWEB)

Shen, Yun, E-mail: shenyunoptics@gmail.com [Department of Physics, Nanchang University, Nanchang 330031 (China); Liu, Huaqing [Department of Physics, Nanchang University, Nanchang 330031 (China); Deng, Xiaohua [Institute of Space Science and Technology, Nanchang University, Nanchang 330031 (China); Wang, Guoping [Key Laboratory of Artificial Micro- and Nano-Structures of Ministry of Education and School of Physics and Technology, Wuhan University, Wuhan 430072 (China)

2017-02-05

Time-reversed lasing in a uniform slab and a grating structure are investigated in the terahertz range. The results show that both the uniform slab and grating can support terahertz time-reversed lasing. Nevertheless, due to the tunable effective refractive index, the grating structure can not only exhibit time-reversed lasing more effectively and flexibly than a uniform slab, but also can realize significant absorption in a broader operating frequency range. Furthermore, applications of terahertz time-reversed lasing for novel concentration/thickness sensors are preliminarily studied in a single-channel coherent perfect absorber system. - Highlights: • Time-reversed lasing are investigated in the terahertz range. • The grating structure exhibit time-reversed lasing more effectively and flexibly than a uniform slab. • THz time-reversed lasing for novel concentration/thickness sensors are studied.

Increasing the lasing efficiency in cholesteric liquid-crystal photonic structures

Energy Technology Data Exchange (ETDEWEB)

Palto, S. P., E-mail: palto@online.ru; Shtykov, N M; Barnik, M I; Umanskii, B A [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

2010-03-15

Two types of lasing in cholesteric liquid crystals (LCs) in the range of luminescence of laser dye molecules have been investigated. The first type belongs to the Bragg modes at the photonic band edge, which propagate along the normal to the LC layer. The second type of lasing is related to the modes leaking into the substrate and propagating at small angles to the LC layer. It is shown that the Bragg lasing efficiency can be significantly increased under wide-aperture optical pumping. The method proposed for increasing the lasing efficiency is based on suppressing the excitation of leaky laser modes using partially absorbing thin films as the coatings for LC-orienting substrates. Both experimental results and the theoretical model of the effect using the numerical simulation data are discussed.

Laser-Induced Graphene by Multiple Lasing: Toward Electronics on Cloth, Paper, and Food.

Science.gov (United States)

Chyan, Yieu; Ye, Ruquan; Li, Yilun; Singh, Swatantra Pratap; Arnusch, Christopher J; Tour, James M

2018-03-27

A simple and facile method for obtaining patterned graphene under ambient conditions on the surface of diverse materials ranging from renewable precursors such as food, cloth, paper, and cardboard to high-performance polymers like Kevlar or even on natural coal would be highly desirable. Here, we report a method of using multiple pulsed-laser scribing to convert a wide range of substrates into laser-induced graphene (LIG). With the increased versatility of the multiple lase process, highly conductive patterns can be achieved on the surface of a diverse number of substrates in ambient atmosphere. The use of a defocus method results in multiple lases in a single pass of the laser, further simplifying the procedure. This method can be implemented without increasing processing times when compared with laser induction of graphene on polyimide (Kapton) substrates as previously reported. In fact, any carbon precursor that can be converted into amorphous carbon can be converted into graphene using this multiple lase method. This may be a generally applicable technique for forming graphene on diverse substrates in applications such as flexible or even biodegradable and edible electronics.

Lasing in dye-doped high-Q conical polymeric microcavities

DEFF Research Database (Denmark)

Grossmann, Tobias; Schleede, Simone; Hauser, Mario

2011-01-01

in the quasistationary pumping regime. Lasing wavelengths are detected in the visible wavelength region around 600 nm. Finite element simulations indicate that lasing occurs in fundamental TE/TM cavity modes, as these modes have - in comparison to higher order cavity modes - the smallest mode volume and the largest...

Investigation of the dye concentration influence on the lasing wavelength and threshold for a micro-fluidic dye laser

DEFF Research Database (Denmark)

Helbo, Bjarne; Kragh, Søren; Kjeldsen, B.G.

2003-01-01

We investigate a micro-fluidic dye laser, which can be integrated with polymer-based lab-on-a-chip microsystems without further processing steps. A simple rate-equation model is used to predict the lasing threshold. The laser device is characterised using the laser dye Rhodamine 6G dissolved...... in ethanol, and the influence of dye concentration on the lasing wavelength and threshold is investigated. The experiments confirm the predictions of the rate-equation model, that lasing can be achieved in the 10 mum long laser cavity with moderate concentrations of Rhodamine 6G in ethanol, starting from 5 x...

Standoff Detection of Trace Molecules by Remote High Gain Backward Lasing in Air

Science.gov (United States)

2016-09-17

vapor it is essential. Backward lasing from two simultaneously pumped, closely separated regions in the air provides a method for the reduction of pulse... inversion in an atomic species, leading to “cavityless” lasing. Lasing occurs from the population inversion that is created in the focal volume of...provide a reference that is capable of removing these pulse-to- pulse variations, a second, simultaneous backward lasing beam is generated using the same

Room-Temperature Exciton Lasing in Ultrathin Film of Coupled Nanocrystals

International Nuclear Information System (INIS)

Appavoo, Kannatassen; Xiaoze, Liu; Menon, Vinod; Sfeir, Matthew Y.

2015-01-01

We demonstrate exciton lasing in sub-wavelength coupled nanostructures at ultralow fluence threshold, as probed by femtosecond broadband emission and absorption spectroscopy. The complex spectrotemporal dynamics reveal for the first time an excitonic-to-electron-hole plasma lasing mechanism.

First operation of a harmonic lasing self-seeded free electron laser

International Nuclear Information System (INIS)

Schneidmiller, E.A.; Faatz, B.; Kuhlmann, M.; Roensch-Schulenburg, J.; Schreiber, S.; Tischer, M.; Yurkov, M.V.

2016-12-01

Harmonic lasing is a perspective mode of operation of X-ray FEL user facilities that allows to provide brilliant beams of higher energy photons for user experiments. Another useful application of harmonic lasing is so called Harmonic Lasing Self-Seeded Free Electron Laser (HLSS FEL) that allows to improve spectral brightness of these facilities. In the past, harmonic lasing has been demonstrated in the FEL oscillators in infrared and visible wavelength ranges, but not in high-gain FELs and not at short wavelengths. In this paper we report on the first evidence of the harmonic lasing and the first operation of the HLSS FEL at the soft X-ray FEL user facility FLASH in the wavelength range between 4.5 nm and 15 nm. Spectral brightness was improved in comparison with Self-Amplified Spontaneous emission (SASE) FEL by a factor of six in the exponential gain regime. A better performance of HLSS FEL with respect to SASE FEL in the post-saturation regime with a tapered undulator was observed as well. The first demonstration of harmonic lasing in a high-gain FEL and at short wavelengths paves the way for a variety of applications of this new operation mode in X-ray FELs.

Cancerous tissue mapping from random lasing emission spectra

International Nuclear Information System (INIS)

Polson, R C; Vardeny, Z V

2010-01-01

Random lasing emission spectra have been collected from both healthy and cancerous tissues. The two types of tissue with optical gain have different light scattering properties as obtained from an average power Fourier transform of their random lasing emission spectra. The difference in the power Fourier transform leads to a contrast between cancerous and benign tissues, which is utilized for tissue mapping of healthy and cancerous regions of patients

Miscellaneous Lasing Actions in Organo-Lead Halide Perovskite Films.

Science.gov (United States)

Duan, Zonghui; Wang, Shuai; Yi, Ningbo; Gu, Zhiyuan; Gao, Yisheng; Song, Qinghai; Xiao, Shumin

2017-06-21

Lasing actions in organo-lead halide perovskite films have been heavily studied in the past few years. However, due to the disordered nature of synthesized perovskite films, the lasing actions are usually understood as random lasers that are formed by multiple scattering. Herein, we demonstrate the miscellaneous lasing actions in organo-lead halide perovskite films. In addition to the random lasers, we show that a single or a few perovskite microparticles can generate laser emissions with their internal resonances instead of multiple scattering among them. We experimentally observed and numerically confirmed whispering gallery (WG)-like microlasers in polygon shaped and other deformed microparticles. Meanwhile, owing to the nature of total internal reflection and the novel shape of the nanoparticle, the size of the perovskite WG laser can be significantly decreased to a few hundred nanometers. Thus, wavelength-scale lead halide perovskite lasers were realized for the first time. All of these laser behaviors are complementary to typical random lasers in perovskite film and will help the understanding of lasing actions in complex lead halide perovskite systems.

Preventing Raman Lasing in High-Q WGM Resonators

Science.gov (United States)

Savchenkov, Anatoliy; Matsko, Andrey; Strekalov, Dmitry; Maleki, Lute

2007-01-01

A generic design has been conceived to suppress the Raman effect in whispering- gallery-mode (WGM) optical resonators that have high values of the resonance quality factor (Q). Although it is possible to exploit the Raman effect (even striving to maximize the Raman gain to obtain Raman lasing), the present innovation is intended to satisfy a need that arises in applications in which the Raman effect inhibits the realization of the full potential of WGM resonators as frequency-selection components. Heretofore, in such applications, it has been necessary to operate high-Q WGM resonators at unattractively low power levels to prevent Raman lasing. (The Raman-lasing thresholds of WGM optical resonators are very low and are approximately proportional to Q(sup -2)). Heretofore, two ways of preventing Raman lasting at high power levels have been known, but both entail significant disadvantages: A resonator can be designed so that the optical field is spread over a relatively large mode volume to bring the power density below the threshold. For any given combination of Q and power level, there is certain mode volume wherein Raman lasing does not start. Unfortunately, a resonator that has a large mode volume also has a high spectral density, which is undesirable in a typical photonic application. A resonator can be cooled to the temperature of liquid helium, where the Raman spectrum is narrower and, therefore, the Raman gain is lower. However, liquid-helium cooling is inconvenient. The present design overcomes these disadvantages, making it possible to operate a low-spectral-density (even a single-mode) WGM resonator at a relatively high power level at room temperature, without risk of Raman lasing.

Random lasing actions in self-assembled perovskite nanoparticles

Science.gov (United States)

Liu, Shuai; Sun, Wenzhao; Li, Jiankai; Gu, Zhiyuan; Wang, Kaiyang; Xiao, Shumin; Song, Qinghai

2016-05-01

Solution-based perovskite nanoparticles have been intensively studied in the past few years due to their applications in both photovoltaic and optoelectronic devices. Here, based on the common ground between solution-based perovskite and random lasers, we have studied the mirrorless lasing actions in self-assembled perovskite nanoparticles. After synthesis from a solution, discrete lasing peaks have been observed from optically pumped perovskites without any well-defined cavity boundaries. We have demonstrated that the origin of the random lasing emissions is the scattering between the nanostructures in the perovskite microplates. The obtained quality (Q) factors and thresholds of random lasers are around 500 and 60 μJ/cm2, respectively. Both values are comparable to the conventional perovskite microdisk lasers with polygon-shaped cavity boundaries. From the corresponding studies on laser spectra and fluorescence microscope images, the lasing actions are considered random lasers that are generated by strong multiple scattering in random gain media. In additional to conventional single-photon excitation, due to the strong nonlinear effects of perovskites, two-photon pumped random lasers have also been demonstrated for the first time. We believe this research will find its potential applications in low-cost coherent light sources and biomedical detection.

Lasing in robust cesium lead halide perovskite nanowires

Science.gov (United States)

Eaton, Samuel W.; Lai, Minliang; Gibson, Natalie A.; Wong, Andrew B.; Dou, Letian; Ma, Jie; Wang, Lin-Wang; Leone, Stephen R.; Yang, Peidong

2016-01-01

The rapidly growing field of nanoscale lasers can be advanced through the discovery of new, tunable light sources. The emission wavelength tunability demonstrated in perovskite materials is an attractive property for nanoscale lasers. Whereas organic–inorganic lead halide perovskite materials are known for their instability, cesium lead halides offer a robust alternative without sacrificing emission tunability or ease of synthesis. Here, we report the low-temperature, solution-phase growth of cesium lead halide nanowires exhibiting low-threshold lasing and high stability. The as-grown nanowires are single crystalline with well-formed facets, and act as high-quality laser cavities. The nanowires display excellent stability while stored and handled under ambient conditions over the course of weeks. Upon optical excitation, Fabry–Pérot lasing occurs in CsPbBr3 nanowires with an onset of 5 μJ cm−2 with the nanowire cavity displaying a maximum quality factor of 1,009 ± 5. Lasing under constant, pulsed excitation can be maintained for over 1 h, the equivalent of 109 excitation cycles, and lasing persists upon exposure to ambient atmosphere. Wavelength tunability in the green and blue regions of the spectrum in conjunction with excellent stability makes these nanowire lasers attractive for device fabrication. PMID:26862172

High beta lasing in micropillar cavities with adiabatic layer design

DEFF Research Database (Denmark)

Lermer, M.; Gregersen, Niels; Lorke, M.

2013-01-01

We report on lasing in optically pumped adiabatic micropillar cavities, based on the AlAs/GaAs material system. A detailed study of the threshold pump power and the spontaneous emission β factor in the lasing regime for different diameters dc is presented. We demonstrate a reduction of the thresh...... of the threshold pump power by over 2 orders of magnitude from dc = 2.25 μm down to 0.95 μm. Lasing with β factors exceeding 0.5 shows that adiabatic micropillars are operating deeply in the cavity quantum electrodynamics regime....

First lasing, capabilities, and flexibilities of FIREFLY

International Nuclear Information System (INIS)

Berryman, K.W.; Smith, T.I.

1995-01-01

FIREFLY is a free electron law that was designed to produce picosecond pulses of light in the range between 15 and 100 microns. It uses an inexpensive electromagnetic wiggler and variable outcoupling to provide maximum flexibility for user experiments. FIREFLY first lased on November 23, 1994, and has now operated from 15 to 65 microns. It has lased in both a traditional undulator configuration and as an optical klystron, and has also lased on the third harmonic between 9 and 11microns. We present measurements, of optical spectral width and pulse width at a range of wavelengths in both configurations. We also compare direct measurements of electron beam extraction, efficiency with observed optical power for fundamental, third harmonic, arid optical klystron operation. We discuss wavelength switching between adjacent peaks in the gain spectrum of an optical klystron, observed for the first time in FIREFLY. Finally, we focus on issues relevant to experimentation with FIREFLY, including continuously variable outcoupling, optical mode quality, and beam handling in the far-infrared

First lasing, capabilities, and flexibilities of FIREFLY

Energy Technology Data Exchange (ETDEWEB)

Berryman, K.W.; Smith, T.I. [Stanford Univ., CA (United States)

1995-12-31

FIREFLY is a free electron law that was designed to produce picosecond pulses of light in the range between 15 and 100 microns. It uses an inexpensive electromagnetic wiggler and variable outcoupling to provide maximum flexibility for user experiments. FIREFLY first lased on November 23, 1994, and has now operated from 15 to 65 microns. It has lased in both a traditional undulator configuration and as an optical klystron, and has also lased on the third harmonic between 9 and 11microns. We present measurements, of optical spectral width and pulse width at a range of wavelengths in both configurations. We also compare direct measurements of electron beam extraction, efficiency with observed optical power for fundamental, third harmonic, arid optical klystron operation. We discuss wavelength switching between adjacent peaks in the gain spectrum of an optical klystron, observed for the first time in FIREFLY. Finally, we focus on issues relevant to experimentation with FIREFLY, including continuously variable outcoupling, optical mode quality, and beam handling in the far-infrared.

Statistical parity-time-symmetric lasing in an optical fibre network.

Science.gov (United States)

Jahromi, Ali K; Hassan, Absar U; Christodoulides, Demetrios N; Abouraddy, Ayman F

2017-11-07

Parity-time (PT)-symmetry in optics is a condition whereby the real and imaginary parts of the refractive index across a photonic structure are deliberately balanced. This balance can lead to interesting optical phenomena, such as unidirectional invisibility, loss-induced lasing, single-mode lasing from multimode resonators, and non-reciprocal effects in conjunction with nonlinearities. Because PT-symmetry has been thought of as fragile, experimental realisations to date have been usually restricted to on-chip micro-devices. Here, we demonstrate that certain features of PT-symmetry are sufficiently robust to survive the statistical fluctuations associated with a macroscopic optical cavity. We examine the lasing dynamics in optical fibre-based coupled cavities more than a kilometre in length with balanced gain and loss. Although fluctuations can detune the cavity by more than the free spectral range, the behaviour of the lasing threshold and the laser power is that expected from a PT-stable system. Furthermore, we observe a statistical symmetry breaking upon varying the cavity loss.

Lasing attempts with a microwiggler on the Los Alamos FEL

International Nuclear Information System (INIS)

Warren, R.W.; O'Shea, P.G.; Bender, S.C.; Carlsten, B.E.; Early, J.W.; Feldman, D.W.; Fortgang, C.M.; Goldstein, J.C.; Schmitt, M.J.; Stein, W.E.; Wilke, M.D.; Zaugg, T.J.; Newnam, B.E.; Sheffield, R.L.

1992-01-01

The APEX FEL normally lases near a wavelength of 3μm using a permanent magnet wiggler with a 2.7-cm period and a linear accelerator of 40-MeV energy. Los Alamos National Laboratory is conducting a series of experiments with the goal of lasing at significantly shorter wavelengths with the same accelerator and the same kind of near-concentric resonator, but using a novel pulsed microwiggler of 0.5-cm period capable of generating a peak field of several tesla. We plan to lase on a fundamental wavelength of ∼0.8 μm and on the third harmonic at 0.25 μm

Lasing by driven atoms-cavity system in collective strong coupling regime.

Science.gov (United States)

Sawant, Rahul; Rangwala, S A

2017-09-12

The interaction of laser cooled atoms with resonant light is determined by the natural linewidth of the excited state. An optical cavity is another optically resonant system where the loss from the cavity determines the resonant optical response of the system. The near resonant combination of an optical Fabry-Pérot cavity with laser cooled and trapped atoms couples two distinct optical resonators via light and has great potential for precision measurements and the creation of versatile quantum optics systems. Here we show how driven magneto-optically trapped atoms in collective strong coupling regime with the cavity leads to lasing at a frequency red detuned from the atomic transition. Lasing is demonstrated experimentally by the observation of a lasing threshold accompanied by polarization and spatial mode purity, and line-narrowing in the outcoupled light. Spontaneous emission into the cavity mode by the driven atoms stimulates lasing action, which is capable of operating as a continuous wave laser in steady state, without a seed laser. The system is modeled theoretically, and qualitative agreement with experimentally observed lasing is seen. Our result opens up a range of new measurement possibilities with this system.

Investigation of the lasing of dyes under copper vapor laser irradiation

Energy Technology Data Exchange (ETDEWEB)

Danilova, V I; Kopylova, T N; Maier, G V; Masarnovskii, L V; Soldatov, A N; Sukhanov, V B

1980-10-01

The lasing characteristics of dyes pumped by copper vapor laser radiation are investigated in order to determine the optimal energetic parameters of the dye-laser system. Expressions are derived for the yields of stimulated emission from dye molecules, and it is shown that the most effective means of improving the lasing characteristics of rhodamine dye solutions is by the modification of intermolecular interactions, in part by the use of multicomponent solutions. Results are then presented of experimental measurements of the emission intensities of combinations of rhodamine dyes irradiated by the 5106-A line of a copper vapor laser. An increase in the lasing efficiency of the acceptor molecule is found for all the dye pairs investigated, with even greater emission intensities observed for multicomponent dye mixtures when the mixtures were pumped transversely. Under longitudinal pumping, improvements in lasing efficiency were obtained only for mixtures of rhodamine 6 Zh with cresil violet.

"lase vaid olla..." : [luuletused] / Stuart, pseud.

Index Scriptorium Estoniae

Stuart,, pseud.

2002-01-01

Autorist lk 134, ka foto. Sisu: "lase vaid olla..." ; "kas seistes on..." ; "hommikuvalguse kajas..." ; "ajal on augud..." ; "malemängu ja kohvi lõhn..." ; L' homme avec l'horloge ; "pargipingil istudes..." ; "yhel õhtul..."

Unique lasing mechanism of localized dispersive nanostructures in InAs/InGaAlAs quantum dash broad interband laser

KAUST Repository

Tan, C. L.

2010-02-11

The authors report on the nanowires-like and nanodots-like lasing behaviors in addition to multiple-wavelength interband transitions from InAs/InAlGaAs quantum dash (Qdash) lasers in the range of ~1550 nm. The presence of lasing actions simultaneously from two different dash ensembles, after postgrowth intermixing for crystalline quality improvement, indicate the absence of optical phonon emission due to the small variation in quantized interband transition energies. This effect is reproducible and shows different lasing characteristics from its quantum dot and quantum wire laser counterparts. Furthermore, the small energy spacing of only 25 nm (at center lasing wavelength of ~1550 nm) and the subsequent quenching of higher energy transition states at higher bias level in Qdash lasers suggest the absence of excited-state transition in highly inhomogeneous self-assembled Qdash structures. However, the appearance of a second lasing line in a certain range of high injection level, which is due to the presence of different sizes of dash assembles, corresponds to the transition from smaller size of Qdash ensembles in different planar active medium. This unique transition mechanism will affect the carrier dynamics, relaxation process in particular and further indicates localized finite carrier lifetime in all sizes of Qdash ensembles. These phenomena will lead to important consequences for the ground-state lasing efficiency and frequency modulation response of Qdash devices. In addition, these imply that proper manipulation of the Qdash ensembles will potentially result in localized nanolasers from individual ensemble and thus contributing towards enormously large envelope lasing coverage from semiconductor devices.

Surface-plasmon-enhanced lasing emission based on polymer distributed feedback laser

Energy Technology Data Exchange (ETDEWEB)

Zhang, Dingke, E-mail: dingke.zhang@gmail.com, E-mail: shijianchen@gmail.com [School of Physics and Electronic Engineering, Chongqing Normal University, Chongqing 401331 (China); Chen, Shijian, E-mail: dingke.zhang@gmail.com, E-mail: shijianchen@gmail.com; Huang, Yingzhou; Zhang, Zhen [School of Physics, Chongqing University, Chongqing 401331 (China); Wang, Yanping; Ma, Dongge [State Key Laboratory of Polymer Physics and Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

2015-01-14

Optical losses associated with the metallic contacts necessary for charge injection are an obstacle to the development of electrically pumped organic lasers. In this work, we show that it is possible to overcome these losses by introducing surface plasmons (SPs) in a distributed feedback laser to enhance the lasing emission. We perform a detailed study of the SPs influence on the lasing emission. We experimentally show that enhanced lasing emission has been successfully achieved in the presence of a metal electrode. The laser emission is strongly dependent on the thickness of Ag layer. By optimizing the thickness of Ag layer, surface-plasmon-enhanced lasing emission has been achieved with much reduced thresholds and higher intensity. When the thickness of the Ag layer increases to 50 nm, the device exhibits ten-fold emission intensity and a fifth of excitation threshold comparing with Ag-free one. The finite-difference time-domain (FDTD) results show that large field intensity is built at the 4-(dicyanomethylene)-2-i-propyl-6-(1,1,7,7-tetramethyljulolidyl-9-enyl) -4H-pyran:/poly(9-vinylcarbazole)Ag interface, which could lead to a strong coupling between lasing and SPs, and consequently a much enhanced laser emission at the photon energy of around 2.02 eV (615 nm). Our FDTD simulations gave an explanation of the effects of the SPs on lasing operation in the periodic structures. The use of SPs would lead to a new class of highly efficient solid-state laser sources and provide a new path to achieve electrically pumped organic lasers.

Enlargement of the inversionless lasing domain by using broad-area cavities

Energy Technology Data Exchange (ETDEWEB)

Mompart, J [Departament de Fisica, Universitat Autonoma de Barcelona, E-08193 Bellaterra (Spain); Torrent, M C [Departament de Fisica i Enginyeria Nuclear, Universitat Politecnica de Catalunya, Colom 11, E-08222 Terrassa (Spain); Ahufinger, V [Departament de Fisica, Universitat Autonoma de Barcelona, E-08193 Bellaterra (Spain); Garcia-Ojalvo, J [Departament de Fisica i Enginyeria Nuclear, Universitat Politecnica de Catalunya, Colom 11, E-08222 Terrassa (Spain); Corbalan, R [Departament de Fisica, Universitat Autonoma de Barcelona, E-08193 Bellaterra (Spain); Vilaseca, R [Departament de Fisica i Enginyeria Nuclear, Universitat Politecnica de Catalunya, Colom 11, E-08222 Terrassa (Spain)

2003-06-01

We investigate analytically and numerically the role of diffraction in the operation of a broad-area inversionless laser in a cascade three-level configuration. Through a linear stability analysis of the trivial non-lasing solution and numerical integration of the corresponding Maxwell-Schroedinger equations, we show that off-axis emission allows stationary inversionless lasing over a cavity detuning range much larger than in small-aspect-ratio cavities and in conventionally inverted three-level lasers. In addition, we investigate inversionless lasing in a self-pulsing regime in the presence of diffraction, which leads to rich spatiotemporal dynamics.

Study of parameters of simultaneous lasing on two lines sharing an upper level

International Nuclear Information System (INIS)

Pikulev, A A

2002-01-01

Stationary lasing at two competing lines sharing an upper level is studied. Based on the expressions for the gain obtained earlier, the possible lasing regimes are considered (at one or two lines) and approximate formulas are derived for determining the output power in each line. These formulas are shown to be the generalisation of the Rigrod formula to the case of simultaneous lasing at several lines. (control of laser radiation parameters)

Absorptive lasing mode suppression in ZnO nano- and microcavities

Energy Technology Data Exchange (ETDEWEB)

Wille, M.; Michalsky, T.; Krüger, E.; Grundmann, M.; Schmidt-Grund, R. [Universität Leipzig, Institut für Experimentelle Physik II, Linnéstraße 5, 04103 Leipzig (Germany)

2016-08-08

We conclusively explain the different lasing mode energies in ZnO nano- and microcavities observed by us and reported in literature. The limited penetration depth of usually used excitation lasers results in an inhomogeneous spatial gain region depending on the structure size and geometry. Hence, weakly or even nonexcited areas remain present after excitation, where modes are instantaneously suppressed by excitonic absorption. We compare the effects for ZnO microwires, nanowires, and tetrapod-like structures at room temperature and demonstrate that the corresponding mode selective effect is most pronounced for whispering-gallery modes in microwires with a hexagonal cross section. Furthermore, the absorptive lasing mode suppression will be demonstrated by correlating the spot size of the excitation laser and the lasing mode characteristic of a single ZnO nanowire.

Multi-state lasing in self-assembled ring-shaped green fluorescent protein microcavities

Energy Technology Data Exchange (ETDEWEB)

Dietrich, Christof P., E-mail: cpd3@st-andrews.ac.uk; Höfling, Sven; Gather, Malte C., E-mail: mcg6@st-andrews.ac.uk [SUPA, School of Physics and Astronomy, University of St Andrews, St Andrews KY16 9SS (United Kingdom)

2014-12-08

We demonstrate highly efficient lasing from multiple photonic states in microcavities filled with self-assembled rings of recombinant enhanced green fluorescent protein (eGFP) in its solid state form. The lasing regime is achieved at very low excitation energies of 13 nJ and occurs from cavity modes dispersed in both energy and momentum. We attribute the momentum distribution to very efficient scattering of incident light at the surface of the eGFP rings. The distribution of lasing states in energy is induced by the large spectral width of the gain spectrum of recombinant eGFP (FWHM ≅ 25 nm)

Mirrorless lasing from light emitters in percolating clusters

Science.gov (United States)

Burlak, Gennadiy; Rubo, Y. G.

2015-07-01

We describe the lasing effect in the three-dimensional percolation system, where the percolating cluster is filled by active media composed by light emitters excited noncoherently. We show that, due to the presence of a topologically nontrivial photonic structure, the stimulated emission is modified with respect to both conventional and random lasers. The time dynamics and spectra of the lasing output are studied numerically with finite-difference time-domain approach. The Fermat principle and Monte Carlo approach are applied to characterize the optimal optical path and interconnection between the radiating emitters. The spatial structure of the laser mode is found by a long-time FDTD simulation.

Two Photon Induced Lasing in 1550 nm Quantum Dash Optical Gain Media

DEFF Research Database (Denmark)

Capua, Amir; Saal, Abigael; Reithmaier, Johann Peter

2011-01-01

We report on a unique lasing mechanism observed in quantum dash Gain media. While the gain media is electrically pumped below lasing threshold, a strong optical pulse excites carriers by two photon absorption into high energy states of the quantum dashes and wetting layer. Fast inter band carrier...

Analytical approach to the multi-state lasing phenomenon in quantum dot lasers

Science.gov (United States)

Korenev, V. V.; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V.

2013-03-01

We introduce an analytical approach to describe the multi-state lasing phenomenon in quantum dot lasers. We show that the key parameter is the hole-to-electron capture rate ratio. If it is lower than a certain critical value, the complete quenching of ground-state lasing takes place at high injection levels. At higher values of the ratio, the model predicts saturation of the ground-state power. This explains the diversity of experimental results and their contradiction to the conventional rate equation model. Recently found enhancement of ground-state lasing in p-doped samples and temperature dependence of the ground-state power are also discussed.

Distinct Lasing Operation From Chirped InAs/InP Quantum-Dash Laser

KAUST Repository

Khan, Mohammed Zahed Mustafa

2013-08-01

We study the enhanced inhomogeneity across the InAs quantum-dash (Qdash) layers by incorporating a chirped AlGaInAs barrier thickness in the InAs/InP laser structure. The lasing operation is investigated via Fabry-Pérot ridge-waveguide laser characterization, which shows a peculiar behavior under quasi-continuous-wave (QCW) operation. Continuous energy transfer between different dash ensembles initiated quenching of lasing action among certain dash groups, causing a reduced intensity gap in the lasing spectra. We discuss these characteristics in terms of the quasi-zero-dimensional density of states (DOS) of dashes and the active region inhomogeneity. © 2009-2012 IEEE.

Linear and nonlinear optics, dynamics, and lasing in ZnO bulk and nanostructures

International Nuclear Information System (INIS)

Klingshirn, C.; Fallert, J.; Gogolin, O.; Wissinger, M.; Hauschild, R.; Hauser, M.; Kalt, H.; Zhou, H.

2008-01-01

In linear optics, we report on measurements of the absolute external quantum efficiency of bulk ZnO and powders using an integrating sphere. At low temperature the near band edge emission efficiency can reach 0.15 in the best samples. For deep center luminescence this value may be even higher. When going to room temperature (RT) the quantum efficiency drops by about one order of magnitude. From time resolved luminescence measurements we deduce the lifetime of the free and bound excitons to be in the sub ns regime and find for the latter a systematic increase with increasing binding energy. Concerning lasing, we discuss the role of excitonic processes and the recombination in an inverted electron-hole plasma (EHP). While excitonic processes seem well justified at lower temperatures and densities, doubts arise concerning the concept of excitonic lasing at RT in ZnO. The densities at laser threshold at RT are frequently close to the Mott density or above but below the density at which population inversion in an EHP is reached. We suggest alternative processes which can explain stimulated emission in this density regime in an EHP at RT

NAMMA LIDAR ATMOSPHERIC SENSING EXPERIMENT (LASE) V1

Data.gov (United States)

National Aeronautics and Space Administration — NASA's Lidar Atmospheric Sensing Experiment (LASE) system using the DIAL (Differential Absorption Lidar) system was operated during the NASA African Monsoon...

Broadband plasmonic silver nanoflowers for high-performance random lasing covering visible region

Directory of Open Access Journals (Sweden)

Chang Qing

2017-05-01

Full Text Available Multicolor random lasing has broad potential applications in the fields of imaging, sensing, and optoelectronics. Here, silver nanoflowers (Ag NF with abundant nanogaps are fabricated by a rapid one-step solution-phase synthesis method and are first proposed as effective broadband plasmonic scatterers to achieve different color random lasing. With abundant nanogaps and spiky tips near the surface and the interparticle coupling effect, Ag NFs greatly enhance the local electromagnetic field and induce broadband plasmonic scattering spectra over the whole visible range. The extremely low working threshold and the high-quality factor for Ag NF-based random lasers are thus demonstrated as 0.24 MW cm−2 and 11,851, respectively. Further, coherent colorful random lasing covering the visible range is realized using the dye molecules oxazine (red, Coumarin 440 (blue, and Coumarin 153 (green, showing high-quality factor of more than 10,000. All these features show that Ag NF are highly efficient scatterers for high-performance coherent random lasing and colorful random lasers.

Temperature and current coefficients of lasing wavelength in tunable diode laser spectroscopy.

Science.gov (United States)

Fukuda, M; Mishima, T; Nakayama, N; Masuda, T

2010-08-01

The factors determining temperature and current coefficients of lasing wavelength are investigated and discussed under monitoring CO(2)-gas absorption spectra. The diffusion rate of Joule heating at the active layer to the surrounding region is observed by monitoring the change in the junction voltage, which is a function of temperature and the wavelength (frequency) deviation under sinusoidal current modulation. Based on the experimental results, the time interval of monitoring the wavelength after changing the ambient temperature or injected current (scanning rate) has to be constant at least to eliminate the monitoring error induced by the deviation of lasing wavelength, though the temperature and current coefficients of lasing wavelength differ with the rate.

Continuous-wave lasing in an organic-inorganic lead halide perovskite semiconductor

Science.gov (United States)

Jia, Yufei; Kerner, Ross A.; Grede, Alex J.; Rand, Barry P.; Giebink, Noel C.

2017-12-01

Hybrid organic-inorganic perovskites have emerged as promising gain media for tunable, solution-processed semiconductor lasers. However, continuous-wave operation has not been achieved so far1-3. Here, we demonstrate that optically pumped continuous-wave lasing can be sustained above threshold excitation intensities of 17 kW cm-2 for over an hour in methylammonium lead iodide (MAPbI3) distributed feedback lasers that are maintained below the MAPbI3 tetragonal-to-orthorhombic phase transition temperature of T ≈ 160 K. In contrast with the lasing death phenomenon that occurs for pure tetragonal-phase MAPbI3 at T > 160 K (ref. 4), we find that continuous-wave gain becomes possible at T ≈ 100 K from tetragonal-phase inclusions that are photogenerated by the pump within the normally existing, larger-bandgap orthorhombic host matrix. In this mixed-phase system, the tetragonal inclusions function as carrier recombination sinks that reduce the transparency threshold, in loose analogy to inorganic semiconductor quantum wells, and may serve as a model for engineering improved perovskite gain media.

Temperature changes across porcelain during multiple exposure CO2 lasing

Science.gov (United States)

Barron, Joseph R.; Zakariasen, Kenneth L.; Peacocke, Larry

1990-06-01

Research indicates that laser energy may provide a useful method for glazing and fusing porcelain for intraoral prosthetic purposes. However, it is not known whether such lasing will result in the production of heat levels that may be damaging to adjacent vital tissues such as the dental pulp and periodontal tissues. This research is designed to measure the magnitude of temperature rise across porcelain observed during multiple exposure C02 lasing. Fifteen porcelain examples of 1000 jim (5), 1500 pm (5) and 2000 tm (5) x each received five C02 laser exposures on the same exposure site at 1.0 sec. intervals at 8.0 watts (0.2 sec. per exposure with a 1 mm focal spot). A YSI 144201 thermilinear precision thermistor was placed on the porcelain surface opposite each laser exposure site. Temperature rise above ambient was recorded by an HP3421A data acquisition unit and HP9816 technical microcomputer. Recording continued for sufficient time to allow temperatures to return to ambient. The mean temperature elevations ranged from a low of 2.97 0C (2000 pm) to a high of 7.77 °C (1000 μm). ANOVA and Duncan's Multiple Range Test indicated significant differences in temperature rise by porcelain thickness. It would appear from the results of this research that temperature elevations adjacent to lased porcelain may be sufficiently controllable that safe intraoral porcelain lasing will be possible.

Temperature changes across CO2-lased dentin during multiple exposures

Science.gov (United States)

Zakariasen, Kenneth L.; Barron, Joseph R.; Boran, Thomas L.

1990-06-01

The literature increasingly indicates that lasers will have a multitude of applications for dental hard tissue procedures, e.g. preventive therapy, caries removal, laser etching and endodontic therapy. However, it is critical that such laser therapies avoid the production of heat levels which will be damaging to the surrounding vital tissues, such as the dental pulp and periodontal tissues. Our preliminary research on temperature changes across C02 lased dentin indicated that for single preventive therapeutic exposures (1.2 W., 0. 1 sec., 1.0 mm focal spot) the mean temperature rise across 350 j.tm of dentin was 0.57 0C while across 1000 .tm of dentin the mean rise was only 0.18 °C. Further research utilizing multiple preventive therapeutic exposures (1.2 W., 0. 1 sec., 1.0 mm focal spot, 3 x 1.0 sec. intervals) showed mean temperature elevations of 1.56 0C across 350 m of dentin and 0.66 O across 1000 xm of dentin. While these temperature elevations, which would be associated with preventive therapy, are very low and would be biologically acceptable, it must be noted that exposures of higher intensities are required to fuse enamel and porcelain, or remove decay. This current research investigates temperature elevations which occuT during C02 lasing utilizing the following exposure parameters: 8.0 W., 1.0 mm focal spot, 0.1 sec. exposures, 2 or 4 exposures per site pulsed 1.0 sec. apart. Three dentin thicknesses were utilized, i.e. 1000 jim, 1500 p.tm and 2000 .tm. Four sections of each thickness were utilized with four exposure sites per specimen (2 with 2 exposures, 2 with 4 exposures). All dentin sections were prepared from non-carious third molars using a hard tissue microtome. A thermistor was placed on the dentin surface opposite each lased site and temperature changes were recorded for approximately 50 sec. following lasing. Mean temperature elevations ranged from a high of 3.07 C for the 1000 xm section utilizing four exposures to a low of 0.37 0C for the

Influence of vertical coupling on the lasing operation of quantum-dash laser

KAUST Repository

Khan, Mohammed Zahed Mustafa

2012-01-01

The authors numerically investigated the consequence of vertical coupling among multi-stack InAs quantum dash (Qdash) laser structure on the lasing bandwidth. The developed model is based on multi-population carrier-photon rate equation and incorporates inhomogeneous broadening due to dash size or composition fluctuation, homogeneous broadening of optical gain, and the multi-longitudinal photon modes. In addition, the effect of Qdash layers emitting at different wavelength, and the carrier coupling (tunneling) between adjacent stacks, are also accounted for. The results predict a direct relation between the lasing bandwidth and the barrier thickness and hence enhanced lasing bandwidth could be achieved by decoupling the Qdash layers (large barrier thickness). Moreover, the model further affirms the non-equilibrium distribution of carriers among Qdash layers in a multi-stack laser structure.

AquaLase versus NeoSoniX--a comparison study.

Science.gov (United States)

Jiraskova, Nada; Rozsival, Pavel; Kadlecova, Jana; Nekolova, Jana; Pozlerova, Jana; Dubravska, Zlatica

2007-12-01

To compare the metrics and surgical outcome when using Infiniti AquaLase and NeoSoniX cataract removal modalities. This prospective clinical study involved 50 patients with bilateral cataracts and lens removal using AquaLase in the right eye and NeoSoniX in the left eye. Best corrected visual acuity (BCVA), endothelial cell density and pachymetry were evaluted pre- and postoperatively. Statistical analysis was performed using the Wilcoxon Signed- Rank Test. Preoperative mean pachymetry was 569 +/- 31 mu in the right eye (RE) and 560 +/- 37 mu in the left eye (LE), mean endothelial cell density 2744 +/- 418 cells/mm(2) (RE) and 2730 +/- 472 cells/mm(2) (LE). One week after operation pachymetry was 576 +/- 52 mu (RE) and 583 +/- 72 mu (LE) and endothelial cell density 2388 +/- 586 cells/mm(2) (RE) and 2463 +/- 615 cells/mm(2) (LE). One month after surgery pachymetry was 556 +/- 43 mu (RE) and 559 +/- 44 mu (LE) and endothelial cell density 2368 +/- 52 cells/mm(2) (RE) and 2495 +/- 548 cells/mm(2) (LE). BCVA improved in all eyes and was 0.8 or better on the first postoperative day. Both the NeosoniX and AquaLase minimize intraoperative damage to ocular structures.

Sustained lasing of HHG-seeded FEL by using EOS-based timing control

International Nuclear Information System (INIS)

Watanabe, Takahiro; Okayasu, Yuichi; Togashi, Tadashi; Hara, Toru; Tomizawa, Hiromitsu; Matsubara, Shinichi; Aoyama, Makoto; Yamakawa, Koichi; Iwasaki, Atsushi; Ohwada, Shigeki; Sato, Takahiro; Yamauchi, Kaoru; Otake, Yuji; Ohshima, Takashi; Ogawa, Kanade; Togawa, Kazuaki; Tanaka, Takashi; Takahashi, Eiji; Midorikawa, Katsumi; Yabashi, Makina; Tanaka, Hitoshi; Ishikawa, Tetsuya

2013-01-01

High-harmonic-generation (HHG) based seeded FEL experiments were demonstrated at SCSS, SPring-8. Seeded FEL has advantageous features against SASE such that there is no intrinsic nature of shot-noise fluctuation and output FEL pulses are in principle fully coherent in both transverse and longitudinal axes. In practical user experiments, however, an overlap between electron bunches and seed laser pulses in six-dimensional phase space needs to be precisely maintained for securing the stable lasing. Otherwise, the overlap could be quickly lost and the lasing is no more sustained. For the stable lasing, we have developed an EO (electro-optic) based timing control system, which enables to observe a timing drift between electron bunches and laser pulses, and compensate for it. Experimental results of the seeded FEL with and without the EO timing control are compared, and the effectiveness of the timing system is discussed. (author)

Optimum electron temperature and density for short-wavelength plasma-lasing from nickel-like ions

International Nuclear Information System (INIS)

Masoudnia, Leili; Bleiner, Davide

2014-01-01

Soft X-ray lasing across a Ni-like plasma gain-medium requires optimum electron temperature and density for attaining to the Ni-like ion stage and for population inversion in the 3d 9 4d 1 (J=0)→3d 9 4p 1 (J=1) laser transition. Various scaling laws, function of operating parameters, were compared with respect to their predictions for optimum temperatures and densities. It is shown that the widely adopted local thermodynamic equilibrium (LTE) model underestimates the optimum plasma-lasing conditions. On the other hand, non-LTE models, especially when complemented with dielectronic recombination, provided accurate prediction of the optimum plasma-lasing conditions. It is further shown that, for targets with Z equal or greater than the rare-earth elements (e.g. Sm), the optimum electron density for plasma-lasing is not accessible for pump-pulses at λ=1ω=1μm. This observation explains a fundamental difficulty in saturating the wavelength of plasma-based X-ray lasers below 6.8 nm, unless using 2ω pumping

Modeling the lasing spectra of InAs/InP Quantum dash lasers

KAUST Repository

Khan, Mohammed Zahed Mustafa; Bhattacharya, Pallab K.; Ng, Tien Khee; Ooi, Boon S.; Schwingenschlö gl, Udo

2011-01-01

We report a theoretical model for InAs/InP quantum-dash (Qdash) lasers incorporating a coupled set of rate equations taking into account the inhomogeneous broadening due to Qdash size fluctuation, the homogeneous broadening due to optical gain of a single Qdash, and the longitudinal cavity modes. The role of cavity length on the Qdash lasing characteristics, particularly the redshift in the peak lasing wavelength, is analyzed and compared with the experimental results by attributing it to the active region inhomogeneity.

Modeling the lasing spectra of InAs/InP Quantum dash lasers

KAUST Repository

Khan, Mohammed Zahed Mustafa

2011-03-09

We report a theoretical model for InAs/InP quantum-dash (Qdash) lasers incorporating a coupled set of rate equations taking into account the inhomogeneous broadening due to Qdash size fluctuation, the homogeneous broadening due to optical gain of a single Qdash, and the longitudinal cavity modes. The role of cavity length on the Qdash lasing characteristics, particularly the redshift in the peak lasing wavelength, is analyzed and compared with the experimental results by attributing it to the active region inhomogeneity.

Influence of Coulomb screening on lateral lasing in VECSELs.

Science.gov (United States)

Wang, Chengao; Malloy, Kevin; Sheik-Bahae, Mansoor

2015-12-14

Parasitic lateral lasing in certain optically pumped semiconductor disc lasers drains the gain of the vertical mode and thus causes power scaling degradation and premature rollover in surface emitting operation. We have observed this effect in both multiple quantum wells (MQW) (GaInAs/GaAs) and double heterostructures (DHS) (GaInP/GaAs/GaInP) under pulsed excitation even when the gain chip lateral dimensions are much larger than the diameter of the pump laser. Lateral lasing occurs persistently between cleaved facets at a band-tail wavelength much longer than the peak of the gain. We show that the effect of bandgap renormalization due to Coulomb screening explains this phenomena. Exploiting the simple analytical plasma theory of bulk semiconductors (Banyai & Koch, 1986), we can account for such an effect in double heterostructures.

Lasing conditions in recombining helium plasmas

International Nuclear Information System (INIS)

Furukane, Utaro; Oda, Toshiatsu

1985-01-01

Lasing conditions for He have been evaluated numerically. We have used a collisional radiative model to calculate overpopulation densities Δnsub(ij), which are defined as differences between population densities per unit statistical weight of the upper and lower excited levels i and j, respectively. Laser oscillations for the level pairs 2 1 P-3 1 S, 2 1 P-4 1 S, 2 1 P-3 1 D, 2 1 P-4 1 D, 3 1 D-4 1 F, 3 1 P-4 1 S, 3 1 P-4 1 D and 3 3 P-4 3 S are possible when the electron densities are within well defined limits at low electron temperature (Tsub(e) = 0.1 eV). For level pairs of the singlet state the inversion mechanism for He is the same as for H. Only collisional processes produce population inversion in the triplet level pair 3 3 P-4 3 S. (author)

One-year outcomes of AquaLase cataract surgery.

Science.gov (United States)

Yoo, Sonia H; Bhatt, Anand B

2007-01-01

The authors report surgical experience and clinical outcomes up to 1 year postoperatively in patients who underwent cataract surgery with the AquaLase liquefaction device (Alcon Laboratories, Fort Worth, TX). The device is a handpiece option for use with Alcon's Infiniti Vision System that uses heated balanced saline solution micropulses to liquefy lenticular material. Twenty-seven eyes of 23 patients underwent cataract extraction with the use of the AquaLase liquefaction device. The average age of participants was 68 years, and the average nuclear sclerotic grade was 1.96 on a 4-point scale. Outcomes were judged by metrics such as visual acuity, inflammation, endothelial cell count, and postoperative posterior capsule opacification. At 30 days postoperatively, 78% of eyes had a best-corrected visual acuity of 20/20. Visual acuity was 20/25 or better 1 year postoperatively in 88% of patients without complications except conversion to ultrasound phacoemulsification for two dense cataracts.

The influence of p-doping on two-state lasing in InAs/InGaAs quantum dot lasers

Science.gov (United States)

Maximov, M. V.; Shernyakov, Yu M.; Zubov, F. I.; Zhukov, A. E.; Gordeev, N. Yu; Korenev, V. V.; Savelyev, A. V.; Livshits, D. A.

2013-10-01

Two-state lasing in devices based on undoped and p-type modulation-doped InAs/InGaAs quantum dots is studied for various cavity lengths and temperatures. Modulation doping of the active region strongly enhances the threshold current of two-state lasing, preserves ground-state lasing up to higher temperatures and increases ground-state output power. The impact of modulation doping is especially strong in short cavities.

The influence of p-doping on two-state lasing in InAs/InGaAs quantum dot lasers

International Nuclear Information System (INIS)

Maximov, M V; Shernyakov, Yu M; Zhukov, A E; Gordeev, N Yu; Zubov, F I; Korenev, V V; Savelyev, A V; Livshits, D A

2013-01-01

Two-state lasing in devices based on undoped and p-type modulation-doped InAs/InGaAs quantum dots is studied for various cavity lengths and temperatures. Modulation doping of the active region strongly enhances the threshold current of two-state lasing, preserves ground-state lasing up to higher temperatures and increases ground-state output power. The impact of modulation doping is especially strong in short cavities. (paper)

The influence of carrier dynamics on double-state lasing in quantum dot lasers at variable temperature

Science.gov (United States)

Korenev, V. V.; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V.

2014-12-01

It is shown in analytical form that the carrier capture from the matrix as well as carrier dynamics in quantum dots plays an important role in double-state lasing phenomenon. In particular, the de-synchronization of hole and electron captures allows one to describe recently observed quenching of ground-state lasing, which takes place in quantum dot lasers operating in double-state lasing regime at high injection. From the other side, the detailed analysis of charge carrier dynamics in the single quantum dot enables one to describe the observed light-current characteristics and key temperature dependences.

The influence of carrier dynamics on double-state lasing in quantum dot lasers at variable temperature

International Nuclear Information System (INIS)

Korenev, V V; Savelyev, A V; Zhukov, A E; Omelchenko, A V; Maximov, M V

2014-01-01

It is shown in analytical form that the carrier capture from the matrix as well as carrier dynamics in quantum dots plays an important role in double-state lasing phenomenon. In particular, the de-synchronization of hole and electron captures allows one to describe recently observed quenching of ground-state lasing, which takes place in quantum dot lasers operating in double-state lasing regime at high injection. From the other side, the detailed analysis of charge carrier dynamics in the single quantum dot enables one to describe the observed light-current characteristics and key temperature dependences

Photoluminescence and lasing properties of ZnO nanorods

International Nuclear Information System (INIS)

Lee, Geon Joon; Lee, Young Pak; Min, Sun Ki; Han, Sung Hwan; Lim, Hwan Hong; Cha, Myoung Sik; Kim, Sung Soo; Cheong, Hyeon Sik

2010-01-01

In this study, we investigated the structures, photoluminescence (PL), and lasing characteristics of the ZnO nanorods prepared by using chemical bath deposition. The continuous-wave HeCd laser excited PL spectra of the ZnO nanorods exhibited two emission bands, one in the UV region and the other in the visible region. The UV emission band has its peak at 3.25 eV with a bandwidth of 160 meV. However, the PL spectra under 355-nm, 35-ps pulse excitation exhibited a spectrally-narrowed UV emission band with a peak at 3.20 eV and a spectral width of 35 meV. The lasing phenomena were ascribed to the amplified spontaneous emission (ASE) caused by coupling of the microcavity effect of ZnO nanorods and the high-intensity excitation. Above the lasing threshold, the ASE peak intensity exhibited a superlinear dependence on the excitation intensity. For an excitation pulse energy of 3 mJ, the ASE peak intensity was increased by enlarging the length of the ZnO nanorods from 1 μm to 4 μm. In addition, the PL spectrum under 800-nm femtosecond pulse excitation exhibited second harmonic generation, as well as the multiphoton absorption-induced UV emission band. In this research, ZnO nanorods were grown on seed layers by using chemical bath deposition in an aqueous solution of Zn(NO 3 ) 2 and hexamethyltetramine. The seed layers were prepared on conducting glass substrates by dip coating in an aqueous colloidal dispersion containing 50% 70-nm ZnO nanoparticles. Scanning electron microscopy clearly revealed that ZnO nanorods were successfully grown on the seed layers.

Lasing of a Solid-State Active Element Based on Anodized Aluminum Oxide Film Doped with Rhodamine 6G

Science.gov (United States)

Shelkovnikov, V. V.; Lyubas, G. A.; Korotaev, S. V.; Kopylova, T. N.; Tel'minov, E. N.; Gadirov, R. M.; Nikonova, E. N.; Nikonov, S. Yu.; Solodova, T. A.; Novikov, V. A.

2017-04-01

Spectral-luminescent and lasing characteristics of rhodamine 6G in porous aluminum oxide films anodized under various conditions are investigated. Lasing is obtained without external resonator in the longitudinal scheme under excitation by the second harmonic of Nd3+:YAG-laser radiation. The threshold pump power densities are in the range 3.5-15 MW/cm2 depending on the anodizing conditions. Wherein, the lasing line narrows down from 12 to 5 nm.

Fresh Slice Self-Seeding and Fresh Slice Harmonic Lasing at LCLS

Energy Technology Data Exchange (ETDEWEB)

Amann, J.W. [SLAC National Accelerator Lab., Menlo Park, CA (United States)

2018-04-01

We present results from the successful demonstration of fresh slice self-seeding at the Linac Coherent Light Source (LCLS).* The performance is compared with SASE and regular self-seeding at photon energy of 5.5 keV, resulting in a relative average brightness increase of a factor of 12 and a factor of 2 respectively. Following this proof-of-principle we discuss the forthcoming plans to use the same technique** for fresh slice harmonic lasing in an upcoming experiment. The demonstration of fresh slice harmonic lasing provides an attractive solution for future XFELs aiming to achieve high efficiency, high brightness X-ray pulses at high photon energies (>12 keV).***

A possible upgrade of FLASH for harmonic lasing down to 1.3 nm

International Nuclear Information System (INIS)

Schneidmiller, E.A.; Yurkov, M.V.

2012-10-01

We propose the 3rd harmonic lasing in a new FLASH undulator as a way to produce intense, narrow-band, and stable SASE radiation down to 1.3 nm with the present accelerator energy of 1.25 GeV. To provide optimal conditions for harmonic lasing, we suggest to suppress the fundamental with the help of a special set of phase shifters. We rely on the standard technology of gap-tunable planar hybrid undulators, and choose the period of 2.3 cm and the minimum gap of 0.9 cm; total length of the undulator system is 34.5 m. With the help of numerical simulations we demonstrate that the 3rd harmonic lasing at 1.3 nm provides peak power at a gigawatt level and the narrow intrinsic bandwidth, 0.1% (FWHM). Pulse duration can be controlled in the range of a few tens of femtoseconds, and the peak brilliance reaches the value of 10 31 photons/(s mrad 2 mm 2 0.1% BW). With the given undulator design, a standard option of lasing at the fundamental wavelength to saturation is possible through the entire water window and at longer wavelengths. In this paper we briefly consider additional options such as polarization control, bandwidth reduction, self-seeding, X-ray pulse compression, and two-color operation. We also discuss possible technical issues and backup solutions.

A possible upgrade of FLASH for harmonic lasing down to 1.3 nm

Energy Technology Data Exchange (ETDEWEB)

Schneidmiller, E.A.; Yurkov, M.V.

2012-10-15

We propose the 3rd harmonic lasing in a new FLASH undulator as a way to produce intense, narrow-band, and stable SASE radiation down to 1.3 nm with the present accelerator energy of 1.25 GeV. To provide optimal conditions for harmonic lasing, we suggest to suppress the fundamental with the help of a special set of phase shifters. We rely on the standard technology of gap-tunable planar hybrid undulators, and choose the period of 2.3 cm and the minimum gap of 0.9 cm; total length of the undulator system is 34.5 m. With the help of numerical simulations we demonstrate that the 3rd harmonic lasing at 1.3 nm provides peak power at a gigawatt level and the narrow intrinsic bandwidth, 0.1% (FWHM). Pulse duration can be controlled in the range of a few tens of femtoseconds, and the peak brilliance reaches the value of 10{sup 31} photons/(s mrad{sup 2} mm{sup 2} 0.1% BW). With the given undulator design, a standard option of lasing at the fundamental wavelength to saturation is possible through the entire water window and at longer wavelengths. In this paper we briefly consider additional options such as polarization control, bandwidth reduction, self-seeding, X-ray pulse compression, and two-color operation. We also discuss possible technical issues and backup solutions.

Lasing cavities and ultra-fast switch based on self-collimation of photonic crystal

International Nuclear Information System (INIS)

Zhao Deyin; Zhou Chuanhong; Gong Qian; Jiang Xunya

2008-01-01

The lasing cavities and ultra-fast switch based on the self-collimation (SC) of photonic crystal have been studied in this work. Some special properties of these devices are demonstrated, such as the higher quality factors and concise integration of the lasing cavities, the tolerance of the non-parallel reflectors in Fabry-Perot cavities. With nonlinearity, the ultra-fast switch can also be realized around the SC frequency. All these functional devices are designed based on the strong beam confinement of SC

Lasing cavities and ultra-fast switch based on self-collimation of photonic crystal

Energy Technology Data Exchange (ETDEWEB)

Zhao Deyin; Zhou Chuanhong; Gong Qian; Jiang Xunya [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China)], E-mail: xyjiang@mit.edu

2008-06-07

The lasing cavities and ultra-fast switch based on the self-collimation (SC) of photonic crystal have been studied in this work. Some special properties of these devices are demonstrated, such as the higher quality factors and concise integration of the lasing cavities, the tolerance of the non-parallel reflectors in Fabry-Perot cavities. With nonlinearity, the ultra-fast switch can also be realized around the SC frequency. All these functional devices are designed based on the strong beam confinement of SC.

LASE measurements of water vapor and aerosol profiles during the Plains Elevated Convection at Night (PECAN) field experiment

Science.gov (United States)

Nehrir, A. R.; Ferrare, R. A.; Kooi, S. A.; Butler, C. F.; Notari, A.; Hair, J. W.; Collins, J. E., Jr.; Ismail, S.

2015-12-01

The Lidar Atmospheric Sensing Experiment (LASE) system was deployed on the NASA DC-8 aircraft during the Plains Elevated Convection At Night (PECAN) field experiment, which was conducted during June-July 2015 over the central and southern plains. LASE is an active remote sensor that employs the differential absorption lidar (DIAL) technique to measure range resolved profiles of water vapor and aerosols above and below the aircraft. The DC-8 conducted nine local science flights from June 30- July 14 where LASE sampled water vapor and aerosol fields in support of the PECAN primary science objectives relating to better understanding nocturnal Mesoscale Convective Systems (MCSs), Convective Initiation (CI), the Low Level Jet (LLJ), bores, and to compare different airborne and ground based measurements. LASE observed large spatial and temporal variability in water vapor and aerosol distributions in advance of nocturnal MCSs, across bores resulting from MCS outflow boundaries, and across the LLJ associated with the development of MCSs and CI. An overview of the LASE data collected during the PECAN field experiment will be presented where emphasis will be placed on variability of water vapor profiles in the vicinity of severe storms and intense convection in the central and southern plains. Preliminary comparisons show good agreement between coincident LASE and radiosonde water vapor profiles. In addition, an advanced water vapor DIAL system being developed at NASA Langley will be discussed.

Numerically investigating the cause of broadband lasing from InAs/InP quantum-dash laser

KAUST Repository

Khan, Mohammed Zahed Mustafa

2013-01-01

The authors numerically investigated the origin of broadband lasing from multi-stack InAs/InP quantum dash (Qdash) laser. For this a model based on multi-population carrier-photon rate equation is developed which treats each Qdash stacking layer separately. In addition, the coupling between the adjacent stacks is also accounted in the model apart from the inhomogeneous broadening due to dash size or composition fluctuation. Simulation results show that the effect of Qdash inhomogeneity on a single plane (in-plane or localized inhomogeneity) is negligible in broadening the lasing spectra compared to the inhomogeneity across the stacks that are emitting at different wavelength. Our results would help in further optimizing the wafer structure design and improve the lasing bandwidth.

Assembling a Lasing Hybrid Material With Supramolecular Polymers and Nanocrystals

National Research Council Canada - National Science Library

Li, Leiming

2003-01-01

.... In the system containing ZnO nanocrystals as the inorganic component, both phases are oriented in the hybrid material forming an ultraviolet lasing medium with a lower threshold relative to pure ZnO nanocrystals.

Holmium-doped fluorotellurite microstructured fibers for 2.1 μm lasing.

Science.gov (United States)

Yao, Chuanfei; He, Chunfeng; Jia, Zhixu; Wang, Shunbin; Qin, Guanshi; Ohishi, Yasutake; Qin, Weiping

2015-10-15

Holmium (Ho3+)-doped fluorotellurite microstructured fibers based on TeO2-BaF2-Y2O3 glasses are fabricated by using a rod-in-tube method. By using a 1.992 μm fiber laser as the pump source, lasing at 2.077 μm is obtained from a 27 cm long Ho3+-doped fluorotellurite microstructured fiber. The maximum unsaturated power is about 161 mW and the corresponding slope efficiency is up to 67.4%. The influence of fiber length on lasing at 2.1 μm is also investigated. Our results show that Ho3+-doped fluorotellurite microstructured fibers are promising gain media for 2.1 μm laser applications.

Shear Bond Strength of Composite to Nd-YAG Lased Dentin with and without Dye

Directory of Open Access Journals (Sweden)

H. Kermanshah

2004-06-01

Full Text Available Statement of Problem: The achievement of a good and durable dentin/composite resin bond is an important task in restorative dentistry. The application of acid conditioners and dentin bonding agents is an accepted method to enhance this bond strength. Pretreating of dentin surface by laser irradiation seems to be a supplemental way to obtain better results,since lased dentin is more roughened and has a widest surface area to interact with acidconditioner.Purpose: In this study, the effect of dentin surface pretreating by Nd-YAG laser on dentin/composite shear bond strength was examined. Moreover, the effect of Chinese ink as a surface energy absorber on this value was investigated.Methods and Materials: Thirty-nine freshly extracted human teeth without dentinal caries were collected and their occlusal dentins were exposed using a diamond disk. The collected samples were divided into three identical groups. The dentin surface of the first group was lased by an Nd-YAG pulsed laser (100 mJ, 20 Hz through a 320 mm fiber optic in a swiping movement. In the second group, 10% solution of Chinese ink was applied on the dentinal surface before lasing. The samples of the third group were not lased at all. Thedentinal surface prepared by 35% phosphoric acid and Scotchbond MP primer and adhesive. Then, composite resin was cured on dentinal surface. After incubation, in water at 37°C for 24 hours, the samples were tested by Digital Tritest ELE machine.Results: The values of bond strength were 20.83±3.96 MPa, 17.83±3.63 MPa and 19.38±4.88 MPa for the lased, unlased and dye-enhanced groups, respectively. The results were not significant by ANOVA test (a=0.05. Although in the Weiboul modulus, the lased group offered better bond strength.Conclusion: Further studies are required to determine whether chemical as well as physical alterations to the dentin surface are induced by laser etching, and whether these influence the performance of the range of dentin

Instability of stationary lasing and self-starting mode locking in external-cavity semiconductor lasers

International Nuclear Information System (INIS)

Smetanin, Igor V; Vasil'ev, Petr P

2009-01-01

Parameters of external-cavity semiconductor lasers, when the stationary lasing becomes unstable, were analysed within the framework of a theoretical model of self-starting mode locking. In this case, a train of ultrashort pulses can be generated due to intrinsic nonlinearities of the laser medium. A decisive role of the transverse optical field nonuniformity, pump rate, and gain spectral bandwidth in the development of the instability of stationary lasing was demonstrated. (control of laser radiation parameters)

Competitive excitation and osmotic-pressure-mediated control of lasing modes in cholesteric liquid crystal microshells

Science.gov (United States)

Lin, Ya-Li; Gong, Ling-Li; Che, Kai-Jun; Li, Sen-Sen; Chu, Cheng-Xu; Cai, Zhi-Ping; Yang, Chaoyong James; Chen, Lu-Jian

2017-05-01

We examined the end-pumped lasing behaviors of dye doped cholesteric liquid crystal (DDCLC) microshells which were fabricated by glass capillary microfluidics. Several kinds of mode resonances, including distributed feedback, Fabry-Pérot (FP), and whispering gallery (WG) modes, can be robustly constructed in each individual DDCLC microshell by varying the beam diameter, namely, tuning the DDCLC gain area. The FP and WG modes were further confirmed experimentally, and the corresponding lasing mechanisms are clearly revealed from the unique material characteristics of DDCLC and the geometrical structure of the microshell. Additionally, we demonstrated that the osmotic pressure can be used to shrink/expand the microshell, productively tuning the excitation of lasing modes in a controlled manner. We wish our findings can provide a new insight into the design of DDCLC microlasers with tunable optical properties.

Enhanced Exciton and Photon Confinement in Ruddlesden-Popper Perovskite Microplatelets for Highly Stable Low-Threshold Polarized Lasing.

Science.gov (United States)

Li, Mingjie; Wei, Qi; Muduli, Subas Kumar; Yantara, Natalia; Xu, Qiang; Mathews, Nripan; Mhaisalkar, Subodh G; Xing, Guichuan; Sum, Tze Chien

2018-06-01

At the heart of electrically driven semiconductors lasers lies their gain medium that typically comprises epitaxially grown double heterostuctures or multiple quantum wells. The simultaneous spatial confinement of charge carriers and photons afforded by the smaller bandgaps and higher refractive index of the active layers as compared to the cladding layers in these structures is essential for the optical-gain enhancement favorable for device operation. Emulating these inorganic gain media, superb properties of highly stable low-threshold (as low as ≈8 µJ cm -2 ) linearly polarized lasing from solution-processed Ruddlesden-Popper (RP) perovskite microplatelets are realized. Detailed investigations using microarea transient spectroscopies together with finite-difference time-domain simulations validate that the mixed lower-dimensional RP perovskites (functioning as cladding layers) within the microplatelets provide both enhanced exciton and photon confinement for the higher-dimensional RP perovskites (functioning as the active gain media). Furthermore, structure-lasing-threshold relationship (i.e., correlating the content of lower-dimensional RP perovskites in a single microplatelet) vital for design and performance optimization is established. Dual-wavelength lasing from these quasi-2D RP perovskite microplatelets can also be achieved. These unique properties distinguish RP perovskite microplatelets as a new family of self-assembled multilayer planar waveguide gain media favorable for developing efficient lasers. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Optical-cell model based on the lasing competition of mode structures with different Q-factors in high-power semiconductor lasers

Energy Technology Data Exchange (ETDEWEB)

Podoskin, A. A., E-mail: podoskin@mail.ioffe.ru; Shashkin, I. S.; Slipchenko, S. O.; Pikhtin, N. A.; Tarasov, I. S. [Russian Academy of Sciences, Ioffe Institute (Russian Federation)

2015-08-15

A model describing the operation of a completely optical cell, based on the competition of lasing of Fabry-Perot cavity modes and the high-Q closed mode in high-power semiconductor lasers is proposed. Based on rate equations, the conditions of lasing switching between Fabry-Perot modes for ground and excited lasing levels and the closed mode are considered in the case of increasing internal optical loss under conditions of high current pump levels. The optical-cell operation conditions in the mode of a high-power laser radiation switch (reversible mode-structure switching) and in the mode of a memory cell with bistable irreversible lasing switching between mode structures with various Q-factors are considered.

Advances in High-Power, Ultrashort Pulse DPSSL Technologies at HiLASE

Directory of Open Access Journals (Sweden)

Martin Smrž

2017-10-01

Full Text Available The development of kW-class diode-pumped picosecond laser sources emitting at various wavelengths started at the HiLASE Center four years ago. A 500-W Perla C thin-disk laser with a diffraction limited beam and repetition rate of 50–100 kHz, a frequency conversion to mid-infrared (mid-IR, and second to fifth harmonic frequencies was demonstrated. We present an updated review on the progress in the development of compact picosecond and femtosecond high average power radiation sources covering the ultraviolet (UV to mid-IR spectral range at the HiLASE Center. We also report on thin-disk manufacturing by atomic diffusion bonding, which is a crucial technology for future high-power laser development.

Photophysics and lasing correlation of pyrromethene 567 dye in crosslinked polymeric networks

International Nuclear Information System (INIS)

Banuelos Prieto, J.; Lopez Arbeloa, F.; Garcia, O.; Arbeloa, I. Lopez

2007-01-01

The photophysical properties of the pyrromethene 567 dye incorporated in copolymers of methylmethacrylate with different acrylic and methacrylic crosslinking monomers are reported. In general, the solid matrices improve the fluorescence capacity of the dye, due to both an increase and a decrease in the radiative and non-radiative deactivation rate constants, respectively, as consequence of a more rigid environment. It is observed that there is an optimal crosslinking degree for the highest fluorescence efficiency, which depends on the nature of the crosslinking monomer. Taking into account the lasing properties for these systems, it is established a good correlation between the lasing and the fluorescence characteristics of the dye in agreement with previous conclusions obtained in liquid solutions

Unique lasing mechanism of localized dispersive nanostructures in InAs/InGaAlAs quantum dash broad interband laser

KAUST Repository

Tan, C. L.; Djie, H. S.; Tan, C. K.; Ooi, Boon S.

2010-01-01

The authors report on the nanowires-like and nanodots-like lasing behaviors in addition to multiple-wavelength interband transitions from InAs/InAlGaAs quantum dash (Qdash) lasers in the range of ~1550 nm. The presence of lasing actions

[Influence AquaLase at corneal endothelial cells].

Science.gov (United States)

Jirásková, N; Rozsíval, P; Ludvíková, M; Burova, M; Nekolová, J

2009-07-01

To assess the effect of the cleaning of the posterior capsule using pulses of balanced salt solution (BSS) on the corneal endothelial cells. This pilot study involves 43 patients with bilateral cataracts having lens removal using torsional phacoemulsification (Ozil, Infiniti, Alcon) and bimanul irrigation/aspiration (I/A). Posterior capsule of the right eye of each patient was cleaned using pulses of BSS (AquaLase, Infiniti, Alcon). Surgery was performed by one of 2 surgeons (NJ, PR), both eyes of each patient was operated on by the same surgeon. Best corrected visual acuity (BCVA), endotelial cell count and pachymetry were evaluated pre- and postoperatively as well as occurence af peri- and postoperative complications. Preoperative mean pachymetry (P) was 566 +/- 45 microm in the right eye (RE) and 562 +/- 42 microm in the left eye (LE), mean endotelial cell count (ECC) 2541 +/- 317 cells/mm2 (RE) and 2567 +/- 311 cells/mm2 (LE). Three months after surgery P was 557 +/- 43 microm (RE) and 558 +/- 45 microm (LE) and ECC 2368 +/- 416 cells/mm2 (RE) and 2396 +/- 417 cells/mm2 (LE). There was no statistical difference in postoperative changes of both corneal parameters between right and left eyes. Best corrected visual acuity improved in all eyes and no peri-or postoperative complications occured. Cleaning of the posterior capsule using AquaLase is safe for corneal endothelial cells.

The possibility of lasing in Ne+Ar ionic molecules pumped by a hard ioniser

International Nuclear Information System (INIS)

Boichenko, Aleksandr M; Yakovlenko, Sergei I

2000-01-01

The kinetic model of relaxation in the Ne-Ar-Kr mixture pumped by a hard ioniser is constructed in connection with the analysis of the possibility of lasing at the Ne + Ar→NeAr + transition of the inert-gas ionic exciplexes. The calculations based on the typical rates of plasmachemical reactions demonstrate that the lasing is possible but difficult to realise: One needs high pressures (greater than 16 bar) and high pumping densities (∼ 1 MW cm -3 ). In the most favourable cases, the laser efficiency lies between 0.05 and 0.25%. (active media)

Electrospun dye-doped fiber networks: lasing emission from randomly distributed cavities

DEFF Research Database (Denmark)

Krammer, Sarah; Vannahme, Christoph; Smith, Cameron

2015-01-01

Dye-doped polymer fiber networks fabricated with electrospinning exhibit comb-like laser emission. We identify randomly distributed ring resonators being responsible for lasing emission by making use of spatially resolved spectroscopy. Numerical simulations confirm this result quantitatively....

Brillouin lasing in single-mode tapered optical fiber with inscribed fiber Bragg grating array

Science.gov (United States)

Popov, S. M.; Butov, O. V.; Chamorovskiy, Y. K.; Isaev, V. A.; Kolosovskiy, A. O.; Voloshin, V. V.; Vorob'ev, I. L.; Vyatkin, M. Yu.; Mégret, P.; Odnoblyudov, M.; Korobko, D. A.; Zolotovskii, I. O.; Fotiadi, A. A.

2018-06-01

A tapered optical fiber has been manufactured with an array of fiber Bragg gratings (FBG) inscribed during the drawing process. The total fiber peak reflectivity is 5% and the reflection bandwidth is ∼3.5 nm. A coherent frequency domain reflectometry has been applied for precise profiling of the fiber core diameter and grating reflectivity both distributed along the whole fiber length. These measurements are in a good agreement with the specific features of Brillouin lasing achieved in the semi-open fiber cavity configuration.

Terahertz light-emitting graphene-channel transistor toward single-mode lasing

Science.gov (United States)

Yadav, Deepika; Tamamushi, Gen; Watanabe, Takayuki; Mitsushio, Junki; Tobah, Youssef; Sugawara, Kenta; Dubinov, Alexander A.; Satou, Akira; Ryzhii, Maxim; Ryzhii, Victor; Otsuji, Taiichi

2018-03-01

A distributed feedback dual-gate graphene-channel field-effect transistor (DFB-DG-GFET) was fabricated as a current-injection terahertz (THz) light-emitting laser transistor. We observed a broadband emission in a 1-7.6-THz range with a maximum radiation power of 10 μW as well as a single-mode emission at 5.2 THz with a radiation power of 0.1 μW both at 100 K when the carrier injection stays between the lower cutoff and upper cutoff threshold levels. The device also exhibited peculiar nonlinear threshold-like behavior with respect to the current-injection level. The LED-like broadband emission is interpreted as an amplified spontaneous THz emission being transcended to a single-mode lasing. Design constraints on waveguide structures for better THz photon field confinement with higher gain overlapping as well as DFB cavity structures with higher Q factors are also addressed towards intense, single-mode continuous wave THz lasing at room temperature.

Thermally and optically tunable lasing properties from dye-doped holographic polymer dispersed liquid crystal in capillaries

Science.gov (United States)

Chen, Maozhou; Dai, Haitao; Wang, Dongshuo; Yang, Yue; Luo, Dan; Zhang, Xiaodong; Liu, Changlong

2018-03-01

In this paper, we investigated tunable lasing properties from the dye-doped holographic polymer dispersed liquid crystal (HPDLC) gratings in capillaries with thermal and optical manners. The thermally tunable range of the lasing from the dye-doped HPDLC reached 8.60 nm with the temperature ranging from 23 °C to 50 °C. The optically tunable laser emission was achieved by doping azo-dye in HPDLC. The transition of azo-dye from trans- to cis-state could induce the reorientation of LC molecules after UV light irradiation, which resulted in the variation of refractive index contrast of LC-rich/polymer-rich layer in HPDLC. Experimentally, the emission wavelength of lasing showed a blueshift (about 2 nm) coupled with decreasing output intensities. The tunable laser based on HPDLC may enable more applications in laser displays, optical communication, biosensors, etc.

First lasings at IR-and FIR range using hybrid type undulator (FEL facility 4) and Halbach type undulator

International Nuclear Information System (INIS)

Takii, T.; Oshita, E.; Okuma, S.; Wakita, K.; Koga, A.; Tomimasu, T.; Ohasi, K.

1997-01-01

First lasing at 18μm was achieved by using a 2.7-m long hybrid type undulator (undulator 4) for far-infrared FELs and a 6.72-m long optical cavity installed at the 33-MeV beam line of the downstream of the FEL facility 1 (FEL-1). We are challenged at two-color FEL oscillation in mid-infrared range using the undulator 1 (λ u=3.4mm) and in far-infrared range using the undulator 4 (λ u=9mm). At first, a 30-MeV, 60-A beam passed through the undulator 1 without lasing is transported using a QFQDBQFQDBQFQDQF system and is used for lasing at the undulator 4. However, six pairs of steering coils had to be attached on the beam duct to reduce the deviation of the electron beam trajectory due to the vertical field distribution induced by the built-in electromagnets. The minimum gap of the undulator 4 was designed to be 35mm. However, the steering coils attached on the beam duct increased the gap up to 52mm. Therefore, the hybrid type undulator was replaced by a new Halbach type one (λ u=8mm, N=30) after the first lasing at 18μm on October 24, '96. The New FEL facility 4 was installed in the middle of December and first lasing at 18.6μm was achieved on December 26, within 10 hours operation. (author)

Analytical model of ground-state lasing phenomenon in broadband semiconductor quantum dot lasers

Science.gov (United States)

Korenev, Vladimir V.; Savelyev, Artem V.; Zhukov, Alexey E.; Omelchenko, Alexander V.; Maximov, Mikhail V.

2013-05-01

We introduce an analytical approach to the description of broadband lasing spectra of semiconductor quantum dot lasers emitting via ground-state optical transitions of quantum dots. The explicit analytical expressions describing the shape and the width of lasing spectra as well as their temperature and injection current dependences are obtained in the case of low homogeneous broadening. It is shown that in this case these dependences are determined by only two dimensionless parameters, which are the dispersion of the distribution of QDs over the energy normalized to the temperature and loss-to-maximum gain ratio. The possibility of optimization of laser's active region size and structure by using the intentionally introduced disorder is also carefully considered.

Influence of vertical coupling on the lasing operation of quantum-dash laser

KAUST Repository

Khan, Mohammed Zahed Mustafa; Ng, Tien Khee; Ooi, Boon S.

2012-01-01

The authors numerically investigated the consequence of vertical coupling among multi-stack InAs quantum dash (Qdash) laser structure on the lasing bandwidth. The developed model is based on multi-population carrier-photon rate equation

White random lasing in mixture of ZnSe, CdS and CdSSe micropowders

Science.gov (United States)

Alyamani, A. Y.; Leanenia, M. S.; Alanazi, L. M.; Aljohani, M. M.; Aljariwi, A. A.; Rzheutski, M. V.; Lutsenko, E. V.; Yablonskii, G. P.

2016-03-01

Room temperature random lasing with white light emission in a mixture of AIIBVI semiconductor powders was achieved for the first time. The scattering gain media was formed by the mixture of closely packed active micron sized crystallites of ZnSe, CdS, CdSSe semiconductors. The micropowders were produced by grinding bulk crystals of each compound. Optical excitation was performed by 10-nanosecond pulses of tuned Ti:Al2O3-laser at 390 nm. The lasing in the mixture of semiconductor powders was achieved simultaneously at four wavelengths in blue, green, yellow and red spectral regions after exceeding the threshold excitation power density. A drastic integral intensity increase, spectrum narrowing and appearance of mode structure accompanied the laser action. ZnSe crystallites produce the laser light at about 460 nm while CdS particles - at about 520 nm. Two types of CdSSe semiconductor micropowders with different sulfur content lase at 580 nm and 660 nm. The threshold excitation power densities for all laser lines in the emission spectrum are approximately the same of about 0.9 MW/cm2. The sum of the emission spectrum of the mixture of the micropowders forms white light with high brightness. Lasing is due to an appearance of random feedback for amplified radiation in the active medium of closely packed light scattering crystallites. The presented results may find their applications for visualization systems, lighting technology, data transmission, medicine as biosensors and in identification systems. The key feature of random lasers is low cost of its production and possibility to be deposited on any type of surface.

Clinical observation on treatment of Meibomian gland before IntraLase LASIK in patients with Meibomian gland dysfunction

Directory of Open Access Journals (Sweden)

He Huang

2016-04-01

Full Text Available AIM:To observe the changes of ocular surface inflammation and tear film state before and after the operation after preoperative targeted therapy for Meibomian gland in the patients scheduled for IntraLase-LASIK with Meibomian gland dysfunction(MGD. METHODS: Thirty-five patients(70 eyesscheduled for IntraLase-LASIK with different degrees of MGD from March to September 2014 were enrolled in this study. All patients were randomly divided into 2 groups, 17 patients(34 eyesin the observation group accepted preoperative targeted therapy for Meibomian gland; 18 patients(36 eyesin the control group did not give the treatment for Meibomian gland, the rest treatments were the same. The change of conjunctival congestion, photophobia, dry symptom score and tear break-up time(BUTwere observed at 1d and 1wk after IntraLase-LASIK. RESULTS: At 1d and 1wk postoperatively, the scores of conjunctival congestion, photophobia, dry symptom and BUT of the observation group were all lower than those of the control group, and the differences were significant(PCONCLUSION: For the patients scheduled for IntraLase-LASIK with MGD, preoperative targeted therapy for Meibomian gland can reduce the postoperative symptoms of ocular surface irritation, stabilize the tear film, improve the postoperative effect and improve the comfort of patients.

CW 3μm lasing via two-photon pumping in cesium vapor with a 1W source

Science.gov (United States)

Haluska, Nathan D.; Rice, Christopher A.; Perram, Glen P.

2018-02-01

We report the first CW lasing from two-photon pumping via a virtual state. Pulsed and the CW lasing of the 3096 nm 72 P1/2 to 72 S1/2 line are observed from degenerate two-photon pumping of the cesium 72 S1/2 to 62 D3/2 transition. High intensity pulses excite over 17 lasing wavelengths. Under lower intensity CW excitation, 3 μm lasing is still observed with efficiencies of 0.7%. CW experiments utilized a Cs heat pipe at 150 °C to 270 °C, and a highly-focused, single pass, Ti-Sapphire pump with no aid of a cavity. Unlike normal DPALS, this architecture does not require buffer gas, and heat is released optically so a flowing system is not required. Both suggest a very simple device with excellent beam quality is possible. This proof of concept can be greatly enhanced with more optimal conditions such as non-degenerate pumping to further increase the two-photon pump cross section and the addition of a cavity to improve mode volume overlap. These improvements may lead to an increase in efficiencies to a theoretical maximum of 14%. Results suggest two-photon pumping with diodes is feasible.

Continuous-wave Optically Pumped Lasing of Hybrid Perovskite VCSEL at Green Wavelength

KAUST Repository

Alias, Mohd Sharizal

2017-05-08

We demonstrate the lasing of a perovskite vertical-cavity surface-emitting laser at green wavelengths, which operates under continuous-wave optical pumping at room-temperature by embedding hybrid perovskite between dielectric mirrors deposited at low-temperature.

Continuous-wave Optically Pumped Lasing of Hybrid Perovskite VCSEL at Green Wavelength

KAUST Repository

Alias, Mohd Sharizal; Liu, Zhixiong; Alatawi, Abdullah; Ng, Tien Khee; Wu, Tao; Ooi, Boon S.

2017-01-01

We demonstrate the lasing of a perovskite vertical-cavity surface-emitting laser at green wavelengths, which operates under continuous-wave optical pumping at room-temperature by embedding hybrid perovskite between dielectric mirrors deposited at low-temperature.

Influence of inhomogeneous broadening and deliberately introduced disorder on the width of the lasing spectrum of a quantum dot laser

International Nuclear Information System (INIS)

Korenev, V. V.; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V.

2012-01-01

Analytical expressions for the shape and width of the lasing spectra of a quantum-dot (QD) laser in the case of a small (in comparison with the spectrum width) homogeneous broadening of the QD energy levels have been obtained. It is shown that the dependence of the lasing spectrum width on the output power at room temperature is determined by two dimensionless parameters: the width of QD distribution over the optical-transition energy, normalized to temperature, and the ratio of the optical loss to the maximum gain. The optimal dimensions of the laser active region have been found to obtain a specified width of the emission spectrum at a minimum pump current. The possibility of using multilayer structures with QDs to increase the lasing spectrum’s width has been analyzed. It is shown that the use of several arrays of QDs with deliberately variable optical-transition energies leads to broadening of the lasing spectra; some numerical estimates are presented.

Influence of inhomogeneous broadening and deliberately introduced disorder on the width of the lasing spectrum of a quantum dot laser

Energy Technology Data Exchange (ETDEWEB)

Korenev, V. V.; Savelyev, A. V., E-mail: savelev@mail.ioffe.ru; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V. [Russian Academy of Sciences, Nanotechnology Research and Education Center, St. Petersburg Academic University (Russian Federation)

2012-05-15

Analytical expressions for the shape and width of the lasing spectra of a quantum-dot (QD) laser in the case of a small (in comparison with the spectrum width) homogeneous broadening of the QD energy levels have been obtained. It is shown that the dependence of the lasing spectrum width on the output power at room temperature is determined by two dimensionless parameters: the width of QD distribution over the optical-transition energy, normalized to temperature, and the ratio of the optical loss to the maximum gain. The optimal dimensions of the laser active region have been found to obtain a specified width of the emission spectrum at a minimum pump current. The possibility of using multilayer structures with QDs to increase the lasing spectrum's width has been analyzed. It is shown that the use of several arrays of QDs with deliberately variable optical-transition energies leads to broadening of the lasing spectra; some numerical estimates are presented.

Optically pumped lasing in single crystals of organometal halide perovskites prepared by cast-capping method

Energy Technology Data Exchange (ETDEWEB)

Nguyen, Van-Cao; Katsuki, Hiroyuki; Yanagi, Hisao, E-mail: yanagi@ms.naist.jp [Graduate School of Materials Science, Nara Institute of Science and Technology (NAIST), 8916-5 Takayama, Ikoma, Nara 630-0192 (Japan); Sasaki, Fumio [Electronics and Photonics Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan)

2016-06-27

A simple “cast-capping” method is adopted to prepare single-crystal perovskites of methyl ammonium lead bromide (CH{sub 3}NH{sub 3}PbBr{sub 3}). By capping a CH{sub 3}NH{sub 3}PbBr{sub 3} solution casted on one substrate with another substrate such as glass, mica, and distributed Bragg reflector (DBR), the slow evaporation of solvent enables large-size cubic crystals to grow between the two substrates. Under optical pumping, edge-emitting lasing is observed based on Fabry–Pérot resonation between parallel side facets of a strip-shaped crystal typically with a lateral cavity length of a few tens of μm. On the other hand, vertical-cavity surface-emitting lasing (VCSEL) is obtained from a planar crystal grown between two DBRs with a cavity thickness of a few μm. Simultaneous detection of those edge- and surface-emissions reveals that the threshold excitation fluence of VCSEL is higher than that of the edge-emitting lasing due to thickness gradient in the planar crystal.

Effect of active medium inhomogeneity on lasing characteristics of InAs/InP quantum-dash lasers

KAUST Repository

Khan, Mohammed Zahed Mustafa

2010-01-01

The authors report on the effect of quantum-dash (Qdash) inhomogeneity on the characteristics of InAs/InP Qdash laser utilizing a single state rate equation model. The inhomogeneity is assumed to follow the Gaussian approximation. From our observation, an increased in Qdash inhomogeneity results in increasing of threshold current density and redshifting of the peak lasing wavelength. The lasing linewidth of the Qdash lasers has also found to increase under large injection current, attaining a full width at half maximum (FWHM) of ~ 17 nm.

Brillouin lasing in single-mode tapered optical fiber with inscribed fiber Bragg grating array

Directory of Open Access Journals (Sweden)

S.M. Popov

2018-06-01

Full Text Available A tapered optical fiber has been manufactured with an array of fiber Bragg gratings (FBG inscribed during the drawing process. The total fiber peak reflectivity is 5% and the reflection bandwidth is ∼3.5 nm. A coherent frequency domain reflectometry has been applied for precise profiling of the fiber core diameter and grating reflectivity both distributed along the whole fiber length. These measurements are in a good agreement with the specific features of Brillouin lasing achieved in the semi-open fiber cavity configuration. Keywords: Tapered optical fibers, Fiber Bragg gratings, Random lasers

Apparatus for uniform pumping of lasing media

International Nuclear Information System (INIS)

Condit, W.C.; Eccles, S.F.

1975-01-01

Electron beam pumping of gaseous or liquid lasing media is carried out by means of electron pulses generated by an electron accelerator. Between the accelerator and the laser cavity, the electron pulse is subjected to a magnetic field to turn the electron pulse approximately through a quarter orbit, so that in essence the direction of pulse travel is changed from axial to lateral. This procedure then enables pumping of the laser cavity uniformly and simultaneously, or in any desired traveling wave mode, over the entire length of the laser cavity with relatively short, and highly intense, electron pulses. (U.S.)

Strong Exciton–Photon Coupling and Lasing Behavior in All-Inorganic CsPbBr3 Micro/Nanowire Fabry-Pérot Cavity

KAUST Repository

Du, Wenna

2018-03-14

All-inorganic perovskite micro/nanowire materials hold great promises as nanoscale coherent light source due to their superior optical and electronic properties. The coupling strength between exciton and photon in this system is important for their optical application, however, is rarely studied. In this work, we demonstrated the strong coupling of exciton-photon and polariton lasing in high quality CsPbBr micro/nanowires synthesized by a CVD method. By exploring spatial resolved PL spectra of CsPbBr cavity, we observed mode volume dependent coupling strength with a vacuum Rabi splitting up to 656 meV, as well as significant increase in group index. Moreover, low threshold polariton lasing was achieved at room temperature within strong coupling regime; the polariton characteristic is confirmed by comparing lasing spectra with waveguided output spectra and the dramatically reduced lasing threshold. Our present results provide new avenues to achieve high coupling strengths potentially enabling application of exciting phenomena such as Bose-Einstein condensation of polaritons, efficient light-emitting diodes, and lasers.

Towards modeling of random lasing in dye doped bio-organic based systems: ray-tracing and cellular automaton analysis

Science.gov (United States)

Mitus, A. C.; Stopa, P.; Zaklukiewicz, W.; Pawlik, G.; Mysliwiec, J.; Kajzar, F.; Rau, I.

2015-08-01

One of many photonic applications of biopolymers as functional materials is random lasing resulting from an incorporation of highly luminescent dyes into biopolymeric matrix, which leads to a random but coherent light scattering in amplifying medium. In spite of numerous theoretical and experimental studies the origin of the coherence is still not clear and various scenarios are discussed. In particular, inhomogeneity of biopolymeric layers can hypothetically promote the feedback in the scattering of the emitted light resulting in coherent and incoherent random lasing. In this paper we analyze the light scattering in a model system of scattering centers of circular shapes and various dimensions using ray-tracing techniques. In the second part, which has mostly a tutorial character, we present the approach to the study of random lasing using a cellular automaton model of Wiersma et al.

Distinct Lasing Operation From Chirped InAs/InP Quantum-Dash Laser

KAUST Repository

Khan, Mohammed Zahed Mustafa; Ng, Tien Khee; Lee, Chi-Sen; Anjum, Dalaver H.; Cha, Dong Kyu; Bhattacharya, Pallab K.; Ooi, Boon S.

2013-01-01

We study the enhanced inhomogeneity across the InAs quantum-dash (Qdash) layers by incorporating a chirped AlGaInAs barrier thickness in the InAs/InP laser structure. The lasing operation is investigated via Fabry-Pérot ridge-waveguide laser

Effect of carrier dynamics and temperature on two-state lasing in semiconductor quantum dot lasers

Energy Technology Data Exchange (ETDEWEB)

Korenev, V. V., E-mail: korenev@spbau.ru; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V. [Saint Petersburg Academic University-Nanotechnology Research and Education Center (Russian Federation)

2013-10-15

It is analytically shown that the both the charge carrier dynamics in quantum dots and their capture into the quantum dots from the matrix material have a significant effect on two-state lasing phenomenon in quantum dot lasers. In particular, the consideration of desynchronization in electron and hole capture into quantum dots allows one to describe the quenching of ground-state lasing observed at high injection currents both qualitatevely and quantitatively. At the same time, an analysis of the charge carrier dynamics in a single quantum dot allowed us to describe the temperature dependences of the emission power via the ground- and excited-state optical transitions of quantum dots.

Effect of carrier dynamics and temperature on two-state lasing in semiconductor quantum dot lasers

International Nuclear Information System (INIS)

Korenev, V. V.; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V.

2013-01-01

It is analytically shown that the both the charge carrier dynamics in quantum dots and their capture into the quantum dots from the matrix material have a significant effect on two-state lasing phenomenon in quantum dot lasers. In particular, the consideration of desynchronization in electron and hole capture into quantum dots allows one to describe the quenching of ground-state lasing observed at high injection currents both qualitatevely and quantitatively. At the same time, an analysis of the charge carrier dynamics in a single quantum dot allowed us to describe the temperature dependences of the emission power via the ground- and excited-state optical transitions of quantum dots

LASE Measurements of Water Vapor, Aerosol, and Cloud Distributions in Saharan Air Layers and Tropical Disturbances

Science.gov (United States)

Ismail, Syed; Ferrare, Richard A.; Browell, Edward V.; Kooi, Susan A.; Dunion, Jason P.; Heymsfield, Gerry; Notari, Anthony; Butler, Carolyn F.; Burton, Sharon; Fenn, Marta;

Electrically Injected Polariton Lasing from a GaAs-Based Microcavity under Magnetic Field

KAUST Repository

Bhattacharya, Pallab; Das, Ayan; Jankowski, Marc; Bhowmick, Sishir; Lee, Chi-Sen; Jahangir, Shafat

2012-01-01

Suppression of relaxation bottleneck and subsequent polariton lasing is observed in a GaAs-based microcavity under the application of a magnetic field. The threshold injection current density is 0.32 A/cm2 at 7 Tesla.

Physically transient photonics: random versus distributed feedback lasing based on nanoimprinted DNA.

Science.gov (United States)

Camposeo, Andrea; Del Carro, Pompilio; Persano, Luana; Cyprych, Konrad; Szukalski, Adam; Sznitko, Lech; Mysliwiec, Jaroslaw; Pisignano, Dario

2014-10-28

Room-temperature nanoimprinted, DNA-based distributed feedback (DFB) laser operation at 605 nm is reported. The laser is made of a pure DNA host matrix doped with gain dyes. At high excitation densities, the emission of the untextured dye-doped DNA films is characterized by a broad emission peak with an overall line width of 12 nm and superimposed narrow peaks, characteristic of random lasing. Moreover, direct patterning of the DNA films is demonstrated with a resolution down to 100 nm, enabling the realization of both surface-emitting and edge-emitting DFB lasers with a typical line width of <0.3 nm. The resulting emission is polarized, with a ratio between the TE- and TM-polarized intensities exceeding 30. In addition, the nanopatterned devices dissolve in water within less than 2 min. These results demonstrate the possibility of realizing various physically transient nanophotonics and laser architectures, including random lasing and nanoimprinted devices, based on natural biopolymers.

Effect of antibiotic, Lacto-lase and probiotic addition in chicken feed on protein and fat content of chicken meat

Science.gov (United States)

Azhar, Noor Amiza; Abdullah, Aminah

2015-09-01

This research was conducted to investigate the effect of chicken feed additives (antibiotic, Lacto-lase® and probiotic) on protein and fat content of chicken meat. Chicken fed with control diet (corn-soy based diet) served as a control. The treated diets were added with zinc bacitracin (antibiotic), different amount of Lacto-lase® (a mixture of probiotic and enzyme) and probiotic. Chicken were slaughtered at the age of 43-48 days. Each chicken was divided into thigh, breast, drumstick, drumette and wing. Protein content in chicken meat was determined by using macro-Kjeldahl method meanwhile Soxhlet method was used to analyse fat content. The result of the study showed that the protein content of chicken breast was significantly higher (p≤0.05) while thigh had the lowest protein content (p≤0.05). Antibiotic fed chicken was found to have the highest protein content among the treated chickens but there was no significant different with 2g/kg Lacto-lase® fed chicken (p>0.05). All thighs were significantly higher (p≤0.05) in fat content except for drumette of control chicken while breast contained the lowest fat content compared to other chicken parts studied. The control chicken meat contained significantly higher (p≤0.05) amount of fat compared to the other treated chickens. Chicken fed with 2g/kg Lacto-lase® had the lowest (p≤0.05) fat content. The result of this study indicated that the addition of Lacto-lase® as a replacement of antibiotic in chicken feed will not affect the content of protein and fat of chicken meat.

Lasing thresholds of helical photonic structures with different positions of a single light-amplifying helix turn

Energy Technology Data Exchange (ETDEWEB)

Blinov, L M; Palto, S P [A.V. Shubnikov Institute of Crystallography, Russian Academy of Sciences, Moscow, Russian Federaion (Russian Federation)

2013-09-30

Numerical simulation is used to assess the lasing threshold of helical structures of cholesteric liquid crystals (CLCs) in which only one turn amplifies light. This turn is located either in the centre of symmetric structures of various sizes or in an arbitrary place in asymmetric structures of preset size. In all cases, we find singularities in light amplification by a one-dimensional CLC structure for the most important band-edge modes (m1, m2 and m3) and plot the threshold gain coefficient k{sub th} against the position of the amplifying turn. For the symmetric structures, the lasing threshold of the m1 mode is shown to vary linearly with the inverse of the square of the cavity length. Moreover, modes with a lower density of photonic states (DOS) in the cavity may have a lower lasing threshold. This can be accounted for by the dependence of the density of photonic states on the position of the amplifying turn and, accordingly, by the nonuniform electromagnetic field intensity distribution along the cavity for different modes. In the asymmetric structures, the same field energy distribution is responsible for a correlation between k{sub th} and DOS curves. (lasers)

Generation of 13.9 µm radiation from CO2 by cascade lasing or ...

Indian Academy of Sciences (India)

the 1000 level is fast, and such lasers operate at low power and energies. ... CO2 laser; Q-switching; generation of 14 µm radiation from CO2; cascade lasing ... of 5% hole coupling output mirror, and a high reflectivity rotating mirror. This.

Reproducibility of flap thickness with IntraLase FS and Moria LSK-1 and M2 microkeratomes.

Science.gov (United States)

Talamo, Jonathan H; Meltzer, Jeremy; Gardner, John

2006-06-01

To compare flap thickness reproducibility of the femtosecond laser and two mechanical microkeratomes. Flap thickness for all eyes was measured as the difference between the preoperative (day of surgery) full corneal thickness and post-flap creation central stromal bed thickness using ultrasonic pachymetry. Flap thickness values produced by three different microkeratome systems were compared for accuracy and reproducibility. For 99 flaps created using the IntraLase FS laser with an intended thickness of 110 microm, the mean achieved thickness was 119 +/- 12 microm (range: 82 to 149 microm). In 100 eyes treated with the Moria LSK-1 microkeratome with an intended flap thickness of 160 microm, the mean achieved thickness was 130 +/- 19 microm (range: 71 to 186 microm). In 135 eyes treated with the Moria M2 microkeratome with an intended flap thickness of 130 microm, mean thickness was 142 +/- 24 microm (range: 84 to 203 microm). The standard deviation and range of corneal flap thickness created with the IntraLase FS laser was significantly smaller than either mechanical microkeratome (P < .0001). When compared to two commonly used mechanical microkeratomes, mean achieved flap thickness was more reproducible with the IntraLase FS laser, reducing the comparative risk of overly thick flaps.

Single-atom lasing induced atomic self-trapping

International Nuclear Information System (INIS)

Salzburger, T.; Ritsch, H.

2004-01-01

We study atomic center of mass motion and field dynamics of a single-atom laser consisting of a single incoherently pumped free atom moving in an optical high-Q resonator. For sufficient pumping, the system starts lasing whenever the atom is close to a field antinode. If the field mode eigenfrequency is larger than the atomic transition frequency, the generated laser light attracts the atom to the field antinode and cools its motion. Using quantum Monte Carlo wave function simulations, we investigate this coupled atom-field dynamics including photon recoil and cavity decay. In the regime of strong coupling, the generated field shows strong nonclassical features like photon antibunching, and the atom is spatially confined and cooled to sub-Doppler temperatures. (author)

The analytical approach to the multi-state lasing phenomenon in undoped and p-doped InAs/InGaAs semiconductor quantum dot lasers

Science.gov (United States)

Korenev, Vladimir V.; Savelyev, Artem V.; Zhukov, Alexey E.; Omelchenko, Alexander V.; Maximov, Mikhail V.

2014-05-01

We introduce an analytical approach to the multi-state lasing phenomenon in p-doped and undoped InAs/InGaAs quantum dot lasers which were studied both theoretically and experimentally. It is shown that the asymmetry in charge carrier distribution in quantum dots as well as hole-to-electron capture rate ratio jointly determine laser's behavior in such a regime. If the ratio is lower than a certain critical value, the complete quenching of ground-state lasing takes place at sufficiently high injection currents; at higher values of the ratio, our model predicts saturation of the ground-state power. It was experimentally shown that the modulation p-doping of laser's active region results in increase of output power emitted via the ground-state optical transitions of quantum dots and in enhancement of the injection currents range in which multi-state lasing takes place. The maximum temperature at which multi-state lasing exists was increased by about 50°C in the p-doped samples. These effects are qualitatively explained in the terms of the proposed model.

Solvent effects on lasing characteristics for Rh B laser dye

Energy Technology Data Exchange (ETDEWEB)

Peter, Jaison, E-mail: jaison.peter@gmail.com [International School of Photonics, Cochin University of Science and Technology, Cochin 682022 (India); Kumar, Mahesh [Department of Applied Chemistry, Cochin University of Science and Technology, Cochin 682022 (India); Ananad, V.R.; Saleem, Rasool; Sebastian, Ananthu; Radhakrishnan, P.; Nampoori, V.P.N.; Vallabhan, C.P.G. [International School of Photonics, Cochin University of Science and Technology, Cochin 682022 (India); Prabhu, Radhakrishna [School of Engineering, Robert Gordon University, Aberdeen AB10 1FR, Scotland (United Kingdom); Kailasnath, M. [International School of Photonics, Cochin University of Science and Technology, Cochin 682022 (India)

2016-01-15

We demonstrate pulsed, photopumped multimode laser emission in the visible spectral range from rhodamine B dye dissolved in various solvents. The laser emission is characterized by a well-defined, low threshold pump power at which the emission spectral intensity dramatically increases and collapsed into several dominant laser modes with reduced mode spacing and spectral width. The modes were found to originate from the subcavities formed by the plane-parallel walls of the cuvette containing the gain medium. The cavity lasing spectral structure and the numbers of longitudinal modes were easily controlled by changing the solvents. A shift in the emission spectra has been also observed by changing the solvents will allow a limited range of tuning of laser emission wavelength. We also determined the gain coefficient and stimulated emission cross-section for the Rh B dye dissolved liquid laser system. A detailed discussion of the solvent effect in the lasing characteristics of Rh B in different solution is explained along with the computational data. - Highlights: • Report multimode laser emission from rhodamine B dye dissolved in various solvents. • Modes are originated from the plane-parallel walls of the cuvette. • Spectral range and the number of modes can be controlled by changing the solvents. • Changing solvents also allows a limited range of tuning of laser emission.

Gamma-ray lasing by free nuclei and by matter-antimatter beams

International Nuclear Information System (INIS)

Rivlin, L.A.

1997-01-01

I discuss the possibilities to induce the gamma-ray emission departing from attempts to use the Moessbauer effect. Three separate approaches are considered: (A) Stimulated radiative transitions in deeply cooled nuclear beams with hidden inversion; (B) external two-photon ignition of nuclear lasing accompanied by gamma-ray giant pulse emission; and (C) burst-like radiative annihilation of relativistic beams of electrons and positrons or parapositronium atoms ignited by an external beam of soft photons

Designing quantum-information-processing superconducting qubit circuits that exhibit lasing and other atomic-physics-like phenomena on a chip

Science.gov (United States)

Nori, Franco

2008-03-01

Superconducting (SC) circuits can behave like atoms making transitions between a few energy levels. Such circuits can test quantum mechanics at macroscopic scales and be used to conduct atomic-physics experiments on a silicon chip. This talk overviews a few of our theoretical studies on SC circuits and quantum information processing (QIP) including: SC qubits for single photon generation and for lasing; controllable couplings among qubits; how to increase the coherence time of qubits using a capacitor in parallel to one of the qubit junctions; hybrid circuits involving both charge and flux qubits; testing Bell's inequality in SC circuits; generation of GHZ states; quantum tomography in SC circuits; preparation of macroscopic quantum superposition states of a cavity field via coupling to a SC qubit; generation of nonclassical photon states using a SC qubit in a microcavity; scalable quantum computing with SC qubits; and information processing with SC qubits in a microwave field. Controllable couplings between qubits can be achieved either directly or indirectly. This can be done with and without coupler circuits, and with and without data-buses like EM fields in cavities (e.g., we will describe both the variable-frequency magnetic flux approach and also a generalized double-resonance approach that we introduced). It is also possible to ``turn a quantum bug into a feature'' by using microscopic defects as qubits, and the macroscopic junction as a controller of it. We have also studied ways to implement radically different approaches to QIP by using ``cluster states'' in SC circuits. For a general overview of this field, see, J.Q. You and F. Nori, Phys. Today 58 (11), 42 (2005)

Numerically investigating the cause of broadband lasing from InAs/InP quantum-dash laser

KAUST Repository

Khan, Mohammed Zahed Mustafa; Ng, Tien Khee; Ooi, Boon S.

2013-01-01

The authors numerically investigated the origin of broadband lasing from multi-stack InAs/InP quantum dash (Qdash) laser. For this a model based on multi-population carrier-photon rate equation is developed which treats each Qdash stacking layer

First lasing of a high-gain harmonic generation free-electron laser experiment.

Energy Technology Data Exchange (ETDEWEB)

Babzien, M.; Ben-Zvi, I.; Biedron, S. G.; DiMauro, L. F.; Douryan, A.; Galayda, J. N.; Gluskin, E.; Graves, W.; Jagger, J.; Johnson, E.; Krinsky, S.; Malone, R.; Pogorelsky, I.; Rakowsky, G.; Sajaev, V.; Skaritka, J.; Solomon, L.; Vasserman, I.; Wang, X. L.; Woodle, M.; Yakimenko, V.; Yu, L.-H.

1999-09-11

We report on the first lasing of a high-gain harmonic generation (HGHG) free-electron laser (FEL). The experiment was conducted at the Accelerator Test Facility (ATF) at Brookhaven National Laboratory (BNL). This is a BNL experiment in collaboration with the Advanced Photon Source (APS) at Argonne National Laboratory. A preliminary measurement gives a high-gain harmonic generation (HGHG) pulse energy that is 2 x 10{sup 7} times larger than the spontaneous radiation, In a purely self-amplified spontaneous emission (SASE) mode of operation, the signal was measured as 10 times larger than the spontaneous radiation in the same distance ({approximately}2 m) through the same wiggler. This means the HGHG signal is 2 x 10{sup 6} times larger than the SASE signal. To obtain the same saturated output power by the SASE process, the radiator would have to be 3 times longer (6 m).

Violet-to-Blue Gain and Lasing from Colloidal CdS Nanoplatelets: Low-Threshold Stimulated Emission Despite Low Photoluminescence Quantum Yield

Energy Technology Data Exchange (ETDEWEB)

Diroll, Benjamin T.; Talapin, Dmitri V.; Schaller, Richard D.

2017-02-13

Amplified spontaneous emission (ASE) and lasing from solution-processed materials are demonstrated in the challenging violet-to-blue (430–490 nm) spectral region for colloidal nanoplatelets of CdS and newly synthesized core/shell CdS/ZnS nanoplatelets. Despite modest band-edge photoluminescence quantum yields of 2% or less for single excitons, which we show results from hole trapping, the samples exhibit low ASE thresholds. Furthermore, four-monolayer CdS samples show ASE at shorter wavelengths than any reported film of colloidal quantum-confined material. This work underlines that low quantum yields for single excitons do not necessarily lead to a poor gain medium. The low ASE thresholds originate from negligible dispersion in thickness, large absorption cross sections of 2.8 × 10–14 cm–2, and rather slow (150 to 300 ps) biexciton recombination. We show that under higher-fluence excitation, ASE can kinetically outcompete hole trapping. Using nanoplatelets as the gain medium, lasing is observed in a linear optical cavity. This work confirms the fundamental advantages of colloidal quantum well structures as gain media, even in the absence of high photoluminescence efficiency.

Optically pumped lasing in a rolled-up dot-in-a-well (DWELL) microtube via the support of Au pad

Science.gov (United States)

Chai, Zhaoer; Wang, Qi; Cao, Jiawei; Mao, Guoming; Liu, Hao; Ren, Xiaomin; Maleev, Nikolai A.; Vasil'ev, Alexey P.; Zhukov, Alexey E.; Ustinov, Victor M.

2018-02-01

We report the observation of optically pumped continuous wave lasing in a self-rolled-up InGaAs/GaAs quantum dot microtube at room temperature. Single layer of InAs quantum dots ( 2.6 ML coverage) in a GaAs well sandwiched by two AlGaAs barriers are incorporated into the tube wall as the gain media. As-fabricated microtube is supported by a 300-nm-thick Au pad, aiming to separate the tube from GaAs substrate and thus to decrease the substrate loss, which finally enables lasing with ultralow threshold power ( 4 µW) from an microtube ring resonator.

A Faraday laser lasing on Rb 1529 nm transition.

Science.gov (United States)

Chang, Pengyuan; Peng, Huanfa; Zhang, Shengnan; Chen, Zhangyuan; Luo, Bin; Chen, Jingbiao; Guo, Hong

2017-08-21

We present the design and performance characterization of a Faraday laser directly lasing on the Rb 1529 nm transition (Rb, 5P 3/2  - 4D 5/2 ) with high stability, narrow spectral linewidth and low cost. This system does not need an additional frequency-stabilized pump laser as a prerequisite to preparing Rb atom from 5S to 5P excited state. Just by using a performance-improved electrodeless discharge lamp-based excited-state Faraday anomalous dispersion optical filter (LESFADOF), we realized a heterogeneously Faraday laser with the frequency corresponding to atomic transition, working stably over a range of laser diode (LD) current from 85 mA to 171 mA and the LD temperature from 11 °C to 32 °C, as well as the 24-hour long-term frequency fluctuation range of no more than 600 MHz. Both the laser linewidth and relative intensity noisy (RIN) are measured. The Faraday laser lasing on Rb 1529 nm transition (telecom C-band) can be applied to further research on metrology, microwave photonics and optical communication systems. Besides, since the transitions correspongding to the populated excited-states of alkali atoms within lamp are extraordinarily rich, this scheme can increase the flexibility for choosing proper wavelengths for Faraday laser and greatly expand the coverage of wavelength corresponding to atomic transmission for laser frequency stabilization.

Achieving Room Temperature Orange Lasing Using InGaP/InAlGaP Diode Laser

KAUST Repository

Al-Jabr, Ahmad

2015-09-28

We demonstrated the first orange laser diode at room temperature with a decent total output power of ∼46mW and lasing wavelength of 608nm, using a novel strain-induced quantum well intermixing in InGaP/InAlGaP red laser structure.

Study of the spectral and energy characteristics of lasing in the green spectral region by lithium fluoride with radiation color centers

Energy Technology Data Exchange (ETDEWEB)

Voitovich, A.P.; Kalinov, V.S.; Mikhnov, S.A.; Ovseichuk, S.I.

1987-06-01

The spectral and energy characteristics of lasers utilizing lithium fluoride with F2 and F3(+) color centers in transverse and longitudinal pumping schemes are studied. The feasibility of obtaining stable narrow-band radiation in the 510-570 nm range using a selective resonator is demonstrated. Consideration is given to the effect of lithium-fluoride crystal processing by excimer laser radiation at a wavelength of 308 nm on the spectroscopic and lasing characteristics of the F3(+) color center. After this processing, the laser efficiency in the green spectral region increases by more than a factor of two (reaching an efficiency of 14 percent). 7 references.

X-ray lasing in colliding plasmas

International Nuclear Information System (INIS)

Clark, R.W.; Davis, J.; Velikovich, A.L.; Whitney, K.G.

1997-01-01

Conditions favorable for the achievement of population inversion and large gains in short-pulse laser-heated selenium have been reported on previously [K. G. Whitney et al., Phys. Rev. E 50, 468 (1994)]. However, the required density profiles to minimize refraction and amplification losses can be difficult to achieve in conventional laser heated blowoff plasmas. The feasibility of accelerating plasma with a laser, and letting it collide with a solid density wall plasma has been explored. The density of the resulting shocked plasma can be controlled and refraction can be reduced in this design. A radiation hydrodynamics model is used to simulate the collision of the laser produced selenium plasma with the wall plasma. The heating of the stagnated plasma with a short-pulse laser is then simulated, providing the hydrodynamic response of the selenium plasma and detailed configuration nonequilibrium atomic populations. From the results of these calculations, it appears feasible to create an x-ray lasing selenium plasma with gains in the J=0 endash 1 line at 182 Angstrom in excess of 100cm -1 . copyright 1997 American Institute of Physics

Light transport and lasing in complex photonic structures

Science.gov (United States)

Liew, Seng Fatt

theoretical modeling and analysis explains why single scattering of light is dominant over multiple scattering in similar biological structures and is responsible for color generation. In collaboration with evolutionary biologists, we examine how closely-related species and populations of butterflies have evolved their structural color. We have used artificial selection on a lab model butterfly to evolve violet color from an ultra-violet brown color. The same coloration mechanism is found in other blue/violet species that have evolved their color in nature, which implies the same evolution path for their nanostructure. While the absorption of light is ubiquitous in nature and in applications, the question remains how absorption modifies the transmission in random media. Therefore, we numerically study the effects of optical absorption on the highest transmission states in a two-dimensional disordered waveguide. Our results show that strong absorption turns the highest transmission channel in random media from diffusive to ballistic-like transport. Finally, we have demonstrated lasing mode selection in a nearly circular semiconductor microdisk laser by shaping the spatial profile of the pump beam. Despite of strong mode overlap, selective pumping suppresses the competing lasing modes by either increasing their thresholds or reducing their power slopes. As a result, we can switch both the lasing frequency and the output direction. This powerful technique can have potential application as an on-chip tunable light source.

Conformal Organohalide Perovskites Enable Lasing on Spherical Resonators

KAUST Repository

Sutherland, Brandon R.

2014-10-28

© 2014 American Chemical Society. Conformal integration of semiconductor gain media is broadly important in on-chip optical communication technology. Here we deploy atomic layer deposition to create conformally deposited organohalide perovskites-an attractive semiconducting gain medium-with the goal of achieving coherent light emission on spherical optical cavities. We demonstrate the high quality of perovskite gain media fabricated with this method, achieving optical gain in the nanosecond pulse regime with a threshold for amplified spontaneous emission of 65 ± 8 μJ cm-2. Through variable stripe length measurements, we report a net modal gain of 125 ± 22 cm-1 and a gain bandwidth of 50 ± 14 meV. Leveraging the high quality of the gain medium, we conformally coat silica microspheres with perovskite to form whispering gallery mode optical cavities and achieve lasing.

RF discharge slab carbon monoxide laser: overtone lasing (2.5-4.0 micron) and fundamental band tuning (5.0-6.5 micron)

Science.gov (United States)

Ionin, Andrey A.; Kozlov, Andrey Yu.; Seleznev, Leonid V.; Sinitsyn, Dmitry V.

2008-10-01

Overtone lasing and fundamental band tuning was for the first time obtained in a slab carbon monoxide laser. The compact slab CO laser with active volume 3×30×250 mm3 was excited by a repetitively pulsed capacitive RF discharge (81.36 MHz) with pulse repetition rate 100-500 Hz. The laser electrodes were cooled down to 120 K. Gas mixture CO:Air:He at gas pressures 15-22 Torr was used. An optical scheme "frequency selective master oscillator - laser amplifier" was applied for getting fundamental band tuning. Single line lasing with average power up to several tens of mW was observed on ~100 rotational-vibrational transitions of CO molecule within the spectral range ~5.0 - 6.5 micron. Multiline overtone lasing was observed on ~80 spectral lines within the spectral range ~2.5 -4.0 micron, with maximum single line average output power 12 mW. Total output power of the slab overtone CO laser came up to 0.3 W, with maximum laser efficiency 0.5%. Results of parametric studies of the overtone CO laser including complicated time behavior for laser pulses on different overtone vibrational-rotational transitions are discussed.

Fabry-Pérot Oscillation and Room Temperature Lasing in Perovskite Cube-Corner Pyramid Cavities

KAUST Repository

Mi, Yang; Liu, Zhixiong; Shang, Qiuyu; Niu, Xinxiang; Shi, Jia; Zhang, Shuai; Chen, Jie; Du, Wenna; Wu, Zhiyong; Wang, Rui; Qiu, Xiaohui; Hu, Xiaoyong; Zhang, Qing; Wu, Tao; Liu, Xinfeng

2018-01-01

Recently, organometal halide perovskite-based optoelectronics, particularly lasers, have attracted intensive attentions because of its outstanding spectral coherence, low threshold, and wideband tunability. In this work, high-quality CH3 NH3 PbBr3 single crystals with a unique shape of cube-corner pyramids are synthesized on mica substrates using chemical vapor deposition method. These micropyramids naturally form cube-corner cavities, which are eminent candidates for small-sized resonators and retroreflectors. The as-grown perovskites show strong emission ≈530 nm in the vertical direction at room temperature. A special Fabry-Pérot (F-P) mode is employed to interpret the light confinement in the cavity. Lasing from the perovskite pyramids is observed from 80 to 200 K, with threshold ranging from ≈92 µJ cm-2 to 2.2 mJ cm-2 , yielding a characteristic temperature of T0 = 35 K. By coating a thin layer of Ag film, the threshold is reduced from ≈92 to 26 µJ cm-2 , which is accompanied by room temperature lasing with a threshold of ≈75 µJ cm-2 . This work advocates the prospect of shape-engineered perovskite crystals toward developing micro-sized optoelectronic devices and potentially investigating light-matter coupling in quantum optics.

Fabry-Pérot Oscillation and Room Temperature Lasing in Perovskite Cube-Corner Pyramid Cavities

KAUST Repository

Mi, Yang

2018-01-10

Recently, organometal halide perovskite-based optoelectronics, particularly lasers, have attracted intensive attentions because of its outstanding spectral coherence, low threshold, and wideband tunability. In this work, high-quality CH3 NH3 PbBr3 single crystals with a unique shape of cube-corner pyramids are synthesized on mica substrates using chemical vapor deposition method. These micropyramids naturally form cube-corner cavities, which are eminent candidates for small-sized resonators and retroreflectors. The as-grown perovskites show strong emission ≈530 nm in the vertical direction at room temperature. A special Fabry-Pérot (F-P) mode is employed to interpret the light confinement in the cavity. Lasing from the perovskite pyramids is observed from 80 to 200 K, with threshold ranging from ≈92 µJ cm-2 to 2.2 mJ cm-2 , yielding a characteristic temperature of T0 = 35 K. By coating a thin layer of Ag film, the threshold is reduced from ≈92 to 26 µJ cm-2 , which is accompanied by room temperature lasing with a threshold of ≈75 µJ cm-2 . This work advocates the prospect of shape-engineered perovskite crystals toward developing micro-sized optoelectronic devices and potentially investigating light-matter coupling in quantum optics.

1887 nm lasing in Tm3+-doped TeO2-BaF2-Y2O3 glass microstructured fibers

Science.gov (United States)

Wang, Shunbin; Yao, Chuanfei; Jia, Zhixu; Qin, Guanshi; Qin, Weiping

2017-04-01

In this paper, we demonstrate ∼2 μm lasing in Tm3+-doped fluorotellurite microstructured fibers. The Tm3+-doped fibers are based on TeO2-BaF2-Y2O3 glasses and fabricated by using a rod-in-tube method. Under the pump of a 1570 nm Er3+-doped fiber laser, lasing at 1887 nm is obtained in a ∼42.5 cm long Tm3+-doped fiber with a threshold pump power of 94 mW. As the pump power increases to 780 mW, the obtained maximum unsaturated power reaches up to ∼408 mW with a slop efficiency of ∼58.1%. This result indicates that the Tm3+-doped fluorotellurite fibers are promising gain media for ∼2 μm fiber lasers.

Effect of modulation p-doping level on multi-state lasing in InAs/InGaAs quantum dot lasers having different external loss

Science.gov (United States)

Korenev, V. V.; Savelyev, A. V.; Maximov, M. V.; Zubov, F. I.; Shernyakov, Yu. M.; Kulagina, M. M.; Zhukov, A. E.

2017-09-01

The influence of the modulation p-doping level on multi-state lasing in InAs/InGaAs quantum dot (QD) lasers is studied experimentally for devices having various external losses. It is shown that in the case of short cavities (high external loss), there is an increase in the lasing power component corresponding to the ground-state optical transitions of QDs as the p-doping level grows. However, in the case of long cavities (small external loss), higher dopant concentrations may have an opposite effect on the output power. Based on these observations, an optimal design of laser geometry and an optimal doping level are discussed.

Modulation doping of quantum dot laser active area and its impact on lasing performance

Science.gov (United States)

Konoplev, S. S.; Savelyev, A. V.; Korenev, V. V.; Maximov, M. V.; Zhukov, A. E.

2015-11-01

We present a theoretical study of modulation doping of active region in the quantum dot (QD) laser and corresponding issues of QD charge neutrality violation, a band diagram of the laser and charge carriers distribution in the structure. Modulation doping is discussed as a possible technique to control laser output characteristics. It was shown that modulation doping leads to an increase of threshold current of lasing through excited QD optical transition together with power emission from QD ground state.

2-micron lasing in Tm:Lu2O3 ceramic: initial operation

Science.gov (United States)

Vetrovec, John; Filgas, David M.; Smith, Carey A.; Copeland, Drew A.; Litt, Amardeep S.; Briscoe, Eldridge; Schirmer, Ernestina

2018-03-01

We report on initial lasing of Tm:Lu2O3 ceramic laser with tunable output in the vicinity of 2 μm. Tm:Lu2O3 ceramic gain materials offer a much lower saturation fluence than the traditionally used Tm:YLF and Tm:YAG materials. The gain element is pumped by 796 nm diodes via a "2-for-1" crossrelaxation energy transfer mechanism, which enables high efficiency. The high thermal conductivity of the Lu2O3 host ( 18% higher than YAG) in combination with low quantum defect of 20% supports operation at high-average power. Konoshima's ceramic fabrication process overcomes the scalability limits of single crystal sesquioxides. Tm:Lu2O3 offers wide-bandwidth amplification of ultrashort pulses in a chirped-pulse amplification (CPA) system. A laser oscillator was continuously tuned over a 230 nm range from 1890 to 2120 nm while delivering up to 43W QCW output with up to 37% efficiency. This device is intended for initial testing and later seeding of a multi-pass edge-pumped disk amplifier now being developed by Aqwest which uses composite Tm:Lu2O3 disk gain elements.

Correlation between enamel morphological and dental pulp physiological outcomes as a function of lasing parameters

Science.gov (United States)

Arcoria, Charles J.; Wagner, Martin J.; Vitasek, Bunny A.

1992-06-01

Previous oral medicine research has insufficiently quantified and correlated laser effects on calcified/soft-tissue combinations. The purpose of this study was to explain lasing effects on outcome variables (pulp response and enamel condition). Vital animal molars were irradiated using several mediums, with predetermined energy densities serving as independent variables. Predetermined safe-tissue thresholds, including pulp/enamel conditions, can be demonstrated to display linear relationships using several laser systems.

Extremely wide lasing bandwidth from InAs/InP quantumdash ridge-waveguide laser near 1.6 μm

KAUST Repository

Khan, Mohammed Zahed Mustafa; Ng, Tien Khee; Lee, Chisen; Bhattacharya, Pallab K.; Ooi, Boon S.

2013-01-01

We demonstrate an ultra-broad lasing bandwidth (-3dB) of > 50 nm utilizing InAs/InGaAlAs/InP quantum-dash ridge-waveguide laser using chirped AlGaInAs barrier layer thickness. Our device exhibits a recorded bandwidth and significant improvement of laser characteristics

Unidirectional, dual-comb lasing under multiple pulse formation mechanisms in a passively mode-locked fiber ring laser

Science.gov (United States)

Liu, Ya; Zhao, Xin; Hu, Guoqing; Li, Cui; Zhao, Bofeng; Zheng, Zheng

2016-09-01

Dual-comb lasers from which asynchronous ultrashort pulses can be simultaneously generated have recently become an interesting research subject. They could be an intriguing alternative to the current dual-laser optical-frequency-comb source with highly sophisticated electronic control systems. If generated through a common light path traveled by all pulses, the common-mode noises between the spectral lines of different pulse trains could be significantly reduced. Therefore, coherent dual-comb generation from a completely common-path, unidirectional lasing cavity would be an interesting territory to explore. In this paper, we demonstrate such a dual-comb lasing scheme based on a nanomaterial saturable absorber with additional pulse narrowing and broadening mechanisms concurrently introduced into a mode-locked fiber laser. The interactions between multiple soliton formation mechanisms result in unusual bifurcation into two-pulse states with quite different characteristics. Simultaneous oscillation of pulses with four-fold difference in pulsewidths and tens of Hz repetition rate difference is observed. The coherence between these spectral-overlapped, picosecond and femtosecond pulses is further verified by the corresponding asynchronous cross-sampling and dual-comb spectroscopy measurements.

Random lasing of microporous surface of Cr2+:ZnSe crystal induced by femtosecond laser

International Nuclear Information System (INIS)

Yang, Xianheng; Feng, Guoying; Yao, Ke; Yi, Jiayu; Zhang, Hong; Zhou, Shouhuan

2015-01-01

We demonstrate a random lasing emission based on microporous surface of Cr 2+ :ZnSe crystal prepared by femtosecond pulsed laser ablation in high vacuum (below 5 × 10 −4 Pa). The scanning electron microscope results show that there are a mass of micropores with an average size of ∼13 μm and smaller ones with ∼1.2 μm on the surface of Cr 2+ :ZnSe crystal. The adjacent micropore spacing of the smaller micropores ranges from 1 μm to 5 μm. Under 1750 nm excitation of Nd:YAG (355 nm) pumped optical parametric oscillator, a random lasing emission with center wavelength of 2350 nm and laser-like threshold of 0.3 mJ/pulse is observed. The emission lifetime of 2350 nm laser reduces from 800 ns to 30 ns as the pump energy increases above threshold. The emission spectra and decay time of smooth surface, groove and microporous surface of Cr 2+ :ZnSe crystal are contrasted. The optional pump wavelength range is from 1500 nm to 1950 nm, which in accordance with the optical absorption property of Cr 2+ :ZnSe crystal. The peak position of excitation spectra is almost identical to the strongest absorption wavelength

Investigation of coronal leakage of root fillings after smear-layer removal with EDTA or Nd:YAG lasing through capillary-flow porometry.

Science.gov (United States)

Michiels, Rafaël; Vergauwen, Tom Edgard Maria; Mavridou, Athina; Meire, Maarten; De Bruyne, Mieke; De Moor, Roeland Jozef Gentil

2010-10-01

This study investigates the effects of Nd:YAG laser irradiation combined with different irrigation protocols on the marginal seal of root fillings. Limited information exists regarding the effects of morphologic changes to root canal (RC) walls after Nd:YAG laser irradiation after smear-layer removal with EDTA on the sealing ability of root fillings. The 75 root-filled teeth (5 × 15 teeth) were analyzed for through-and-through leakage by using capillary flow porometry (CFP). The RC cleaning procedure determined the assignment to a group: (1) irrigation with NaOCl 2.5% and EDTA 17% or standard protocol (SP), (2) SP + Nd:YAG lasing (dried RC), (3) NaOCl 2.5% + Nd:YAG lasing (dried RC), (4) SP + Nd:YAG lasing (wet RC), or (5) NaOCl 2.5% + Nd:YAG lasing (wet RC). Groups 1r to 5r consisted of the same filled teeth with resected apices up to the most apical point of the preparation length. Resection was performed after the first CFP measurement. Roots were filled with cold lateral condensation. CFP was used to assess minimum, mean flow and maximum pore diameters after 48 h, and immediately after these measurements, including root resection. Statistics were performed by using nonparametric tests (p > 0.05). An additional three roots per group were submitted to SEM of the RC wall. Through-and-through leakage was observed in all groups. Statistically significant differences were observed in maximum pore diameter: 1r > 3r, and 1r > 5r; in mean flow pore diameter: 1r > 2r, 2r < 4r (p < 0.05). Typical Nd:YAG glazing effects were observed when the smear layer was present and exposed to the laser fiber (i.e., in the groups without use of EDTA) or when the fiber tip made direct contact with a smear-layer free RC wall. The reduction in through-and-through leakage is significantly higher with the Nd:YAG laser as smear-layer modifier than when smear layer is removed with an EDTA rinsing solution.

Self-cavity lasing in optically pumped single crystals of p-sexiphenyl

International Nuclear Information System (INIS)

Yanagi, Hisao; Tamura, Kenji; Sasaki, Fumio

2016-01-01

Organic single-crystal self-cavities are prepared by solution growth of p-sexiphenyl (p-6P). Based on Fabry-Pérot feedback inside a quasi-lozenge-shaped platelet crystal, edge-emitting laser is obtained under optical pumping. The multimode lasing band appears at the 0-1 or 0-2 vibronic progressions depending on the excitation conditions which affect the self-absorption effect. Cavity-size dependence of amplified spontaneous emission (ASE) is investigated with laser-etched single crystals of p-6P. As the cavity length of square-shaped crystal is reduced from 100 to 10 μm, ASE threshold fluence is decreased probably due to size-dependent light confinement in the crystal cavity.

Modulation doping of quantum dot laser active area and its impact on lasing performance

International Nuclear Information System (INIS)

Konoplev, S S; Savelyev, A V; Korenev, V V; Maximov, M V; Zhukov, A E

2015-01-01

We present a theoretical study of modulation doping of active region in the quantum dot (QD) laser and corresponding issues of QD charge neutrality violation, a band diagram of the laser and charge carriers distribution in the structure. Modulation doping is discussed as a possible technique to control laser output characteristics. It was shown that modulation doping leads to an increase of threshold current of lasing through excited QD optical transition together with power emission from QD ground state. (paper)

Advances in high-power, Ultrashort pulse DPSSL technologies at HiLASE

Czech Academy of Sciences Publication Activity Database

Smrž, Martin; Novák, Ondřej; Mužík, Jiří; Turčičová, Hana; Chyla, Michal; Nagisetty, Siva S.; Vyvlečka, Michal; Roškot, Lukáš; Miura, Taisuke; Černohorská, Jitka; Sikocinski, Pawel; Chen, Liyuan; Huynh, Jaroslav; Severová, Patricie; Pranovich, Alina; Endo, Akira; Mocek, Tomáš

2017-01-01

Roč. 7, č. 10 (2017), s. 1-12, č. článku 1016. ISSN 2076-3417 R&D Projects: GA MŠk LO1602; GA ČR GA16-12960S; GA MŠk LM2015086; GA TA ČR(CZ) TG02010056 EU Projects: European Commission(XE) 739573 Grant - others:OP VVV - HiLASE-CoE(XE) CZ.02.1.01/0.0/0.0/15_006/0000674 Institutional support: RVO:68378271 Keywords : diode-pumped solid- state lasers (DPSSL) * high average power lasers * higher harmonic generation * Yb:YAG * mid-infrared radiation * thin-disk laser * picosecond pulses Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.679, year: 2016

Strong Exciton–Photon Coupling and Lasing Behavior in All-Inorganic CsPbBr3 Micro/Nanowire Fabry-Pérot Cavity

KAUST Repository

Du, Wenna; Zhang, Shuai; Shi, Jia; Chen, Jie; Wu, Zhiyong; Mi, Yang; Liu, Zhixiong; Li, Yuanzheng; Sui, Xinyu; Wang, Rui; Qiu, Xiaohui; Wu, Tao; Xiao, Yunfeng; Zhang, Qing; Liu, Xinfeng

2018-01-01

for their optical application, however, is rarely studied. In this work, we demonstrated the strong coupling of exciton-photon and polariton lasing in high quality CsPbBr micro/nanowires synthesized by a CVD method. By exploring spatial resolved PL spectra of CsPbBr

Lasing and ion beam doping of semiconductor nanowires

Energy Technology Data Exchange (ETDEWEB)

Geburt, Sebastian

2013-01-31

Semiconductor nanowires exhibit extraordinary optical properties like highly localized light emission, efficient waveguiding and light amplification. Even the stimulation of laser oscillations can be achieved at optical pumping, making nanowires promising for optoelectronic applications. For successful integration into future devices, three major key challenges have to be faced: (1) the understanding of the fundamental properties, (2) the modification of the emission characteristics and (3) the investigation of the efficiency-limiting factors. All key challenges are addressed in this thesis: (1) The fundamental properties of CdS nanowire have been investigated to uncover the size limits for photonic nanowire lasers. Laser oscillations were observed at room temperature and the emission characteristics were correlated to the morphology, which allowed the determination of a minimum diameter and length necessary for lasing. (2) The emission characteristics of ZnO nanowires have been successfully modified by ion beam doping with Co. The structural investigations revealed a good recovery of the ion induced damage in the crystal lattice. Optical activation of the implanted Co ions was achieved and an intense intra-3d-emission confirmed successful modification. (3) The temporal decay of excited luminescence centers strongly depends on the interplay of luminescent ions and defects, thus offering an approach to investigate the efficiency-limiting processes. Mn implanted ZnS nanowires were investigated, as the temporal decay of the incorporated Mn ions can be described by a Foerster energy transfer model modified for nanostructures. The defect concentration was varied systematically by several approaches and the model could successfully fit the transients in all cases. The emission properties of Tb implanted ZnS nanowires were investigated and the temporal decay of the intra-4f-emission could also be fitted by the model, proving its accuracy for an additional element.

Lasing and ion beam doping of semiconductor nanowires

International Nuclear Information System (INIS)

Geburt, Sebastian

2013-01-01

Semiconductor nanowires exhibit extraordinary optical properties like highly localized light emission, efficient waveguiding and light amplification. Even the stimulation of laser oscillations can be achieved at optical pumping, making nanowires promising for optoelectronic applications. For successful integration into future devices, three major key challenges have to be faced: (1) the understanding of the fundamental properties, (2) the modification of the emission characteristics and (3) the investigation of the efficiency-limiting factors. All key challenges are addressed in this thesis: (1) The fundamental properties of CdS nanowire have been investigated to uncover the size limits for photonic nanowire lasers. Laser oscillations were observed at room temperature and the emission characteristics were correlated to the morphology, which allowed the determination of a minimum diameter and length necessary for lasing. (2) The emission characteristics of ZnO nanowires have been successfully modified by ion beam doping with Co. The structural investigations revealed a good recovery of the ion induced damage in the crystal lattice. Optical activation of the implanted Co ions was achieved and an intense intra-3d-emission confirmed successful modification. (3) The temporal decay of excited luminescence centers strongly depends on the interplay of luminescent ions and defects, thus offering an approach to investigate the efficiency-limiting processes. Mn implanted ZnS nanowires were investigated, as the temporal decay of the incorporated Mn ions can be described by a Foerster energy transfer model modified for nanostructures. The defect concentration was varied systematically by several approaches and the model could successfully fit the transients in all cases. The emission properties of Tb implanted ZnS nanowires were investigated and the temporal decay of the intra-4f-emission could also be fitted by the model, proving its accuracy for an additional element.

Dynamics of a photorefractive response and competition of nonlinear processes in self-pumping double phase-conjugate mirrors

International Nuclear Information System (INIS)

Mogaddam, Mehran Wahdani; Shuvalov, Vladimir V

2005-01-01

The dynamics of formation of a nonlinear response of a double phase-conjugate (PC) BaTiO 3 mirror is calculated. It is shown that because of competition between processes of different types (related to the presence of several PC channels, the local and nonlocal components of the photorefractive nonlinearity), the transient and dynamic lasing regimes for this mirror can be substantially different. It is found that the development of lasing begins with the successive formation and phasing of dynamic holograms of two different types (two PC channels). It is shown that even under optimal conditions, the lasing regime is not stationary due to competition between processes of different types, and the parameters of output fields fluctuate in time in a nontrivial way (due to the presence of the in-phase and out-of-phase components). Several scenarios of transition to the dynamic chaos are described. (nonlinear optical phenomena)

Random lasing of microporous surface of Cr{sup 2+}:ZnSe crystal induced by femtosecond laser

Energy Technology Data Exchange (ETDEWEB)

Yang, Xianheng; Feng, Guoying, E-mail: guoing-feng@scu.edu.cn, E-mail: zhoush@scu.edu.cn; Yao, Ke; Yi, Jiayu; Zhang, Hong [College of Electronics and Information Engineering, Sichuan University, Chengdu 610065 (China); Zhou, Shouhuan, E-mail: guoing-feng@scu.edu.cn, E-mail: zhoush@scu.edu.cn [College of Electronics and Information Engineering, Sichuan University, Chengdu 610065 (China); North China Research Institute of Electro-Optics, Beijing 100015 (China)

2015-06-15

We demonstrate a random lasing emission based on microporous surface of Cr{sup 2+}:ZnSe crystal prepared by femtosecond pulsed laser ablation in high vacuum (below 5 × 10{sup −4} Pa). The scanning electron microscope results show that there are a mass of micropores with an average size of ∼13 μm and smaller ones with ∼1.2 μm on the surface of Cr{sup 2+}:ZnSe crystal. The adjacent micropore spacing of the smaller micropores ranges from 1 μm to 5 μm. Under 1750 nm excitation of Nd:YAG (355 nm) pumped optical parametric oscillator, a random lasing emission with center wavelength of 2350 nm and laser-like threshold of 0.3 mJ/pulse is observed. The emission lifetime of 2350 nm laser reduces from 800 ns to 30 ns as the pump energy increases above threshold. The emission spectra and decay time of smooth surface, groove and microporous surface of Cr{sup 2+}:ZnSe crystal are contrasted. The optional pump wavelength range is from 1500 nm to 1950 nm, which in accordance with the optical absorption property of Cr{sup 2+}:ZnSe crystal. The peak position of excitation spectra is almost identical to the strongest absorption wavelength.

Tuneabilities of localized electromagnetic modes in random nanostructures for random lasing

Science.gov (United States)

Takeda, S.; Obara, M.

2010-02-01

The modal characteristics of localized electromagnetic waves inside random nanostructures are theoretically presented. It is crucial to know the tuneabilities of the localized modes systematically for demonstrating a specific random lasing application. By use of FDTD (Finite-Difference Time-Domain) method, we investigated the impulse response of two-dimensional random nanostructures consisting of closely packed cylindrical dielectric columns, and precisely analyzed the localized modes. We revealed the tuneability of the frequency of the localized modes by controlling the medium configurations: diameter, spatial density, and refractive index of the cylinders. Furthermore, it is found to be able to tune the Q (quality) factors of the localized modes dramatically by controlling simply the system size of the entire medium. The observed Q factors of approximately 1.6×104 were exhibited in our random disordered structures.

Análise clínica, cirúrgica e laboratorial de pacientes com conjuntivocálase Clinical, surgical and laboratorial analysis of patients with conjunctivochalasis

Directory of Open Access Journals (Sweden)

Carlos Eduardo Borges Souza

2004-08-01

Full Text Available OBJETIVO: Avaliação clínica, cirúrgica e laboratorial de pacientes com conjuntivocálase. MÉTODOS: Foi realizado exame oftalmológico antes e após tratamento cirúrgico em dez pacientes com conjuntivocálase avaliando os seguintes dados: acuidade visual, biomicroscopia do segmento anterior, padrão de coloração pela rosa bengala, teste de Schirmer e citologia de impressão. RESULTADOS: Após a cirurgia todos os pacientes apresentaram melhora na sintomatologia e no padrão de rosa bengala. A citologia de impressão revelou metaplasia escamosa em oito pacientes. CONCLUSÃO: A cirurgia pode ser eficaz na melhora da sintomatologia dos pacientes com conjuntivocálase. Metaplasia escamosa foi achado freqüente nesses pacientes.PURPOSE: To evaluate clinical, surgical and laboratorial findings in patients with conjunctivochalasis. METHODS: Ophthalmologic examinations using 1% rose bengal, Schirmer test and impression cytology were performed in ten patients and after surgery. RESULTS: Sintomatology improved in all patients on surgery. Impression cytology revealed metaplasia in eight patients. CONCLUSION: Surgical treatment may improve signs and symptoms in patients with conjuctivochalasis. Scamous metaplasia was a frequent finding in these patients.

Lasing characteristics of refractive-index-matched composite Y3Al5O12 rods employing transparent ceramics for solar-pumped lasers

Science.gov (United States)

Hasegawa, Kazuo; Ichikawa, Tadashi; Takeda, Yasuhiko; Ikesue, Akio; Ito, Hiroshi; Motohiro, Tomoyoshi

2018-04-01

We have proposed a new configuration of solar-pumped lasers employing transparent ceramic rods. The laser rod has a composite structure consisting of a Nd/Cr:YAG gain domain surrounded by Gd:YAG with the same refractive index as that of Nd/Cr:YAG. The lasing mode is well controlled by the output coupler, and the parasitic oscillation is suppressed, owing to the refractive index matching. A high laser slope efficiency and a low laser oscillation threshold were achieved owing to the suppressed absorption outside the lasing mode, which was previously a serious issue for the end-pumping configuration using a high-NA focusing optics. The laser oscillation threshold of 136 mW and the slope efficiency of 25.3% were derived. Thus, we have resolved the issue of useless absorption associated with the high-NA end-pumping, and achieved significant improvements compared with the conventional structure of uniform Nd/Cr:YAG.

Strong coupling and polariton lasing in Te based microcavities embedding (Cd,Zn)Te quantum wells

Energy Technology Data Exchange (ETDEWEB)

Rousset, J.-G., E-mail: j-g.rousset@fuw.edu.pl; Piętka, B.; Król, M.; Mirek, R.; Lekenta, K.; Szczytko, J.; Borysiuk, J.; Suffczyński, J.; Kazimierczuk, T.; Goryca, M.; Smoleński, T.; Kossacki, P.; Nawrocki, M.; Pacuski, W. [Institute of Experimental Physics, Faculty of Physics, University of Warsaw, ul. Pasteura 5, PL-02-093 Warszawa (Poland)

2015-11-16

We report on properties of an optical microcavity based on (Cd,Zn,Mg)Te layers and embedding (Cd,Zn)Te quantum wells. The key point of the structure design is the lattice matching of the whole structure to MgTe, which eliminates the internal strain and allows one to embed an arbitrary number of unstrained quantum wells in the microcavity. We evidence the strong light-matter coupling regime already for the structure containing a single quantum well. Embedding four unstrained quantum wells results in further enhancement of the exciton-photon coupling and the polariton lasing in the strong coupling regime.

Anomalous dependence of the lasing parameters of dye solutions on the spectrum of microsecond pump laser pulses

International Nuclear Information System (INIS)

Tarkovsky, V V; Kurstak, V Yu; Anufrik, S S

2003-01-01

The anomalous dependence of the lasing parameters of ethanol solutions of coumarin, rhodamine, oxazine, and laser dyes of other classes on the spectrum of microsecond pump laser pulses is found. The dependence is determined by the shape of the induced singlet - singlet absorption spectra and absorption spectra of short-lived photoproducts. The elucidation of the influence of these factors makes it possible to choose optimal pump spectra and to enhance the efficiency and stability of microsecond dye lasers. (active media)

Efficiency enhancement of a harmonic lasing free-electron laser

International Nuclear Information System (INIS)

Salehi, E.; Maraghechi, B.; Mirian, N. S.

2015-01-01

The harmonic lasing free-electron laser amplifier, in which two wigglers is employed in order for the fundamental resonance of the second wiggler to coincide with the third harmonic of the first wiggler to generate ultraviolet radiation, is studied. A set of coupled nonlinear first-order differential equations describing the nonlinear evolution of the system, for a long electron bunch, is solved numerically by CYRUS code. Solutions for the non-averaged and averaged equations are compared. Remarkable agreement is found between the averaged and non-averaged simulations for the evolution of the third harmonic. Thermal effects in the form of longitudinal velocity spread are also investigated. For efficiency enhancement, the second wiggler field is set to decrease linearly and nonlinearly at the point where the radiation of the third harmonic saturates. The optimum starting point and the slope of the tapering of the amplitude of the wiggler are found by a successive run of the code. It is found that tapering can increase the saturated power of the third harmonic considerably. In order to reduce the length of the wiggler, the prebunched electron beam is considered

Efficiency enhancement of a harmonic lasing free-electron laser

Science.gov (United States)

Salehi, E.; Maraghechi, B.; Mirian, N. S.

2015-03-01

The harmonic lasing free-electron laser amplifier, in which two wigglers is employed in order for the fundamental resonance of the second wiggler to coincide with the third harmonic of the first wiggler to generate ultraviolet radiation, is studied. A set of coupled nonlinear first-order differential equations describing the nonlinear evolution of the system, for a long electron bunch, is solved numerically by CYRUS code. Solutions for the non-averaged and averaged equations are compared. Remarkable agreement is found between the averaged and non-averaged simulations for the evolution of the third harmonic. Thermal effects in the form of longitudinal velocity spread are also investigated. For efficiency enhancement, the second wiggler field is set to decrease linearly and nonlinearly at the point where the radiation of the third harmonic saturates. The optimum starting point and the slope of the tapering of the amplitude of the wiggler are found by a successive run of the code. It is found that tapering can increase the saturated power of the third harmonic considerably. In order to reduce the length of the wiggler, the prebunched electron beam is considered.

First lasing of the Darmstadt cw free electron laser

CERN Document Server

Brunken, M; Eichhorn, R; Genz, H; Gräf, H D; Loos, H; Richter, A; Schweizer, B; Stascheck, A; Wesp, T

1999-01-01

The Darmstadt CW FEL designed for wavelengths between 3 and 10 mu m driven by the superconducting electron accelerator S-DALINAC first lased on December 1st, 1996 and has operated thereafter successfully in the wavelength region between 6.6 and 7.8 mu m. The pulsed electron beam employed had a micro pulse length of about 2ps, with a repetition rate of 10 MHz and a peak current of 2.7 A while its energy was varied between 29.6 and 31.5 MeV. A wedged pole hybrid undulator, with 80 periods each of 0.032 m length and a magnetic field strength of 0.15-0.4T, was located in between a 15.01 m long optical cavity equipped with two high reflectivity (99.8) mirrors of 0.05 m diameter. Due to the low beam current special care with respect to the electron and optical beam properties was necessary to meet the stringent conditions in order to reach a minute small signal gain of at least a few percent resulting in amplification. Saturation was obtained after about 2000 repetitions of the photon pulse inside the cavity. The D...

Efficiency enhancement of a harmonic lasing free-electron laser

Energy Technology Data Exchange (ETDEWEB)

Salehi, E.; Maraghechi, B., E-mail: behrouz@aut.ac.ir [Department of Physics, Amirkabir University of Technology, 15875-4413 Tehran (Iran, Islamic Republic of); Mirian, N. S. [School of Particle and Accelerator Physics, Institute for Research in Fundamental Sciences (IPM), 19395-5531 Tehran (Iran, Islamic Republic of)

2015-03-15

The harmonic lasing free-electron laser amplifier, in which two wigglers is employed in order for the fundamental resonance of the second wiggler to coincide with the third harmonic of the first wiggler to generate ultraviolet radiation, is studied. A set of coupled nonlinear first-order differential equations describing the nonlinear evolution of the system, for a long electron bunch, is solved numerically by CYRUS code. Solutions for the non-averaged and averaged equations are compared. Remarkable agreement is found between the averaged and non-averaged simulations for the evolution of the third harmonic. Thermal effects in the form of longitudinal velocity spread are also investigated. For efficiency enhancement, the second wiggler field is set to decrease linearly and nonlinearly at the point where the radiation of the third harmonic saturates. The optimum starting point and the slope of the tapering of the amplitude of the wiggler are found by a successive run of the code. It is found that tapering can increase the saturated power of the third harmonic considerably. In order to reduce the length of the wiggler, the prebunched electron beam is considered.

Super low threshold plasmonic WGM lasing from an individual ZnO hexagonal microrod on an Au substrate for plasmon lasers.

Science.gov (United States)

Dong, H M; Yang, Y H; Yang, G W

2015-03-05

We demonstrate an individual ZnO hexagonal microrod on the surface of an Au substrate which can become new sources for manufacturing miniature ZnO plasmon lasers by surface plasmon polariton coupling to whispering-gallery modes (WGMs). We also demonstrate that the rough surface of Au substrates can acquire a more satisfied enhancement of ZnO emission if the surface geometry of Au substrates is appropriate. Furthermore, we achieve high Q factor and super low threshold plasmonic WGM lasing from an individual ZnO hexagonal microrod on the surface of the Au substrate, in which Q factor can reach 5790 and threshold is 0.45 KW/cm(2) which is the lowest value reported to date for ZnO nanostructures lasing, at least 10 times smaller than that of ZnO at the nanometer. Electron transfer mechanisms are proposed to understand the physical origin of quenching and enhancement of ZnO emission on the surface of Au substrates. These investigations show that this novel coupling mode holds a great potential of ZnO hexagonal micro- and nanorods for data storage, bio-sensing, optical communications as well as all-optic integrated circuits.

Stimulated emission and lasing from all-inorganic perovskite quantum dots

Science.gov (United States)

Sun, Handong; Wang, Yue; Li, Xiaoming; Haibo, Zeng

We present superior optical gain and lasing properties in a new class of emerging quantum materials, the colloidal all-inorganic cesium lead halide perovskite quantum dots (IPQDs) (CsPbX3, X = Cl, Br, I). Our result has indicated that such material system show combined merits of both colloidal quantum dots and halide perovskites. Low-threshold and ultrastable stimulated emission was demonstrated under atmospheric condition. The flexibility and advantageous optical gain properties of these CsPbX3 IPQDs were manifested by demonstration of an optically pumped micro-laser. The nonlinear optical properties including the multi-photon absorption and resultant photoluminescence of the CsPbX3 nanocrystals were investigated. A large two-photon absorption cross-section of up to ~1.2×105 GM is determined from 9 nm-sized CsPbBr3 nanocrystals. Moreover, low-threshold frequency-upconverted stimulated emission by two-photon absorption was observed from the thin films of close-packed CsPbBr3 nanocrystals. We further realize the three-photon pumped stimulated emission in green spectra range from colloidal IPQD.

Measurements of line overlap for resonant spoiling of x-ray lasing transitions

International Nuclear Information System (INIS)

Beiersdorfer, P.; Elliott, S.R.; MacGowan, B.J.; Nilsen, J.

1994-06-01

High-precision measurements are presented of candidate line pairs for resonant spoiling of x-ray lasing transitions in the nickel-like W 46+ , the neon-like Fe 16+ , and the neon-like La 47+ x-ray lasers. Our measurements were carried out with high-resolution crystal spectrometers, and a typical precision of 20--50 ppM was achieved. While most resonances appear insufficient for effective photo-spoiling, two resonance pairs are identified that provide a good overlap. These are the 4p 1/2 → 3d 3/2 transition in nickel-like W 46+ with the 2p 3/2 → 1s 1/2 transition in hydrogenic Al 12+ , and the 3s 1/2 → 2p 3/2 transition in neon-like La 47+ with the 1 1 S 0 -2 1 P 1 line in heliumlike Ti 20+

Ground state depletion – A step towards mid-IR lasing of doped silver halides

Energy Technology Data Exchange (ETDEWEB)

Tsur, Yuval, E-mail: yuvaltsu@post.tau.ac.il [Raymond and Beverly Sackler Faculty of Exact Sciences, Tel-Aviv University, Tel-Aviv 6997801 (Israel); Goldring, Sharone [Applied Physics Division, Soreq NRC, Yavne 81800 (Israel); Galun, Ehud [DDR& D, Ministry of Defense (Israel); Katzir, Abraham [Raymond and Beverly Sackler Faculty of Exact Sciences, Tel-Aviv University, Tel-Aviv 6997801 (Israel)

2016-07-15

We show for the first time ground state absorption saturation in a doped silver halide crystal (AgCl{sub x}Br{sub 1−x}), specifically with cobalt. Spectroscopic studies showed absorption bands in the 1.4–2.5 μm region and emission bands in the 3.8–5.0 μm region, with a 1.5 ms lifetime at low temperatures. Absorption saturation indicates a good low and room temperature lasing feasibility at 4.1 μm. In addition, a comparison of cobalt, nickel and iron as dopants is presented. These doped silver halide crystals can be extruded to form optical fibers, possibly introducing a new family of fiber lasers for the middle infrared.

NicoLase-An open-source diode laser combiner, fiber launch, and sequencing controller for fluorescence microscopy.

Directory of Open Access Journals (Sweden)

Philip R Nicovich

Full Text Available Modern fluorescence microscopy requires software-controlled illumination sources with high power across a wide range of wavelengths. Diode lasers meet the power requirements and combining multiple units into a single fiber launch expands their capability across the required spectral range. We present the NicoLase, an open-source diode laser combiner, fiber launch, and software sequence controller for fluorescence microscopy and super-resolution microscopy applications. Two configurations are described, giving four or six output wavelengths and one or two single-mode fiber outputs, with all CAD files, machinist drawings, and controller source code openly available.

Effect of the background radiation of a copper vapor laser with an unstable resonator on dye lasing

Energy Technology Data Exchange (ETDEWEB)

Elaev, V F; Mirza, S M; Sukhanov, V B; Troitskii, V O; Soldatov, A N

1986-05-01

Results of an experimental study of the emission divergence of a copper vapor laser with an unstable resonator are reported. It is shown that a copper vapor laser beam can be conveniently treated as a pair of components with a divergence higher or lower than a certain optimal value; the percent ratio of the components varies with the pulse repetition frequency. In the case where a copper vapor laser is used to pump a dye laser, the contribution of the component with the higher divergence to dye lasing does not exceed 1 percent. 7 references.

Conditions for soft x-ray lasing action in a confined plasma column

International Nuclear Information System (INIS)

Suckewer, S.; Fishman, H.

1979-09-01

The idea of using a multi-Z (e.g., carbon, oxygen) thin plasma column as a medium for soft x-ray lasing action is presented. A plasma confined by a strong magnetic field is first heated by a CO 2 -laser, and then cools rapidly by radiation losses. This leads to a level population inversion of hydrogen-like carbon or oxygen ions. Two computational models are presented. One uses given electron temperature, T/sub e/(t), evolutions. The other uses T/sub e/(t) calculated from an energy balance equation ith CO 2 -laser beam power as a parameter. According to calculations, a total gain of G > 100 is expected for 3 → 2 and G > 10 for 4 → 2 transitions (lambda = 182 A and lambda = 135 A, respectively) for CVI ions using a CO 2 -laser beam with power approx. 5 x 10 10 W for plasma column heating

Comparison of DLK incidence after laser in situ keratomileusis associated with two femtosecond lasers: Femto LDV and IntraLase FS60

Directory of Open Access Journals (Sweden)

Tomita M

2013-07-01

Full Text Available Minoru Tomita,1–3 Yuko Sotoyama,1 Satoshi Yukawa,1 Tadayuki Nakamura1 1Shinagawa LASIK Center, Chiyoda-ku, Tokyo, Japan; 2Department of Ophthalmology, Wenzhou Medical College, Wenzhou, People’s Republic of China; 3Eye Can Cataract Surgery Center, Manila, Philippines Purpose: To compare the incidence of diffuse lamellar keratitis (DLK after laser in situ keratomileusis (LASIK with flap creation using the Femto LDV and IntraLase™ FS60 femtosecond lasers. Methods: A total of 818 consecutive myopic eyes had LASIK performed using either Femto LDV or IntraLase FS60 for flap creation. The same excimer laser, the Allegretto Wave® Eye-Q Laser, was used for correcting refractive errors for all patients. In the preoperative examination, uncorrected distance visual acuity, corrected distance visual acuity, and manifest refraction spherical equivalent were measured. At the postop examination, the same examinations were performed along with a slit-lamp biomicroscopic examination, and patients with DLK were classified into stages. For the statistical analysis of the DLK occurrence rate and the visual and refractive outcomes, the Mann-Whitney’s U-test was used. Results: In the Femto LDV group with 514 eyes, 42 (8.17% had DLK. In the IntraLase FS60 group with 304 eyes, 114 (37.5% had DLK. There was a statistically significant difference in the DLK incidence rate between these groups (P < 0.0001. Both groups had excellent visual and refractive outcomes. Although low levels of DLK were observed for both groups, they did not affect visual acuity. Conclusion: While there were significantly fewer incidences of low level DLK when using Femto LDV, neither femtosecond laser induced high levels of DLK, and any postoperative DLK cleared up within 1 week. Therefore, both lasers provide excellent results, with no clinical differences, and both excel at flap creation for LASIK. Keywords: LASIK, Ziemer, Femto LDV, DLK, IntraLase FS60, femtosecond laser

Lasing from the domain of collision of ionisation waves produced due to electric field concentration at electrodes with a small radius of curvature

International Nuclear Information System (INIS)

Tarasenko, Viktor F; Tel'minov, A E; Burachenko, A G; Rybka, D V; Baksht, E Kh; Lomaev, Mikhail I; Panchenko, Aleksei N; Vil'tovskii, P O

2011-01-01

The characteristics of UV lasing in nitrogen and of diffusive discharge produced without an additional ionisation source were experimentally investigated in a nonuniform electric field formed by electrodes with different profiles. High-voltage nanosecond pulses were applied to the blade- and cylinder-shaped electrodes. It was determined that the gap breakdown at elevated pressure was caused by diffusive jets which propagate from the electrodes with a small radius of curvature. The electric field increased in the intersection of counter-propagating jets, with the effect that the threshold of lasing in the C 3 Π u - B 3 Π g (λ = 337.1 nm) molecular nitrogen band was attained for low average electric fields (below 60 V cm -1 Torr -1 ) and at pressures of 760 Torr and above. With lowering the pressure from 760 to 20 Torr, the voltage of gap breakdown in the nonuniform electric field was observed to increase for a voltage pulse rise time of ∼300 ps and to decrease for a pulse rise time of ∼2 ns.

Parasitic lasing suppression in large-aperture Ti:sapphire amplifiers by optimizing the seed–pump time delay

International Nuclear Information System (INIS)

Chu, Y X; Liang, X Y; Yu, L H; Xu, L; Lu, X M; Liu, Y Q; Leng, Y X; Li, R X; Xu, Z Z

2013-01-01

Theoretical and experimental investigations are carried out to determine the influence of the time delay between the input seed pulse and pump pulses on transverse parasitic lasing in a Ti:sapphire amplifier with a diameter of 80 mm, which is clad by a refractive index-matched liquid doped with an absorber. When the time delay is optimized, a maximum output energy of 50.8 J is achieved at a pump energy of 105 J, which corresponds to a conversion efficiency of 47.5%. Based on the existing compressor, the laser system achieves a peak power of 1.26 PW with a 29.0 fs pulse duration. (letter)

Design of all-optical memory cell using EIT and lasing without inversion phenomena in optical micro ring resonators

Science.gov (United States)

Pasyar, N.; Yadipour, R.; Baghban, H.

2017-07-01

The proposed design of the optical memory unit cell contains dual micro ring resonators in which the effect of lasing without inversion (LWI) in three-level nano particles doped over the optical resonators or integrators as the gain segment is used for loss compensation. Also, an on/off phase shifter based on electromagnetically induced transparency (EIT) in three-level quantum dots (QDs) has been used for data reading at requested time. Device minimizing for integrated purposes and high speed data storage are the main advantages of the optical integrator based memory.

Enhancement of soft X-ray lasing action with thin blade radiators

Science.gov (United States)

Suckewer, Szymon; Skinner, Charles H.; Voorhees, David R.

1988-01-01

An enhancement of approximately 100 of stimulated emission over spontaneous emission of the CVI 182 Angstrom line was obtained in a recombining magnetically confined plasma column. The plasma was formed by focusing a CO.sub.2 laser beam on a carbon disc. A magnetic solenoid produced a strong magnetic field which confined the plasma to the shape of a column. A single thin carbon blade extended parallel to the plasma column and served to make the column axially more uniform and also acted as a heat sink. Axial and transverse measurements of the soft X-ray lasing action were made from locations off-set from the central axis of the plasma column. Multiple carbon blades located at equal intervals around the plasma column were also found to produce acceptable results. According to another embodiment 10 a thin coating of aluminum or magnesium was placed on the carbon disc and blade. The Z of the coating should preferably be at least 5 greater than the Z of the target. Measurements of the soft X-rays generated at 182 Angstroms showed a significant increase in intensity enhancement.

Photoluminescence and lasing properties of MAPbBr3 single crystals grown from solution

Science.gov (United States)

Aryal, Sandip; Lafalce, Evan; Zhang, Chuang; Zhai, Yaxin; Vardeny, Z. Valy

Recent studies of solution-grown single crystals of inorganic-organic hybrid lead-trihalide perovskites have suggested that surface traps may play a significant role in their photophysics. We study electron-hole recombination in single crystal MAPbBr3 through such trap states using cw photoluminescence (PL) and ps transient photoinduced absorption (PA) spectroscopies. By varying the depth of the collecting optics we examined the contributions from surface and bulk radiative recombination. We found a surface dominated PL band at the band-edge that is similar to that observed from polycrystalline thin films, as well as a weaker red-shifted emission band that originates from the bulk crystal. The two PL bands are distinguished in their temperature, excitation intensity and polarization dependencies, as well as their ps dynamics. Additionally, amplified spontaneous emission and crystal-related cavity lasing modes were observed in the same spectral range as the PL band assigned to the surface recombination. This work was funded by AFOSR through MURI Grant RA 9550-14-1-0037.

Percolation and lasing in real 3D crystals with inhomogeneous distributed random pores

Energy Technology Data Exchange (ETDEWEB)

Burlak, Gennadiy, E-mail: gburlak@uaem.mx; Calderón-Segura, Yessica

2014-11-15

We systematically study the percolation phase transition in real 3D crystals where not only the state of pores but also their radius r and displacement s are random valued numbers. The mean values R=〈r〉 and S=〈s〉 emerge as additional spatial scales in such an extended network. This leads to variations of the threshold (critical) percolation probability p{sub C} and the percolation order parameter P that become to be the intricate functions of R and S. Our numerical simulations have shown that in such extended system the incipient spanning cluster can arise even for situations where for simple periodical system the percolation does not exist. We analyzed the validity of the nearest neighbor's approximation and found that such approximation is not valid for materials with large dispersivity of pores. The lasing of nanoemitters incorporated in such percolating spanning cluster is studied too. This effect can open interesting perspectives in modern nano- and micro-information technologies.

Optical lattice-like cladding waveguides by direct laser writing: fabrication, luminescence, and lasing.

Science.gov (United States)

Nie, Weijie; He, Ruiyun; Cheng, Chen; Rocha, Uéslen; Rodríguez Vázquez de Aldana, Javier; Jaque, Daniel; Chen, Feng

2016-05-15

We report on the fabrication of optical lattice-like waveguide structures in an Nd:YAP laser crystal by using direct femtosecond laser writing. With periodically arrayed laser-induced tracks, the waveguiding cores can be located in either the regions between the neighbored tracks or the central zone surrounded by a number of tracks as outer cladding. The polarization of the femtosecond laser pulses for the inscription has been found to play a critical role in the anisotropic guiding behaviors of the structures. The confocal photoluminescence investigations reveal different stress-induced modifications of the structures inscribed by different polarization of the femtosecond laser beam, which are considered to be responsible for the refractive index changes of the structures. Under optical pump at 808 nm, efficient waveguide lasing at ∼1  μm wavelength has been realized from the optical lattice-like structure, which exhibits potential applications as novel miniature light sources.

Pump spot size dependent lasing threshold in organic semiconductor DFB lasers fabricated via nanograting transfer.

Science.gov (United States)

Liu, Xin; Klinkhammer, Sönke; Wang, Ziyao; Wienhold, Tobias; Vannahme, Christoph; Jakobs, Peter-Jürgen; Bacher, Andreas; Muslija, Alban; Mappes, Timo; Lemmer, Uli

2013-11-18

Optically excited organic semiconductor distributed feedback (DFB) lasers enable efficient lasing in the visible spectrum. Here, we report on the rapid and parallel fabrication of DFB lasers via transferring a nanograting structure from a flexible mold onto an unstructured film of the organic gain material. This geometrically well-defined structure allows for a systematic investigation of the laser threshold behavior. The laser thresholds for these devices show a strong dependence on the pump spot diameter. This experimental finding is in good qualitative agreement with calculations based on coupled-wave theory. With further investigations on various DFB laser geometries prepared by different routes and based on different organic gain materials, we found that these findings are quite general. This is important for the comparison of threshold values of various devices characterized under different excitation areas.

Pump spot size dependent lasing threshold in organic semiconductor DFB lasers fabricated via nanograting transfer

DEFF Research Database (Denmark)

Liu, Xin; Klinkhammer, Sönke; Wang, Ziyao

2013-01-01

material. This geometrically well-defined structure allows for a systematic investigation of the laser threshold behavior. The laser thresholds for these devices show a strong dependence on the pump spot diameter. This experimental finding is in good qualitative agreement with calculations based on coupled......Optically excited organic semiconductor distributed feedback (DFB) lasers enable efficient lasing in the visible spectrum. Here, we report on the rapid and parallel fabrication of DFB lasers via transferring a nanograting structure from a flexible mold onto an unstructured film of the organic gain......-wave theory. With further investigations on various DFB laser geometries prepared by different routes and based on different organic gain materials, we found that these findings are quite general. This is important for the comparison of threshold values of various devices characterized under different...

Vib--rotational energy distributions and relaxation processes in pulsed HF chemical lasers

International Nuclear Information System (INIS)

Ben-Shaul, A.; Kompa, K.L.; Schmailzl, U.

1976-01-01

The rate equations governing the temporal evolution of photon densities and level populations in pulsed F+H 2 →HF+H chemical lasers are solved for different initial conditions. The rate equations are solved simultaneously for all relevant vibrational--rotational levels and vibrational--rotational P-branch transitions. Rotational equilibrium is not assumed. Approximate expressions for the detailed state-to-state rate constants corresponding to the various energy transfer processes (V--V, V--R,T, R--R,T) coupling the vib--rotational levels are formulated on the basis of experimental data, approximate theories, and qualitative considerations. The main findings are as follows: At low pressures, R--T transfer cannot compete with the stimulated emission, and the laser output largely reflects the nonequilibrium energy distribution in the pumping reaction. The various transitions reach threshold and decay almost independently and simultaneous lasing on several lines takes place. When a buffer gas is added in excess to the reacting mixture, the enhanced rotational relaxation leads to nearly single-line operation and to the J shift in lasing. Laser efficiency is higher at high inert gas pressures owing to a better extraction of the internal energy from partially inverted populations. V--V exchange enhances lasing from upper vibrational levels but reduces the total pulse intensity. V--R,T processes reduce the efficiency but do not substantially modify the spectral output distribution. The photon yield ranges between 0.4 and 1.4 photons/HF molecule depending on the initial conditions. Comparison with experimental data, when available, is fair

All-optical loadable and erasable memory cell design based on inversionless lasing and electromagnetically induced transparency effects

International Nuclear Information System (INIS)

Gholipour Verki, N; HajiBadali, A; Abbasian, K; Rostami, A

2011-01-01

A loadable and erasable all-optical memory cell is designed by using two coupled micro-ring resonators with electromagnetically induced transparency (EIT) and lasing without inversion (LWI). To read out stored data, an additional phase is introduced in the upper ring resonator due to EIT. To compensate the fibre loss, use is made of LWI. The EIT is induced by inserting Λ-type three level quantum dots in the right-hand half of the upper ring and LWI is implemented by inserted Y-type four level quantum dots in the left-hand half of both rings. This optical memory cell can operate at a low light power level corresponding to several photons.

First lasing of the KAERI millimeter-wave free electron laser

Energy Technology Data Exchange (ETDEWEB)

Lee, B.C.; Jeong, Y.U.; Cho, S.O. [Korea Atomic Energy Research Institute, Taejon (Korea, Democratic People`s Republic of)] [and others

1995-12-31

The millimeter-wave FEL program at KAERI aims at the generation of high-power CW laser beam with high efficiency at the wavelength of 3{approximately}10 mm for the application in plasma heating and in power beaming. In the first oscillation experiment, the FEL has lased at the wavelength of 10 mm with the pulsewidth of 10{approximately}30 {mu}s. The peak power is about 1 kW The FEL is driven by a recirculating electrostatic accelerator having tandem geometry. The energy and the current of the electron beam are 400 keV and 2 A, respectively. The FEL resonator is located in the high-voltage terminal and is composed of a helical undulator, two mesh mirrors, and a cylindrical waveguide. The parameters of the permanent-magnet helical undulator are : period = 32 mm, number of periods = 20, magnetic field = 1.3 kG. At present, with no axial guiding magnetic field only 15 % of the injected beam pass through the undulator. Transport ratio of the electron beam through the undulator is very sensitive to the injection parameters such as the diameter and the divergence of the electron beam Simulations show that, with unproved injection condition, the FEL can generate more than 50 kW of average power in CW operation. Details of the experiments, including the spectrum measurement and the recirculation of electron beam, are presented.

Competitive behavior of photons contributing to junction voltage jump in narrow band-gap semiconductor multi-quantum-well laser diodes at lasing threshold

Energy Technology Data Exchange (ETDEWEB)

Feng, Liefeng, E-mail: fengliefeng@tju.edu.cn, E-mail: lihongru@nankai.edu.cn; Yang, Xiufang; Wang, Cunda; Yao, Dongsheng [Tianjin Key Laboratory of Low Dimensional Materials Physics and Preparing Technology, Faculty of Science, Tianjin University, Tianjin 300072 (China); Li, Yang [Business and Vocational College of Hainan, Haikou 570203 (China); Li, Ding; Hu, Xiaodong [Research Center for Wide Band Gap Semiconductors, State Key Laboratory for Artificial Microstructure and Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China); Li, Hongru, E-mail: fengliefeng@tju.edu.cn, E-mail: lihongru@nankai.edu.cn [State Key Laboratory for Medicinal Chemistry and Biology, College of Pharmacy, Nankai University, Tianjin 300071 (China)

2015-04-15

The junction behavior of different narrow band-gap multi-quantum-well (MQW) laser diodes (LDs) confirmed that the jump in the junction voltage in the threshold region is a general characteristic of narrow band-gap LDs. The relative change in the 1310 nm LD is the most obvious. To analyze this sudden voltage change, the threshold region is divided into three stages by I{sub th}{sup l} and I{sub th}{sup u}, as shown in Fig. 2; I{sub th}{sup l} is the conventional threshold, and as long as the current is higher than this threshold, lasing exists and the IdV/dI-I plot drops suddenly; I{sub th}{sup u} is the steady lasing point, at which the separation of the quasi-Fermi levels of electron and holes across the active region (V{sub j}) is suddenly pinned. Based on the evolutionary model of dissipative structure theory, the rate equations of the photons in a single-mode LD were deduced in detail at I{sub th}{sup l} and I{sub th}{sup u}. The results proved that the observed behavior of stimulated emission suddenly substituting for spontaneous emission, in a manner similar to biological evolution, must lead to a sudden increase in the injection carriers in the threshold region, which then causes the sudden increase in the junction voltage in this region.

Competitive behavior of photons contributing to junction voltage jump in narrow band-gap semiconductor multi-quantum-well laser diodes at lasing threshold

International Nuclear Information System (INIS)

Feng, Liefeng; Yang, Xiufang; Wang, Cunda; Yao, Dongsheng; Li, Yang; Li, Ding; Hu, Xiaodong; Li, Hongru

2015-01-01

The junction behavior of different narrow band-gap multi-quantum-well (MQW) laser diodes (LDs) confirmed that the jump in the junction voltage in the threshold region is a general characteristic of narrow band-gap LDs. The relative change in the 1310 nm LD is the most obvious. To analyze this sudden voltage change, the threshold region is divided into three stages by I th l and I th u , as shown in Fig. 2; I th l is the conventional threshold, and as long as the current is higher than this threshold, lasing exists and the IdV/dI-I plot drops suddenly; I th u is the steady lasing point, at which the separation of the quasi-Fermi levels of electron and holes across the active region (V j ) is suddenly pinned. Based on the evolutionary model of dissipative structure theory, the rate equations of the photons in a single-mode LD were deduced in detail at I th l and I th u . The results proved that the observed behavior of stimulated emission suddenly substituting for spontaneous emission, in a manner similar to biological evolution, must lead to a sudden increase in the injection carriers in the threshold region, which then causes the sudden increase in the junction voltage in this region

Low-Threshold Lasing from 2D Homologous Organic-Inorganic Hybrid Ruddlesden-Popper Perovskite Single Crystals.

Science.gov (United States)

Raghavan, Chinnambedu Murugesan; Chen, Tzu-Pei; Li, Shao-Sian; Chen, Wei-Liang; Lo, Chao-Yuan; Liao, Yu-Ming; Haider, Golam; Lin, Cheng-Chieh; Chen, Chia-Chun; Sankar, Raman; Chang, Yu-Ming; Chou, Fang-Cheng; Chen, Chun-Wei

2018-05-09

Organic-inorganic hybrid two-dimensional (2D) perovskites have recently attracted great attention in optical and optoelectronic applications due to their inherent natural quantum-well structure. We report the growth of high-quality millimeter-sized single crystals belonging to homologous two-dimensional (2D) hybrid organic-inorganic Ruddelsden-Popper perovskites (RPPs) of (BA) 2 (MA) n-1 Pb n I 3 n+1 ( n = 1, 2, and 3) by a slow evaporation at a constant-temperature (SECT) solution-growth strategy. The as-grown 2D hybrid perovskite single crystals exhibit excellent crystallinity, phase purity, and spectral uniformity. Low-threshold lasing behaviors with different emission wavelengths at room temperature have been observed from the homologous 2D hybrid RPP single crystals. Our result demonstrates that solution-growth homologous organic-inorganic hybrid 2D perovskite single crystals open up a new window as a promising candidate for optical gain media.

The Effect of an Instructional Intervention on Enhancement Pre-Service Science Teachers' Science Processes Skills

Science.gov (United States)

Durmaz, Hüsnüye

2016-01-01

The aim of this study is to investigate the effects of an instructional intervention on enhancement the pre-service science teachers' (PSTs) science process skills (SPSs) and to identify problems in using SPSs through Laboratory Applications in Science Education-I course (LASE-I). One group pretest-posttest pre-experimental design was employed. An…

Microscopic study on lasing characteristics of the UVSOR storage ring free electron laser

Energy Technology Data Exchange (ETDEWEB)

Hama, H. [Institute for Molecular Science, Okazaki (Japan)]|[Graduate Univ. for Advanced Stuides, Okazaki (Japan); Yamazaki, J.; Kinoshita, T. [Institute for Molecular Science, Okazaki (Japan)] [and others

1995-12-31

Characteristics of storage ring free electron laser (SRFEL) at a short wavelength region (UV and visible) has been studied at the UVSOR facility, Institute for Molecular Science. We have measured the laser power evolution by using a biplanar photodiode, and the micro-macro temporal structure of both the laser and the electron bunch with a dualsweep streak camera. The saturated energy of the laser micropulse in the gain-switching (Q-switching) mode has been measured as a function of the ring current. We have not observed a limitation of the output power yet within the beam current can be stored. We have analyzed the saturated micropulse energy based on a model of gain reduction due to the bunch-heating. The bunch-heating process seems to be very complicate. We derived time dependent gain variations from the shape of macropulse and the bunch length. Those two gain variations are almost consistent with each other but slightly different in detail. The gain may be not only simply reduced by the energy spread but also affected by the phase space rotation due to synchrotron oscillation of the electron bunch. As reported in previous issue, the lasing macropulse consists of a couple of micropulses that are simultaneously evolved. From high resolution two-dimensional spectra taken by the dual-sweep streak camera, we noticed considerable internal substructures of the laser micropulse in both the time distribution and the spectral shape. There are a couple of peaks separated with almost same distance in a optical bunch. Such substructure does not seem to result from statistical fluctuations of laser seeds. Although the origin of the substructure of macropulse is not dear at the present, we are going to discuss about SRFEL properties.

The effect of p-doping on multi-state lasing in InAs/InGaAs quantum dot lasers for different cavity lengths

Science.gov (United States)

Korenev, V. V.; Savelyev, A. V.; Maximov, M. V.; Zubov, F. I.; Shernyakov, Yu M.; Zhukov, A. E.

2017-11-01

The effect of modulation p-doping on multi-state lasing in InAs/InGaAs quantum dot (QD) lasers is studied for different levels of acceptor concentration. It is shown that in case of the short laser cavities, p-doping results in higher output power of the ground-state optical transitions of InAs/InGaAs QDs whereas in longer samples p-doping may result in the decrease of this power component. On the basis of this observation, the optimal design of laser active region and optimal doping level are discussed in details.

Continuously tunable cw lasing near 2.75 μm in diode-pumped Er3+ : SrF2 and Er3+ : CaF2 crystals

International Nuclear Information System (INIS)

Basiev, Tasoltan T; Orlovskii, Yu V; Polyachenkova, M V; Fedorov, Pavel P; Kuznetsov, S V; Konyushkin, V A; Osiko, Vyacheslav V; Alimov, Olimkhon K; Dergachev, Alexey Yu

2006-01-01

CW lasing is obtained in Er 3+ (5%) : CaF 2 and Er 3+ (5%) : SrF 2 crystals near 2.75 μm with 0.4 and 2 W of output powers, respectively, upon transverse diode laser pumping into the upper 4 I 11/2 laser level of erbium ions at 980 nm. Continuous tuning of the laser wavelength between 2720 and 2760 nm is realised in the Er 3+ : SrF 2 crystal. (special issue devoted to the 90th anniversary of a.m. prokhorov)

Combining Raman and laser induced breakdown spectroscopy by double pulse lasing.

Science.gov (United States)

Lednev, Vasily N; Pershin, Sergey M; Sdvizhenskii, Pavel A; Grishin, Mikhail Ya; Fedorov, Alexander N; Bukin, Vladimir V; Oshurko, Vadim B; Shchegolikhin, Alexander N

2018-01-01

A new approach combining Raman spectrometry and laser induced breakdown spectrometry (LIBS) within a single laser event was suggested. A pulsed solid state Nd:YAG laser running in double pulse mode (two frequency-doubled sequential nanosecond laser pulses with dozens microseconds delay) was used to combine two spectrometry methods within a single instrument (Raman/LIBS spectrometer). First, a low-energy laser pulse (power density far below ablation threshold) was used for Raman measurements while a second powerful laser pulse created the plasma suitable for LIBS analysis. A short time delay between two successive pulses allows measuring LIBS and Raman spectra at different moments but within a single laser flash-lamp pumping. Principal advantages of the developed instrument include high quality Raman/LIBS spectra acquisition (due to optimal gating for Raman/LIBS independently) and absence of target thermal alteration during Raman measurements. A series of high quality Raman and LIBS spectra were acquired for inorganic salts (gypsum, anhydrite) as well as for pharmaceutical samples (acetylsalicylic acid). To the best of our knowledge, the quantitative analysis feasibility by combined Raman/LIBS instrument was demonstrated for the first time by calibration curves construction for acetylsalicylic acid (Raman) and copper (LIBS) in gypsum matrix. Combining ablation pulses and Raman measurements (LIBS/Raman measurements) within a single instrument makes it an efficient tool for identification of samples hidden by non-transparent covering or performing depth profiling analysis including remote sensing. Graphical abstract Combining Raman and laser induced breakdown spectroscopy by double pulse lasing.

Exploring the wavelength range of InP/AlGaInP QDs and application to dual-state lasing

International Nuclear Information System (INIS)

Shutts, Samuel; Elliott, Stella N; Smowton, Peter M; Krysa, Andrey B

2015-01-01

We explore the accessible wavelength range offered by InP/AlGaInP quantum dots (QD)s grown by metal–organic vapour phase epitaxy and explain how changes in growth temperature and wafer design can be used to influence the transition energy of the dot states and improve the performance of edge-emitting lasers. The self assembly growth method of these structures creates a multi-modal distribution of inhomogeneously broadened dot sizes, and via the effects of state-filling, allows access to a large range of lasing wavelengths. By characterising the optical properties of these dots, we have designed and demonstrated dual-wavelength lasers which operate at various difference-wavelengths between 8 and 63 nm. We show that the nature of QDs allows the difference-wavelength to be tuned by altering the operating temperature at a rate of up to 0.12 nm K −1 and we investigate the factors affecting intensity stability of the competing modes. (invited article)

Inflammatory process decrease by gallium-aluminium-arsenide (GaAlAs) low intensity laser irradiation on postoperative extraction of impacted lower third molar

International Nuclear Information System (INIS)

Atihe, Mauricio Martins

2002-01-01

This study aimed the observation of inflammatory process decrease by the use of GaAlAs Low Intensity Laser (λ=830 nm; 40 mW) irradiation. Five patients were selected and submitted to surgery of impacted lower third molars, both right and left sides at different occasions. On a first stage, a tooth of a random chosen side - right or left - was extracted by conventional surgery, without LILT. The inflammatory process was measured at postoperative on the first, third and seventh days. This side was then called 'control side'. After 21 days, period in which the inflammatory process of the first surgery was terminated, the other side surgery took place, this time using LILT (4 J at four spots) at postoperative, first and third days. As the previous surgery, the inflammatory process was also measured at postoperative on the first, third and seventh days. This side was called 'experimental or lased side'. The inflammatory process was evaluated by measuring its four characteristic signs: swelling, pain, color and temperature. It was clearly observed a decrease for swelling, pain and color on the lased side which presented significant inference and descriptive statistics. It can be concluded that GaAlAs Low Intensity Laser (λ=830 nm) can surely be used as an additional and important anti-inflammatory source on impacted lower third molar surgeries. (author)

Bioactive glass-ceramic coatings prepared by pulsed laser deposition from RKKP targets (sol-gel vs melt-processing route)

Energy Technology Data Exchange (ETDEWEB)

Rau, J.V., E-mail: giulietta.rau@ism.cnr.it [Istituto di Struttura della Materia, Consiglio Nazionale delle Ricerche, Via del Fosso del Cavaliere, 100-00133 Rome (Italy); Teghil, R. [Universita della Basilicata, Dipartimento di Chimica ' A.M. Tamburro' , Via dell' Ateneo Lucano, 10-85100 Potenza (Italy); CNR-IMIP U.O.S. di Potenza, Zona Industriale di Tito scalo (PZ) (Italy); Fosca, M. [Istituto di Struttura della Materia, Consiglio Nazionale delle Ricerche, Via del Fosso del Cavaliere, 100-00133 Rome (Italy); Universita di Roma ' La Sapienza' , Dipartimento di Chimica, Piazzale Aldo Moro, 5-00185 Rome (Italy); De Bonis, A. [Universita della Basilicata, Dipartimento di Chimica ' A.M. Tamburro' , Via dell' Ateneo Lucano, 10-85100 Potenza (Italy); CNR-IMIP U.O.S. di Potenza, Zona Industriale di Tito scalo (PZ) (Italy); Cacciotti, I.; Bianco, A. [Universita di Roma ' Tor Vergata' , Dipartimento di Ingegneria Industriale, UR INSTM ' Roma Tor Vergata' , Via del Politecnico, 1-00133 Rome (Italy); Albertini, V. Rossi [Istituto di Struttura della Materia, Consiglio Nazionale delle Ricerche, Via del Fosso del Cavaliere, 100-00133 Rome (Italy); Caminiti, R. [Universita di Roma ' La Sapienza' , Dipartimento di Chimica, Piazzale Aldo Moro, 5-00185 Rome (Italy); Ravaglioli, A. [Parco Torricelli delle Arti e delle Scienze, Via Granarolo, 64-48018 Faenza (Ra) (Italy)

2012-05-15

Highlights: Black-Right-Pointing-Pointer Bioactive glass-ceramic coatings for bone tissue repair and regeneration. Black-Right-Pointing-Pointer Pulsed Lased Deposition allowed congruent transfer of target composition to coating. Black-Right-Pointing-Pointer Target was prepared by sol-gel process suitable for compositional tailoring. Black-Right-Pointing-Pointer Titanium, widely used for orthopaedics and dental implants, was used as substrate. Black-Right-Pointing-Pointer The physico-chemical properties of the prepared coatings are reported. -- Abstract: The deposition of innovative glass-ceramic composition (i.e. RKKP) coatings by Pulsed Lased Deposition (PLD) technique is reported. RKKP was synthesised following two methodologies: melt-processing and sol-gel, the latter being particularly suitable to tailor the compositional range. The PLD advantage with respect to other deposition techniques is the congruent transfer of the target composition to the coating. The physico-chemical properties of films were investigated by Scanning Electron and Atomic Force Microscopies, Fourier Transform Infrared Spectroscopy, Angular and Energy Dispersive X-ray Diffraction, and Vickers microhardness. The deposition performed at 12 J/cm{sup 2} and 500 Degree-Sign C allows to prepare crystalline films with the composition that replicates rather well that of the initial targets. The 0.6 {mu}m thin melt-processing RKKP films, possessing the hardness of 25 GPa, and the 4.3 {mu}m thick sol-gel films with the hardness of 17 GPa were obtained.

Bioactive glass–ceramic coatings prepared by pulsed laser deposition from RKKP targets (sol–gel vs melt-processing route)

International Nuclear Information System (INIS)

Rau, J.V.; Teghil, R.; Fosca, M.; De Bonis, A.; Cacciotti, I.; Bianco, A.; Albertini, V. Rossi; Caminiti, R.; Ravaglioli, A.

2012-01-01

Highlights: ► Bioactive glass–ceramic coatings for bone tissue repair and regeneration. ► Pulsed Lased Deposition allowed congruent transfer of target composition to coating. ► Target was prepared by sol–gel process suitable for compositional tailoring. ► Titanium, widely used for orthopaedics and dental implants, was used as substrate. ► The physico-chemical properties of the prepared coatings are reported. -- Abstract: The deposition of innovative glass–ceramic composition (i.e. RKKP) coatings by Pulsed Lased Deposition (PLD) technique is reported. RKKP was synthesised following two methodologies: melt-processing and sol–gel, the latter being particularly suitable to tailor the compositional range. The PLD advantage with respect to other deposition techniques is the congruent transfer of the target composition to the coating. The physico-chemical properties of films were investigated by Scanning Electron and Atomic Force Microscopies, Fourier Transform Infrared Spectroscopy, Angular and Energy Dispersive X-ray Diffraction, and Vickers microhardness. The deposition performed at 12 J/cm 2 and 500 °C allows to prepare crystalline films with the composition that replicates rather well that of the initial targets. The 0.6 μm thin melt-processing RKKP films, possessing the hardness of 25 GPa, and the 4.3 μm thick sol–gel films with the hardness of 17 GPa were obtained.

Lasing at 300 nm and below: Optical challenges and perspectives

Energy Technology Data Exchange (ETDEWEB)

Garzella, D. [Universite de Paris-Sud, Orsay (France); Couprie, M.E. [Universite de Paris-Sud, Orsay (France)]|[CEA DSM DRECAM SPAM, Gif Sur Yvette (France); Billardon, M. [ESPCI, Paris (France)

1995-12-31

The FEL experiment in the visible and near UV on the Super ACO storage ring has given, since 1989, important informations on the SRFEL dynamics and, furthermore, a very good beam stability has been achieved. In addition, the operation at 350 nm with this good stability and a long beam lifetime allowed us to perform the first user experiment in biology and to start with a campaign for using the laser as photons source for experiments in other domains, coupling FEL light and the Synchrotron Radiation. For this, FEL starts to be very competitive with respect to the other conventional laser sources, provided that it could oscillate further in the UV, say at 300 nm and below. So, the real challenge is now given by the lasing at shorter wavelengths and, for this, by the optical technology existing nowadays. Since 1992 the efforts have been concentrating to look for every kind of solution allowing us to overcome the problem of having a very low gain. From an optical point of view, in the range of wavelengths explored, there is a lack of transparents dielectric materials for substrates and coatings. Substrates are required at the same time to be relatively not absorbing (a few tens 10{sup -6}), to have a very good surface quality (RMS roughness below 10 {Angstrom}) because of scattering losses dramatically increasing in this spectral range and, due to the thermal load of the undulator emission, to have adequate thermal characteristics. In order to fulfill all these requirements, a good characterisation and modelisation of the substrates is needed, especially to correlate thermal loading and mechanical deformations from one hand, and roughness and scattering losses from the other hand. Coatings must be not absorbing too and, above all, the most amorphous as possible (this could be obtained with IBS deposition technique), in order to insure a good reproduction of the substrate roughness at the interfaces and on the top layer and an higher resistance to the XUV photons load.

Compact lasing system at 13.5-nm to ground state of LiIII at 2Hz

Science.gov (United States)

Goltsov, A. Y.; Korobkin, D.; Nam, C. H.; Suckewer, Szymon

1997-11-01

The recent results of the demonstration of the lasing action at 13.5 nm in transition to ground state of LiIII at 2 Hz repetition rate using two lasers is being presented in this paper. A gain length of GL approximately equals 5.5 was measured in the 5 mm long, 0.3 mm diameter, LiF microcapillary using a 50 mJ, 250 fsec UV laser beam. The initial plasma was created in the microcapillary by a low power, relatively long pulse Nd/YAG laser. In order to shed light on observed unusually high efficiency of the ionization of the atoms in microcapillaries, the subpicosecond UV laser beam transmissions through the plasma in microcapillaries were measured. Strong dependence of the beam transmission on the delay time between inial plasma formation with the Nd/YAG laser and the sub-picosecond UV laser was recorded. The final part of the paper discusses some necessary conditions for an extension of the present results towards the shorter wavelength lasers with an emphasis on the presently conducted experiments at Princeton University for the generation gain at 4.8 nm in BV.

Photophysical properties, photodegradation characteristics, and lasing action for coumarin dye C540A in polymeric media

Science.gov (United States)

Jones, Guilford, II; Huang, Zhennian; Pacheco, Dennis P., Jr.; Russell, Jeffrey A.

2004-07-01

Tunable solid-state dye lasers operating in the blue-green spectral region are attractive for a variety of applications. An important consideration in assessing the viability of this technology is the service life of the gain medium, which is presently limited by dye photodegradation. In this study, solid polymeric samples consisting of the coumarin dye C540A in modified PMMA were subjected to controlled photodegradation tests. The excitation laser was a flashlamp-pumped dye laser operating at 440 nm with a pulse duration of 1 μs. A complementary set of data was obtained for dye in solution phase for comparison purposes. Photophysical properties of C540A in water solution of polymethacrylic acid (PMAA) have been investigated with a view to assess the suitability of the sequestering polymer (PMAA) as an effective additive to facilitate use of a water medium for highly efficient blue-green dye lasers. Lasing action of C540A in aqueous PMAA has been realized using flashlamp-pumped laser system, yielding excellent laser efficiencies superior to that achieved in ethanolic solutions with the same dye. Laser characterization of dye in media included measurement of laser threshold, slope efficiency, pulse duration and output wavelength.

Numerical calculations of the absorption and oscillation processes in the nonlinear polarized crystal Cr4+:YAG pumped by Nd-glass laser

International Nuclear Information System (INIS)

Abdul Ghani, B.; Hammadi, M.

2007-01-01

A mathematical model describing the dynamic emission of intracavity isotropic Cr 4+ : YAG polarized solid-state saturable absorber as a tool of dual Q-switching and lasing processes 1.06 μm and 1.4 μm by double pumping pulse has been developed. This model describes the time evolution of interaction between the pumping laser pulse with a changed polarization state and the polarized absorber. (author)

Lasing ability of naphthyl 1, 3, 4, oxadiazole molecules in relation with their structures: application to the design of new UV dye laser

Energy Technology Data Exchange (ETDEWEB)

Rulliere, C; Rayez, J C [Bordeaux-1 Univ., 33 - Talence (France). Lab. de Chimie Physique A

1976-11-01

The lasing properties of naphtyl 1,3,4 oxadiazole derivatives were found to be directly related to the position of the forbidden transition S/sub 0/ ..-->../sup 1/Lsub(b) of naphtalene with respect to the first allowed transitions. The combination of theoretical and experimental results allows us to predict which compounds are most likely to exhibit a laser effect according to the nature and the position of their substituants. This approach was successfully applied to the following compounds: ..cap alpha..NPD, ..beta..NPD, ..cap alpha..NND, ..beta..NND, ..beta..NBD, and ..cap alpha..NBD. In particular we reported the first observation of a laser effect for ..cap alpha..NBD and ..beta..NBD in the UV at 3830 A and 3758 A is reported.

The Theory of Random Laser Systems

International Nuclear Information System (INIS)

Xunya Jiang

2002-01-01

Studies of random laser systems are a new direction with promising potential applications and theoretical interest. The research is based on the theories of localization and laser physics. So far, the research shows that there are random lasing modes inside the systems which is quite different from the common laser systems. From the properties of the random lasing modes, they can understand the phenomena observed in the experiments, such as multi-peak and anisotropic spectrum, lasing mode number saturation, mode competition and dynamic processes, etc. To summarize, this dissertation has contributed the following in the study of random laser systems: (1) by comparing the Lamb theory with the Letokhov theory, the general formulas of the threshold length or gain of random laser systems were obtained; (2) they pointed out the vital weakness of previous time-independent methods in random laser research; (3) a new model which includes the FDTD method and the semi-classical laser theory. The solutions of this model provided an explanation of the experimental results of multi-peak and anisotropic emission spectra, predicted the saturation of lasing modes number and the length of localized lasing modes; (4) theoretical (Lamb theory) and numerical (FDTD and transfer-matrix calculation) studies of the origin of localized lasing modes in the random laser systems; and (5) proposal of using random lasing modes as a new path to study wave localization in random systems and prediction of the lasing threshold discontinuity at mobility edge

Efficient non-linear two-photon effects from the Cesium 6D manifold

Science.gov (United States)

Haluska, Nathan D.; Perram, Glen P.; Rice, Christopher A.

2018-02-01

We report several non-linear process that occur when two-photon pumping the cesium 6D states. Cesium vapor possess some of the largest two-photon pump cross sections in nature. Pumping these cross sections leads to strong amplified spontaneous emission that we observe on over 17 lasing lines. These new fields are strong enough to couple with the pump to create additional tunable lines. We use a heat pipe with cesium densities of 1014 to 1016 cm-3 and 0 to 5 Torr of helium buffer gas. The cesium 6D States are interrogated by both high energy pulses and low power CW sources. We observe four-wave mixing, six-wave mixing, potential two-photon lasing, other unknown nonlinear processes, and the persistence of some processes at low thresholds. This system is also uniquely qualified to support two-photon lasing under the proper conditions.

Low threshold lasing of bubble-containing glass microspheres by non-whispering gallery mode excitation over a wide wavelength range

Energy Technology Data Exchange (ETDEWEB)

Kumagai, Tsutaru, E-mail: kumagai.t.af@m.titech.ac.jp; Kishi, Tetsuo; Yano, Tetsuji [Department of Chemistry and Materials Science, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8550 (Japan)

2015-03-21

Bubble-containing Nd{sup 3+}-doped tellurite glass microspheres were fabricated by localized laser heating technique to investigate their optical properties for use as microresonators. Fluorescence and excitation spectra measurements were performed by pumping with a tunable CW-Ti:Sapphire laser. The excitation spectra manifested several sharp peaks due to the conventional whispering gallery mode (WGM) when the pumping laser was irradiated to the edge part of the microsphere. However, when the excitation light was irradiated on the bubble position inside the microsphere, “non-WGM excitation” was induced, giving rise to numerous peaks at a broad wavelength range in the excitation spectra. Thus, efficient excitation was achieved over a wide wavelength range. Lasing threshold excited at the bubble position was much lower than that for the excitation at the edges of the microsphere. The lowest value of the laser threshold was 34 μW for a 4 μm sphere containing a 0.5 μm bubble. Efficiency of the excitation at the bubble position with broadband light was calculated to be 5 times higher than that for the edge of the microsphere. The bubble-containing microsphere enables efficient utilization of broadband light excitation from light-emitting diodes and solar light.

Double threshold behavior in a resonance-controlled ZnO random laser

Directory of Open Access Journals (Sweden)

Ryo Niyuki

2017-03-01

Full Text Available We observed unusual lasing characteristics, such as double thresholds and blue-shift of lasing peak, in a resonance-controlled ZnO random laser. From the analysis of lasing threshold carrier density, we found that the lasing at 1st and 2nd thresholds possibly arises from different mechanisms; the lasing at 1st threshold involves exciton recombination, whereas the lasing at 2nd threshold is caused by electron-hole plasma recombination, which is the typical origin of conventional random lasers. These phenomena are very similar to the transition from polariton lasing to photon lasing observed in a well-defined cavity laser.

Exciton recombination in lasing contributing an opposite abrupt change of the electrical behavior near threshold between GaN- and GaAs- multi-quantum-well laser diodes

Science.gov (United States)

Feng, Liefeng; Wang, Shupeng; Li, Yang; Li, Ding; Wang, Cunda

2018-03-01

The opposite sudden change of electrical characteristics between narrow and wide bang-gap multi-quantum-well (MQW) laser diodes (LDs) in the threshold region (which is defined as a current region between two kinks of IdV/dI-I curve) shows an interesting phenomenon that the slope changes of IdV/dI-I or V j -I curve between two adjacent regions (‘below’ and ‘in’, or ‘in’ and ‘above’ threshold region) display an approximate e-exponential relationship with the wavelengths of LDs. After comparing the exciton binding energy in different MQW LDs, and analyzing the temperature dependence of V j -I and IdV/dI-I of GaN MQW LDs, we suggested that the fraction of exciton recombination into lasing is a reason causing the relationship of sudden changes of the electrical characteristics with wavelengths of LDs.

Inflammatory process decrease by gallium-aluminium-arsenide (GaAlAs) low intensity laser irradiation on postoperative extraction of impacted lower third molar; Reducao de processo inflamatorio com aplicacao de laser de arseneto de galio aluminio ({lambda}=830 nm) em pos-operatorio de exodontia de terceiros molares inferiores inclusos ou semi-inclusos

Energy Technology Data Exchange (ETDEWEB)

Atihe, Mauricio Martins

2002-07-01

This study aimed the observation of inflammatory process decrease by the use of GaAlAs Low Intensity Laser ({lambda}=830 nm; 40 mW) irradiation. Five patients were selected and submitted to surgery of impacted lower third molars, both right and left sides at different occasions. On a first stage, a tooth of a random chosen side - right or left - was extracted by conventional surgery, without LILT. The inflammatory process was measured at postoperative on the first, third and seventh days. This side was then called 'control side'. After 21 days, period in which the inflammatory process of the first surgery was terminated, the other side surgery took place, this time using LILT (4 J at four spots) at postoperative, first and third days. As the previous surgery, the inflammatory process was also measured at postoperative on the first, third and seventh days. This side was called 'experimental or lased side'. The inflammatory process was evaluated by measuring its four characteristic signs: swelling, pain, color and temperature. It was clearly observed a decrease for swelling, pain and color on the lased side which presented significant inference and descriptive statistics. It can be concluded that GaAlAs Low Intensity Laser ({lambda}=830 nm) can surely be used as an additional and important anti-inflammatory source on impacted lower third molar surgeries. (author)

Inflammatory process decrease by gallium-aluminium-arsenide (GaAlAs) low intensity laser irradiation on postoperative extraction of impacted lower third molar; Reducao de processo inflamatorio com aplicacao de laser de arseneto de galio aluminio ({lambda}=830 nm) em pos-operatorio de exodontia de terceiros molares inferiores inclusos ou semi-inclusos

Energy Technology Data Exchange (ETDEWEB)

Atihe, Mauricio Martins

2002-07-01

This study aimed the observation of inflammatory process decrease by the use of GaAlAs Low Intensity Laser ({lambda}=830 nm; 40 mW) irradiation. Five patients were selected and submitted to surgery of impacted lower third molars, both right and left sides at different occasions. On a first stage, a tooth of a random chosen side - right or left - was extracted by conventional surgery, without LILT. The inflammatory process was measured at postoperative on the first, third and seventh days. This side was then called 'control side'. After 21 days, period in which the inflammatory process of the first surgery was terminated, the other side surgery took place, this time using LILT (4 J at four spots) at postoperative, first and third days. As the previous surgery, the inflammatory process was also measured at postoperative on the first, third and seventh days. This side was called 'experimental or lased side'. The inflammatory process was evaluated by measuring its four characteristic signs: swelling, pain, color and temperature. It was clearly observed a decrease for swelling, pain and color on the lased side which presented significant inference and descriptive statistics. It can be concluded that GaAlAs Low Intensity Laser ({lambda}=830 nm) can surely be used as an additional and important anti-inflammatory source on impacted lower third molar surgeries. (author)

Laser reactor

International Nuclear Information System (INIS)

Bellak, J.G.

1976-01-01

A device is described for producing reactions in the chemical to thermonuclear range and beyond. Physical principles entail pressures, kinetic temperatures, and electromagnetic field strengths obtainable from convergent electromagnetic energy. Process converges closed electromagnetic wave on reactants thereby heating, compressing and confining, and stressing reactants under focal electromagnetic intensities, inducing endothermic, equithermic, exothermic or combination reactions, all types furnishing energy useful externally and the exothermic type furnishing energy useful as feedback for generating new electromagnetic waves for process cyclic operation. Embodiment consists of closed shell lasing element enclosing reaction chamber, source of reactants, sink for reactant by-products, and a source of initial energy for priming the lasing element

Transverse mode control in proton-implanted and oxide-confined VCSELs via patterned dielectric anti-phase filters

Science.gov (United States)

Kesler, Benjamin; O'Brien, Thomas; Dallesasse, John M.

2017-02-01

A novel method for controlling the transverse lasing modes in both proton implanted and oxide-confined vertical- cavity surface-emitting lasers (VCSELs) with a multi-layer, patterned, dielectric anti-phase (DAP) filter is pre- sented. Using a simple photolithographic liftoff process, dielectric layers are deposited and patterned on individual VCSELs to modify (increase or decrease) the mirror reflectivity across the emission aperture via anti-phase reflections, creating spatially-dependent threshold material gain. The shape of the dielectric pattern can be tailored to overlap with specific transverse VCSEL modes or subsets of transverse modes to either facilitate or inhibit lasing by decreasing or increasing, respectively, the threshold modal gain. A silicon dioxide (SiO2) and titanium dioxide (TiO2) anti-phase filter is used to achieve a single-fundamental-mode, continuous-wave output power greater than 4.0 mW in an oxide-confined VCSEL at a lasing wavelength of 850 nm. A filter consisting of SiO2 and TiO2 is used to facilitate injection-current-insensitive fundamental mode and lower order mode lasing in proton implanted VCSELs at a lasing wavelength of 850 nm. Higher refractive index dielectric materials such as amorphous silicon (a-Si) can be used to increase the effectiveness of the anti-phase filter on proton implanted devices by reducing the threshold modal gain of any spatially overlapping modes. This additive, non-destructive method allows for mode selection at any lasing wavelength and for any VCSEL layer structure without the need for semiconductor etching or epitaxial regrowth. It also offers the capability of designing a filter based upon available optical coating materials.

Colloidal-Quantum-Dot Ring Lasers with Active Color Control.

Science.gov (United States)

le Feber, Boris; Prins, Ferry; De Leo, Eva; Rabouw, Freddy T; Norris, David J

2018-02-14

To improve the photophysical performance of colloidal quantum dots for laser applications, sophisticated core/shell geometries have been developed. Typically, a wider bandgap semiconductor is added as a shell to enhance the gain from the quantum-dot core. This shell is designed to electronically isolate the core, funnel excitons to it, and reduce nonradiative Auger recombination. However, the shell could also potentially provide a secondary source of gain, leading to further versatility in these materials. Here we develop high-quality quantum-dot ring lasers that not only exhibit lasing from both the core and the shell but also the ability to switch between them. We fabricate ring resonators (with quality factors up to ∼2500) consisting only of CdSe/CdS/ZnS core/shell/shell quantum dots using a simple template-stripping process. We then examine lasing as a function of the optical excitation power and ring radius. In resonators with quality factors >1000, excitons in the CdSe cores lead to red lasing with thresholds at ∼25 μJ/cm 2 . With increasing power, green lasing from the CdS shell emerges (>100 μJ/cm 2 ) and then the red lasing begins to disappear (>250 μJ/cm 2 ). We present a rate-equation model that can explain this color switching as a competition between exciton localization into the core and stimulated emission from excitons in the shell. Moreover, by lowering the quality factor of the cavity we can engineer the device to exhibit only green lasing. The mechanism demonstrated here provides a potential route toward color-switchable quantum-dot lasers.

Micro-Cavity Fluidic Dye Laser

DEFF Research Database (Denmark)

Helbo, Bjarne; Kristensen, Anders; Menon, Aric Kumaran

2003-01-01

We have successfully designed, fabricated and characterized a micro-cavity fluidic dye laser with metallic mirrors, which can be integrated with polymer based lab-on-a-chip microsystems without further processing steps. A simple rate-equation model is used to predict the average pumping power...... threshold for lasing as function of cavity-mirror reflectance, laser dye concentration and cavity length. The laser device is characterized using the laser dye Rhodamine 6G dissolved in ethanol. Lasing is observed, and the influence of dye concentration is investigated....

Induced Higher-order aberrations after Laser In Situ Keratomileusis (LASIK) Performed with Wavefront-Guided IntraLase Femtosecond Laser in moderate to high Astigmatism.

Science.gov (United States)

Al-Zeraid, Ferial M; Osuagwu, Uchechukwu L

2016-03-22

Wavefront-guided Laser-assisted in situ keratomileusis (LASIK) is a widespread and effective surgical treatment for myopia and astigmatic correction but whether it induces higher-order aberrations remains controversial. The study was designed to evaluate the changes in higher-order aberrations after wavefront-guided ablation with IntraLase femtosecond laser in moderate to high astigmatism. Twenty-three eyes of 15 patients with moderate to high astigmatism (mean cylinder, -3.22 ± 0.59 dioptres) aged between 19 and 35 years (mean age, 25.6 ± 4.9 years) were included in this prospective study. Subjects with cylinder ≥ 1.5 and ≤2.75 D were classified as moderate astigmatism while high astigmatism was ≥3.00 D. All patients underwent a femtosecond laser-enabled (150-kHz IntraLase iFS; Abbott Medical Optics Inc) wavefront-guided ablation. Uncorrected (UDVA), corrected (CDVA) distance visual acuity in logMAR, keratometry, central corneal thickness (CCT) and higher-order aberrations (HOAs) over a 6 mm pupil, were assessed before and 6 months, postoperatively. The relationship between postoperative change in HOA and preoperative mean spherical equivalent refraction, mean astigmatism, and postoperative CCT were tested. At the last follow-up, the mean UDVA was increased (P < 0.0001) but CDVA remained unchanged (P = 0.48) and no eyes lost ≥2 lines of CDVA. Mean spherical equivalent refraction was reduced (P < 0.0001) and was within ±0.50 D range in 61% of eyes. The average corneal curvature was flatter by 4 D and CCT was reduced by 83 μm (P < 0.0001, for all), postoperatively. Coma aberrations remained unchanged (P = 0.07) while the change in trefoil (P = 0.047) postoperatively, was not clinically significant. The 4th order HOAs (spherical aberration and secondary astigmatism) and the HOA root mean square (RMS) increased from -0.18 ± 0.07 μm, 0.04 ± 0.03 μm and 0.47 ± 0.11 μm, preoperatively, to 0.33 ± 0

Biomaterials in light amplification

Science.gov (United States)

Mysliwiec, Jaroslaw; Cyprych, Konrad; Sznitko, Lech; Miniewicz, Andrzej

2017-03-01

Biologically produced or inspired materials can serve as optical gain media, i.e. they can exhibit the phenomenon of light amplification. Some of these materials, under suitable dye-doping and optical pumping conditions, show lasing phenomena. The emerging branch of research focused on obtaining lasing action in highly disordered and highly light scattering materials, i.e. research on random lasing, is perfectly suited for biological materials. The use of biomaterials in light amplification has been extensively reported in the literature. In this review we attempt to report on progress in the development of biologically derived systems able to show the phenomena of light amplification and random lasing together with the contribution of our group to this field. The rich world of biopolymers modified with molecular aggregates and nanocrystals, and self-organized at the nanoscale, offers a multitude of possibilities for tailoring luminescent and light scattering properties that are not easily replicated in conventional organic or inorganic materials. Of particular importance and interest are light amplification and lasing, or random lasing studies in biological cells and tissues. In this review we will describe nucleic acids and their complexes employed as gain media due to their favorable optical properties and ease of manipulation. We will report on research conducted on various biomaterials showing structural analogy to nucleic acids such as fluorescent proteins, gelatins in which the first distributed feedback laser was realized, and also amyloids or silks, which, due to their dye-doped fiber-like structure, allow for light amplification. Other materials that were investigated in that respect include polysaccharides, like starch exhibiting favorable photostability in comparison to other biomaterials, and chitosan, which forms photonic crystals or cellulose. Light amplification and random lasing was not only observed in processed biomaterials but also in living

Planar waveguide nanolaser configured by dye-doped hybrid nanofilm on substrate

Science.gov (United States)

Tikhonov, E. A.; Yashchuk, V. P.; Telbiz, G. M.

2018-04-01

Dye-doped hybrid silicate/titanium nanofilms on the glass substrate structures of asymmetrical waveguides were studied by way of laser systems. The threshold, spatial and spectral features of the laser oscillation of genuine and hollow waveguides were determined. The pattern of stimulated radiation included two concurrent processes: single-mode waveguide lasing and lateral small divergence emission. Comparison of the open angle of the lateral beams and grazing angles of the waveguide lasing mode provides an insight into the effect of leaky mode emission followed by Lummer-Gehrcke interference.

Small UAS Analysis of Laser Designation and Search and Target Acquisition Capabilities in an Urban Environment

National Research Council Canada - National Science Library

Harclerode, Eric

2008-01-01

Conclusions: -Small UAS has extreme difficulty lasing moving targets in high density urban environments -Lasing moving targets in medium density terrain is possible but not certain -Lasing of stationary targets...

Terahertz lasers and amplifiers based on resonant optical phonon scattering to achieve population inversion

Science.gov (United States)

Williams, Benjamin S. (Inventor); Hu, Qing (Inventor)

2009-01-01

The present invention provides quantum cascade lasers and amplifier that operate in a frequency range of about 1 Terahertz to about 10 Terahertz. In one aspect, a quantum cascade laser of the invention includes a semiconductor heterostructure that provides a plurality of lasing modules connected in series. Each lasing module includes a plurality of quantum well structure that collectively generate at least an upper lasing state, a lower lasing state, and a relaxation state such that the upper and the lower lasing states are separated by an energy corresponding to an optical frequency in a range of about 1 to about 10 Terahertz. The lower lasing state is selectively depopulated via resonant LO-phonon scattering of electrons into the relaxation state.

Fission fragment excited laser system

Science.gov (United States)

McArthur, David A.; Tollefsrud, Philip B.

1976-01-01

A laser system and method for exciting lasing action in a molecular gas lasing medium which includes cooling the lasing medium to a temperature below about 150 K and injecting fission fragments through the lasing medium so as to preferentially excite low lying vibrational levels of the medium and to cause population inversions therein. The cooled gas lasing medium should have a mass areal density of about 5 .times. 10.sup.-.sup.3 grams/square centimeter, relaxation times of greater than 50 microseconds, and a broad range of excitable vibrational levels which are excitable by molecular collisions.

Red to green emitters from InGaP/InAlGaP laser structure by strain-induced quantum-well intermixing

KAUST Repository

Al-Jabr, Ahmad

2016-04-28

We increased the Al content in the single quantum well InGaP/InAlGaP laser by strain-induced quantum well intermixing, and obtained a considerable enhancement (close to ten-fold increase) in the photoluminescence (PL) intensity. Among the annealing process investigated, we achieved lasing at 638 nm in conjunction with reduction in the lasing threshold current by close to 500 mA in a moderately intermixed laser. Lasing in orange color, as well as spontaneous emission in the yellow and green color regime, were also achieved by extending the annealing conditions. The significance of the current work became apparent when one considers that achieving these tunable wavelengths by increasing the Al content in quantum wells during epitaxy growth leads to severe lattice-mismatch and poor material quality. Hence, our Al "drive-in" intermixing process is a viable approach for forming Al-rich InAlGaP quantum well, which is essential for realizing efficient optoelectronic devices in the "green-yellow-orange gap". © (2016) COPYRIGHT Society of Photo-Optical Instrumentation Engineers (SPIE). Downloading of the abstract is permitted for personal use only.

Enhancing Optically Pumped Organic-Inorganic Hybrid Perovskite Amplified Spontaneous Emission via Compound Surface Plasmon Resonance

Directory of Open Access Journals (Sweden)

Xiaoyan Wu

2018-03-01

Full Text Available Organic-inorganic hybrid perovskite has attracted intensive attention from researchers as the gain medium in lasing devices. However, achieving electrically driven lasing remains a significant challenge. Modifying the devices’ structure to enhance the optically pumped amplified spontaneous emission (ASE is the key issue. In this work, gold nanoparticles (Au NPs are first doped into PEDOT: PSS buffer layer in a slab waveguide device structure: Quartz/PEDOT: PSS (with or w/o Au NPs/CH3NH3PbBr3. As a result, the facile device shows a significantly enhanced ASE intensity and a narrowed full width at half maximum. Based on experiments and theoretical simulation data, the improvement is mainly a result of the compound surface plasmon resonance, including simultaneous near- and far-field effects, both of which could increase the density of excitons excited state and accelerate the radiative decay process. This method is highly significant for the design and development and fabrication of high-performance organic-inorganic hybrid perovskite lasing diodes.

Ultrafast atomic process in X-ray emission by using inner-shell ionization method for sodium and carbon atoms

Energy Technology Data Exchange (ETDEWEB)

Moribayashi, Kengo; Sasaki, Akira; Tajima, Toshiki [Japan Atomic Energy Research Inst., Neyagawa, Osaka (Japan). Kansai Research Establishment

1998-07-01

An ultrafast inner-shell ionization process with X-ray emission stimulated by high-intensity short-pulse X-ray is studied. Carbon and sodium atoms are treated as target matter. It is shown that atomic processes of the target determine the necessary X-ray intensity for X-ray laser emission as well as the features of X-ray laser such as wavelength and duration time. The intensity also depends on the density of initial atoms. Furthermore, we show that as the intensity of X-ray source becomes high, the multi-inner-shell ionization predominates, leading to the formation of hollow atoms. As the density of hollow atoms is increased by the pumping X-ray power, the emission of X-rays is not only of significance for high brightness X-ray measurement but also is good for X-ray lasing. New classes of experiments of pump X-ray probe and X-ray laser are suggested. (author)

Low-threshold conical microcavity dye lasers

DEFF Research Database (Denmark)

Grossmann, Tobias; Schleede, Simone; Hauser, Mario

2010-01-01

element simulations confirm that lasing occurs in whispering gallery modes which corresponds well to the measured multimode laser-emission. The effect of dye concentration on lasing threshold and lasing wavelength is investigated and can be explained using a standard dye laser model....

Gain dynamics of quantum dot devices for dual-state operation

Energy Technology Data Exchange (ETDEWEB)

Kaptan, Y., E-mail: yuecel.kaptan@physik.tu-berlin.de; Herzog, B.; Kolarczik, M.; Owschimikow, N.; Woggon, U. [Institut für Optik und Atomare Physik, Technische Universität Berlin, Berlin (Germany); Schmeckebier, H.; Arsenijević, D.; Bimberg, D. [Institut für Festkörperphysik, Technische Universität Berlin, Berlin (Germany); Mikhelashvili, V.; Eisenstein, G. [Technion Institute of Technology, Faculty of Electrical Engineering, Haifa (Israel)

2014-06-30

Ground state gain dynamics of In(Ga)As-quantum dot excited state lasers are investigated via single-color ultrafast pump-probe spectroscopy below and above lasing threshold. Two-color pump-probe experiments are used to localize lasing and non-lasing quantum dots within the inhomogeneously broadened ground state. Single-color results yield similar gain recovery rates of the ground state for lasing and non-lasing quantum dots decreasing from 6 ps to 2 ps with increasing injection current. We find that ground state gain dynamics are influenced solely by the injection current and unaffected by laser operation of the excited state. This independence is promising for dual-state operation schemes in quantum dot based optoelectronic devices.

Effect of temperature and ridge-width on the lasing characteristics of InAs/InP quantum-dash lasers: A thermal analysis view

Science.gov (United States)

Alkhazraji, E.; Khan, M. T. A.; Ragheb, A. M.; Fathallah, H.; Qureshi, K. K.; Alshebeili, S.; Khan, M. Z. M.

2018-01-01

We investigate the thermal characteristics of multi-stack chirped barrier thickness InAs/InGaAlAs/InP quantum-dash-in-a-well lasers of different ridge widths 2, 3, 4 and 15 μm. The effect of varying this geometrical parameter on the extracted thermal resistance and characteristic temperature, and their stability with temperature are examined. The results show an inverse relation of ridge-width with junction temperature with 2 μm device exhibiting the largest junction temperature buildup owing to an associated high thermal resistance of ∼45 °C/W. Under the light of this thermal analysis, lasing behavior of different ridge-width quantum-dash (Qdash) lasers with injection currents and operating temperatures, is investigated. Thermionic carrier escape and phonon-assisted tunneling are found to be the dominant carrier transport mechanisms resulting in wide thermal spread of carriers across the available transition states of the chirped active region. An emission coverage of ∼75 nm and 3 dB bandwidth of ∼55 nm is exhibited by the 2 μm device, thus possibly exploiting the inhomogeneous optical transitions to the fullest. Furthermore, successful external modulation of a single Qdash Fabry-Perot laser mode via injection locking is demonstrated with eye diagrams at bit rates of 2-12 Gbit/s incorporating various modulation schemes. These devices are being considered as potential light sources for future high-speed wavelength-division multiplexed optical communication systems.

Semiconductor Nanomembranes for Quantum Photonics: Quantum Light Sources and Optomechanics

DEFF Research Database (Denmark)

Liu, Jin

that such a high efficiency could be attributed to the coupling to one of the higher-order cavity modes. Lasing oscillation has also been observed in the same systems. The comparison between the experimental lasing data to an advanced theory reveals that QDs lasing is fundamentally different from single atoms...

Moving localized structures and spatial patterns in quadratic media with a saturable absorber

International Nuclear Information System (INIS)

Tlidi, M; Taki, M; Berre, M Le; Reyssayre, E; Tallet, A; Di Menza, L

2004-01-01

For near the first lasing threshold, we give a detailed derivation of a real order parameter equation for the degenerate optical parametric oscillator with a saturable absorber. For this regime, we study analytically the role of the quasi-homogeneous neutral mode in the pattern formation process. We show that this effect stabilized the hexagonal patterns below the lasing threshold. More importantly, we find numerically that when Turing and Hopf bifurcations interact, a stable moving asymmetric localized structure with a constant transverse velocity is generated. The formation of the moving localized structures is analysed for both the propagation and the mean field models. A quantitative confrontation of the two models is discussed

BaseLase

DEFF Research Database (Denmark)

Müller, Jörg; Eberle, Dieter; Schmidt, Constantin

2015-01-01

Covers a very large floor area (75m2) with a low resolution context projector, while it provides three movable high-resolution focus spots.......Covers a very large floor area (75m2) with a low resolution context projector, while it provides three movable high-resolution focus spots....

Simultaneous multi-state stimulated emission in quantum dot lasers: experiment and analytical approach

Science.gov (United States)

Korenev, V. V.; Savelyev, A. V.; Zhukov, A. E.; Omelchenko, A. V.; Maximov, M. V.; Shernyakov, Yu. M.

2012-06-01

The theoretical investigation of the double-state lasing phenomena in InAs/InGaAs quantum dot lasers has been carried out. The new mechanism of the ground-state lasing quenching, which takes place in quantum dot (QD) laser operating in double-state lasing regime at high pump level, was proposed. The difference between electron and hole capture rates causes the depletion of the hole levels and consequently leads to the decrease of an output lasing power via QD ground state with the growth of injection. Moreover, it was shown that the hole-to-electron capture rates ratio strongly affects both the light-current curve and the key laser parameters. The model of the simultaneous lasing through the ground and excited QD states was developed which allows to describe the observed quenching quantitatively.

Laser device and method

International Nuclear Information System (INIS)

Myers, J.D.

1986-01-01

A method is described of treatment of opacity of the lens of an eye resulting from foreign matter at the back surface of the eye lens within the vitreous fluid body of the eye with a passively Q-switched laser device. The method consists of: (a) generating a single lasing pulse emitted from the laser device focused within the eye vitreous fluid body, spaced from the lens back surface, creating a microplasma dot in the vitreous fluid body (b) then increasing the frequency of the lasing pulses emitted from the lasing device having a frequency greater than the life of the microplasma to generate an elongated lasing plasma within the eye vitreous fluid moving toward the lens back surface, until the elongated lasing plasma contacts and destroys the foreign matter

Random laser emission at dual wavelengths in a donor-acceptor dye mixture solution

Directory of Open Access Journals (Sweden)

Sunita Kedia

Full Text Available The work was aimed to generate random laser emissions simultaneously at two wavelengths in a weakly scattering system containing mixture of binary dyes, rhodamine-B (Rh-B and oxazine-170 (O-170 dispersed with ZnO nano-particles serving as scattering centres. Random lasing performances for individual Rh-B dye were extensively studied for varying small signal gain/scatterer density and we found lasing threshold to significantly depend upon number density of dispersed nano-particles. In spite of inefficient pumping, we demonstrated possibility of random lasing in O-170 dye solution on account of resonance energy transfer from Rh-B dye which served as donor. At optimum concentrations of fluorophores and scatterer in dye mixture solution, incoherent random lasing was effectively attained simultaneously at two wavelengths centered 90 nm apart. Dual-emission intensities, lasing thresholds and rate of amplifications could be controlled and made equivalent for both donor and acceptor in dye mixture solution by appropriate choice of concentrations of dyes and scatterers. Keywords: Random lasing, Energy transfer, Rhodamine-B, Oxazine-170, Zinc oxide

Effect of optical waveguiding mechanism on the lasing action of chirped InAs/AlGaInAs/InP quantum dash lasers

KAUST Repository

Khan, Mohammed Zahed Mustafa

2013-03-04

We report on the atypical emission dynamics of InAs/AlGaInAs/InP quantum dash (Qdash) lasers employing varying AlGaInAs barrier thickness (multilayer-chirped structure). The analysis is carried out via fabry-perot (FP) ridge (RW) and stripe waveguide (SW) laser characterization corresponding to the index and gain guided waveguiding mechanisms, respectively, and at different current pulse width operations. The laser emissions are found to emerge from the size dispersion of the Qdash ensembles across the four Qdash-barrier stacks, and governed by their overlapping quasi-zero dimensional density of states (DOS). The spectral characteristics demonstrated prominent dependence on the waveguiding mechanism at quasi-continuous wave (QCW) operation (long pulse width). The RW geometry showed unusual spectral split in the emission spectra on increasing current injection while the SW geometry showed typical broadening of lasing spectra. These effects were attributed to the highly inhomogeneous active region, the nonequilibrium carrier distribution and the energy exchange between Qdash groups across the Qdash-barrier stacks. Furthermore, QCW operation showed a progressive red shift of emission spectra with injection current, resulted from active region heating and carrier depopulation, which was observed to be minimal in the short pulse width (SPW) operation. Our investigation sheds light on the device physics of chirped Qdash laser structure and provides guidelines for further optimization in obtaining broad-gain laser diodes. © (2013) COPYRIGHT Society of Photo-Optical Instrumentation Engineers (SPIE). Downloading of the abstract is permitted for personal use only.

Muli-photon spectroscopy of rare-earth ions in ionic crystals

International Nuclear Information System (INIS)

Tsuboi, Taiju

2001-01-01

Diode-pumping solid state laser are important for not only the research of optical properties of optoelectronics device materials but also a variety of technological applications, e.g. optical memory, optical recording, display and optical communication. Diode-pumping gives rises to lasing at wavelength which is longer than the wavelength of diode, while it also gives rise to lasing at wavelength which is shorter than the wavelength of pumping diode. The latter process is called up-conversion. Blue laser pumped by red diode laser is one of the lasers operated by up-conversion process. Up-conversion is now easily observed in various solid state materials and glasses because high power lasers are commercially available. Observation of up-conversion stimulates us to invent up-conversion based devices which are useful for optoelectronics applications such as optical recording with super high bit rates.

Microring embedded hollow polymer fiber laser

Energy Technology Data Exchange (ETDEWEB)

Linslal, C. L., E-mail: linslal@gmail.com; Sebastian, S.; Mathew, S.; Radhakrishnan, P.; Nampoori, V. P. N.; Girijavallabhan, C. P.; Kailasnath, M. [International School of Photonics, Cochin University of Science and Technology, Cochin 22 (India)

2015-03-30

Strongly modulated laser emission has been observed from rhodamine B doped microring resonator embedded in a hollow polymer optical fiber by transverse optical pumping. The microring resonator is fabricated on the inner wall of a hollow polymer fiber. Highly sharp lasing lines, strong mode selection, and a collimated laser beam are observed from the fiber. Nearly single mode lasing with a side mode suppression ratio of up to 11.8 dB is obtained from the strongly modulated lasing spectrum. The microring embedded hollow polymer fiber laser has shown efficient lasing characteristics even at a propagation length of 1.5 m.

Unconventional modes in lasers with spatially varying gain and loss

International Nuclear Information System (INIS)

Ge Li; Tuereci, H. E.; Chong, Y. D.; Stone, A. D.; Rotter, S.

2011-01-01

We discuss a class of lasing modes created by a spatially inhomogeneous gain profile. These lasing modes are ''extra modes,'' in addition to, and very different from, conventional lasing modes, which arise from the passive cavity resonances. These new modes do not have high intensity across the entire gain region, but instead are localized at the gain boundary and throughout the gain-free region. They are surface modes, originating from the transmission resonances of the gain-free region. Using an S-matrix description we connect these surface modes to the lasing modes in PT-symmetric (balanced gain-loss) cavities.

Epitaxial growth of sexi-thiophene and para-hexaphenyl and its implications for the fabrication of self-assembled lasing nano-fibres

International Nuclear Information System (INIS)

Simbrunner, Clemens

2013-01-01

Over the last few years, epitaxially grown self-assembled organic nano-structures became of increasing interest due to their high potential for implementation within opto-electronic devices. Exemplarily, the epitaxial growth of the rod-like molecules para-hexaphenyl (p-6P) and α-sexi-thiophene (6T) is discussed within this review. Both molecules tend to crystallize in highly asymmetric elongated entities which are also called nano-fibres. It is demonstrated that the obtained needle orientations and morphologies result from a complex interplay between various parameters e.g. substrate surface symmetry, molecular adsorption, crystal structure and contact plane. The interplay and its implications on the fabrication of self-assembled waveguiding nano-fibres and optical resonator structures are discussed and substantiated by a comparison with the reported literature. In further consequence, it is demonstrated that a precise control on the molecular adsorption geometry and the crystal contact plane represents a fundamental key parameter for the fabrication of self-assembled nano-fibres. As both parameters are basically determined by the chosen molecule–substrate material couple, the possible spectrum of molecular building blocks for the fabrication of waveguiding and lasing nano-structures can be predicted by the discussed growth model. A possible expansion of this common valid concept is presented by the utilization of organic–organic heteroepitaxy. Based on the reported p-6P/6T heterostructures which have been fabricated on various substrate surfaces, it is substantiated that the fabrication of organic–organic interfaces can be effectively used to gain control on the molecular adsorption geometry. As the proposed strategy still lacks a precise control of the obtained crystal contact plane, further strategies are discussed which potentially lead to a controlled fabrication of opto-electronic devices based on self-assembled organic nano-structures. (invited review)

LASERS, ACTIVE MEDIA: The aqueous-polyelectrolyte dye solution as an active laser medium

Science.gov (United States)

Akimov, A. I.; Saletskii, A. M.

2000-11-01

The spectral, luminescent, and lasing properties of aqueous solutions of a cationic dye rhodamine 6G with additions of anion polyelectrolytes — polyacrylic and polymethacrylic acids — are studied. It is found that the energy and spectral properties of lasing of these solutions depend on the ratio of concentrations of polyelectrolyte and molecules. It is also found that the lasing parameters of aqueous-polyelectrolyte dye solutions can be controlled by changing the structure of the molecular system. The variation in the structure of aqueous-polyelectrolyte dye solutions of rhodamine 6G resulted in an almost five-fold increase in the lasing efficiency compared to that in aqueous dye solutions.

Low ohmic multilayer contacts in lead-tin-telluride diode lasers

International Nuclear Information System (INIS)

Herrmann, K.; Sumpf, B.; Boehme, D.; Hannemann, M.

1983-01-01

The preparation and the influence of low ohmic multilayer thin film contacts of lead-salt homo- and heterolasers on the degradation of lasing parameters during recycling processes between low working temperatures and room temperatures storage are described and discussed in detail. (author)

Progress of the volume FEL (VFEL) experiments in millimeter range

Science.gov (United States)

Baryshevsky, V. G.; Batrakov, K. G.; Gurinovich, A. A.; Ilienko, I. I.; Lobko, A. S.; Molchanov, P. V.; Moroz, V. I.; Sofronov, P. F.; Stolyarsky, V. I.

2003-07-01

Use of non-one-dimensional distributed feedback in Volume Free Electron Laser gives possibility of frequency tuning in wide range. In present work, dependence of lasing process on the angle between resonant diffraction grating grooves and direction of electron beam velocity is discussed.

Semiconductor Laser Measurements Laboratory

Data.gov (United States)

Federal Laboratory Consortium — The Semiconductor Laser Measurements Laboratory is equipped to investigate and characterize the lasing properties of semiconductor diode lasers. Lasing features such...

Efficient oscillation regimes of an HF laser pumped by a nonchain chemical reaction initiated by a self-sustained discharge

International Nuclear Information System (INIS)

Panchenko, Aleksei N; Orlovskii, Viktor M; Tarasenko, Viktor F; Baksht, E Kh

2003-01-01

The amplitude - time and spectral characteristics of laser radiation and discharge characteristics in mixtures of SF 6 with hydrogen and hydrocarbons at a high lasing efficiency are investigated. Lasing efficiencies of ∼10 % with respect to the deposited energy are obtained under the pumping from capacitive and inductive energy storage units. It is shown that, during a pump pulse, the maximum efficiencies are achieved at high values of the parameter E/p in the laser gap. When profiled electrodes and UV preionisation are used, a specific output energy of a nonchain HF laser of ∼140 J L -1 atm -1 and a lasing efficiency of ∼4.5 % with respect to the stored energy were obtained. It is shown that the emission spectrum of a nonchain HF laser operating at high lasing efficiencies becomes significantly wider and cascade lasing is realised on the ν(3-2) → ν(2-1) → ν(1-0) vibrational transitions at several rotational lines. (lasers)

GaAs-based high temperature electrically pumped polariton laser

Energy Technology Data Exchange (ETDEWEB)

Baten, Md Zunaid; Bhattacharya, Pallab, E-mail: pkb@eecs.umich.edu; Frost, Thomas; Deshpande, Saniya; Das, Ayan [Center for Photonic and Multiscale Nanomaterials, Department of Electrical Engineering and Computer Science, University of Michigan, Ann Arbor, Michigan 48109 (United States); Lubyshev, Dimitri; Fastenau, Joel M.; Liu, Amy W. K. [IQE, Inc., 119 Technology Drive, Bethlehem, Pennsylvania 18015 (United States)

2014-06-09

Strong coupling effects and polariton lasing are observed at 155 K with an edge-emitting GaAs-based microcavity diode with a single Al{sub 0.31}Ga{sub 0.69}As/Al{sub 0.41}Ga{sub 0.59}As quantum well as the emitter. The threshold for polariton lasing is observed at 90 A/cm{sup 2}, accompanied by a reduction of the emission linewidth to 0.85 meV and a blueshift of the emission wavelength by 0.89 meV. Polariton lasing is confirmed by the observation of a polariton population redistribution in momentum space and spatial coherence. Conventional photon lasing is recorded in the same device at higher pump powers.

Effect of Cr4+ impurities in Nd:Cr:GSGG and Nd:Cr:YAG laser materials on parameters of lasers at solar pumping

International Nuclear Information System (INIS)

Payziyev, Sh.D.; Bakhramov, S.A.; Shayimov, F.F.; Fayziev, A.Sh.

2015-01-01

The analysis of an effect of Cr 4+ impurity ions, existent in Nd 3+ :Cr 3+ :GSGG and Nd 3+ :Cr 3+ :YAG laser materials on output parameters of solar pumped lasers is carried out by modeling of lasing process at solar pumping. (authors)

Upconversion channels in Er3+ ZBLALiP fluoride glass microspheres

NARCIS (Netherlands)

O'Shea, D. G.; Ward, J. M.; Shortt, B. J.; Mortier, M.; Feron, P.; Chormaic, S. Nic

We present results on the realization of a multicolour microspherical glass light source fabricated from the erbium doped fluoride glass ZBLALiP. Whispering gallery mode lasing and upconversion processes give rise to laser and fluorescent emissions at multiple wavelengths from the ultraviolet to the

Room Temperature Ultralow Threshold GaN Nanowire Polariton Laser

KAUST Repository

Das, Ayan

2011-08-01

We report ultralow threshold polariton lasing from a single GaN nanowire strongly coupled to a large-area dielectric microcavity. The threshold carrier density is 3 orders of magnitude lower than that of photon lasing observed in the same device, and 2 orders of magnitude lower than any existing room-temperature polariton devices. Spectral, polarization, and coherence properties of the emission were measured to confirm polariton lasing. © 2011 American Physical Society.

Optimum discharge current waveforms for pumping Ne-like Ar soft X-ray laser

International Nuclear Information System (INIS)

Zhao Yongpeng; Jiang Shan; Xie Yao; Teng Shupeng; Wang Qi

2011-01-01

In order to enhance intensity of Ne-like Ar 46.9 nm soft X-ray laser pumped by capillary discharge, influences of main current waveform on Z-pinch process,time of lasing onset and laser intensity were studied. Rise-time of main current waveform was changed by varying conducting inductance of main switch. Experimental results with different rise-times show that amplitude of laser spike decreases with increasing rise-time,and time of lasing onset increases with increasing rise-time. In addition, influences of average current changing rate on laser intensity were studied. When inner diameter of capillary is 3 mm and initial pressure is 30 Pa, optimum average current changing rate is about 7.0 x 10 11 A/s. (authors)

SPECIAL ISSUE DEVOTED TO THE 25th ANNIVERSARY OF THE A.M. PROKHOROV GENERAL PHYSICS INSTITUTE: High-speed ablation of ultradeep channels by a phase-conjugate dynamically controlled passively Q-switched Nd:YAG laser

Science.gov (United States)

Basiev, T. T.; Garnov, S. V.; Klimentov, S. M.; Pivovarov, P. A.; Gavrilov, A. V.; Smetanin, S. N.; Solokhin, S. A.; Fedin, A. V.

2007-10-01

Parameters of high-speed ablation of ultradeep channels by controlled pulse trains from a single-mode phase-conjugate dynamic cavity Nd:YAG laser emitting 20-200-ns, 70-250-mJ pulses at a pulse repetition rate in a train of 40-250 kHz are studied. The optimal parameters of ablation are found, for which a long-lived region of a hot rarefied gas was maintained in the ultradeep channel, which suppressed the shielding action of the surface plasma. The control of the lasing process during ablation optimises not only the heating and plasma formation, but also the removal of the processed material in the pause between laser pulses. Adaptive regulation of lasing parameters during ablation made it possible to obtain ultradeep channels of length 8-27 mm and diameters 80-300 μm of the input and output holes in metals (aluminium, steel and Inconel 718 nickel superalloy) and ultrahard ceramics (Al2O3, AlN, SiC).

Distributed Feedback Laser Based on Single Crystal Perovskite

Science.gov (United States)

Sun, Shang; Xiao, Shumin; Song, Qinghai

2017-06-01

We demonstrate a single crystal perovskite based, with grating-structured photoresist on top, highly polarized distributed feedback laser. A lower laser threshold than the Fabry-Perot mode lasers from the same single crystal CH3NH3PbBr3 microplate was obtained. Single crystal CH3NH3PbBr3 microplates was synthesized with one-step solution processed precipitation method. Once the photoresist on top of the microplate was patterned with electron beam, the device was realized. This one-step fabrication process utilized the advantage of single crystal to the greatest extend. The ultra-low defect density in single crystalline microplate offer an opportunity for lower threshold lasing action compare with poly-crystal perovskite films. In the experiment, the lasing action based on the distributed feedback grating design was found with lower threshold and higher intensity than the Fabry-Perot mode lasers supported by the flat facets of the same microplate.

Successive composition of two laser channels upon excitation of He-Ar-Xe (2.03 μm) and Ar-Xe (1.73 μm) mixtures by uranium fission fragments

International Nuclear Information System (INIS)

Pikulev, A A; Tsvetkov, V M; Sosnin, P V; Sinyanskii, A A

2009-01-01

The operation efficiency of the scheme with successive composition of two laser channels upon excitation of the active medium by uranium-235 fission fragments is studied experimentally and numerically. For the He:Ar:Xe = 380:380:1 mixture (at a pressure of 1 atm and the lasing wavelength λ = 2.03 μm) the maximum lasing power of a double channel (1 kW) is almost twice that of a single channel (540 W). Calculations show that in the case of ideal composition (without losses on mirrors) the lasing power of the double channel can be increased to 1.2 kW. For the Ar:Xe = 380:1 mixture (the pressure is 0.5 atm, λ = 1.73 μm) the maximum lasing power of the double channel (620 W) is slightly above that of the single channel (520 W), which is caused by the losses on aluminum mirrors employed for channel doubling and by a negative effect of optical inhomogeneities. In the case of ideal composition, the lasing power can be increased to 830 W. (lasers)

Degenerate band edge laser

Science.gov (United States)

Veysi, Mehdi; Othman, Mohamed A. K.; Figotin, Alexander; Capolino, Filippo

2018-05-01

We propose a class of lasers based on a fourth-order exceptional point of degeneracy (EPD) referred to as the degenerate band edge (DBE). EPDs have been found in parity-time-symmetric photonic structures that require loss and/or gain; here we show that the DBE is a different kind of EPD since it occurs in periodic structures that are lossless and gainless. Because of this property, a small level of gain is sufficient to induce single-frequency lasing based on a synchronous operation of four degenerate Floquet-Bloch eigenwaves. This lasing scheme constitutes a light-matter interaction mechanism that leads also to a unique scaling law of the laser threshold with the inverse of the fifth power of the laser-cavity length. The DBE laser has the lowest lasing threshold in comparison to a regular band edge laser and to a conventional laser in cavities with the same loaded quality (Q ) factor and length. In particular, even without mirror reflectors the DBE laser exhibits a lasing threshold which is an order of magnitude lower than that of a uniform cavity laser of the same length and with very high mirror reflectivity. Importantly, this novel DBE lasing regime enforces mode selectivity and coherent single-frequency operation even for pumping rates well beyond the lasing threshold, in contrast to the multifrequency nature of conventional uniform cavity lasers.

Vlijanie dizajna geterostruktury na porog generacii lazera s mnozhestvennymi kvantovymi jamami InGaN/GaN na kremnii

DEFF Research Database (Denmark)

Andryieuski, Andrei

2008-01-01

This article is devoted to the investigation of the influence of heterostructure design on lasing characteristics of the InGaN/GaN multiple quantum well laser on silicon substrate, performed by computer modelling. It is shown that heterogeneity in a growth process can lead to different far-field ...

Stability of quantum-dot excited-state laser emission under simultaneous ground-state perturbation

Energy Technology Data Exchange (ETDEWEB)

Kaptan, Y., E-mail: yuecel.kaptan@physik.tu-berlin.de; Herzog, B.; Schöps, O.; Kolarczik, M.; Woggon, U.; Owschimikow, N. [Institut für Optik und Atomare Physik, Technische Universität Berlin, Berlin (Germany); Röhm, A.; Lingnau, B.; Lüdge, K. [Institut für Theoretische Physik, Technische Universität Berlin, Berlin (Germany); Schmeckebier, H.; Arsenijević, D.; Bimberg, D. [Institut für Festkörperphysik, Technische Universität Berlin, Berlin (Germany); Mikhelashvili, V.; Eisenstein, G. [Technion Institute of Technology, Faculty of Electrical Engineering, Haifa (Israel)

2014-11-10

The impact of ground state amplification on the laser emission of In(Ga)As quantum dot excited state lasers is studied in time-resolved experiments. We find that a depopulation of the quantum dot ground state is followed by a drop in excited state lasing intensity. The magnitude of the drop is strongly dependent on the wavelength of the depletion pulse and the applied injection current. Numerical simulations based on laser rate equations reproduce the experimental results and explain the wavelength dependence by the different dynamics in lasing and non-lasing sub-ensembles within the inhomogeneously broadened quantum dots. At high injection levels, the observed response even upon perturbation of the lasing sub-ensemble is small and followed by a fast recovery, thus supporting the capacity of fast modulation in dual-state devices.

Fiber-Type Random Laser Based on a Cylindrical Waveguide with a Disordered Cladding Layer.

Science.gov (United States)

Zhang, Wei Li; Zheng, Meng Ya; Ma, Rui; Gong, Chao Yang; Yang, Zhao Ji; Peng, Gang Ding; Rao, Yun Jiang

2016-05-25

This letter reports a fiber-type random laser (RL) which is made from a capillary coated with a disordered layer at its internal surface and filled with a gain (laser dye) solution in the core region. This fiber-type optical structure, with the disordered layer providing randomly scattered light into the gain region and the cylindrical waveguide providing confinement of light, assists the formation of random lasing modes and enables a flexible and efficient way of making random lasers. We found that the RL is sensitive to laser dye concentration in the core region and there exists a fine exponential relationship between the lasing intensity and particle concentration in the gain solution. The proposed structure could be a fine platform of realizing random lasing and random lasing based sensing.

Energy spectrum and thermal properties of a terahertz quantum-cascade laser based on the resonant-phonon depopulation scheme

Energy Technology Data Exchange (ETDEWEB)

Khabibullin, R. A., E-mail: khabibullin@isvch.ru; Shchavruk, N. V.; Klochkov, A. N.; Glinskiy, I. A.; Zenchenko, N. V.; Ponomarev, D. S.; Maltsev, P. P. [Russian Academy of Sciences, Institute of Ultrahigh Frequency Semiconductor Electronics (Russian Federation); Zaycev, A. A. [National Research University of Electronic Technology (MIET) (Russian Federation); Zubov, F. I.; Zhukov, A. E.; Cirlin, G. E.; Alferov, Zh. I. [Russian Academy of Sciences, Saint Petersburg Academic University—Nanotechnology Research and Education Center (Russian Federation)

2017-04-15

The dependences of the electronic-level positions and transition oscillator strengths on an applied electric field are studied for a terahertz quantum-cascade laser (THz QCL) with the resonant-phonon depopulation scheme, based on a cascade consisting of three quantum wells. The electric-field strengths for two characteristic states of the THz QCL under study are calculated: (i) “parasitic” current flow in the structure when the lasing threshold has not yet been reached; (ii) the lasing threshold is reached. Heat-transfer processes in the THz QCL under study are simulated to determine the optimum supply and cooling conditions. The conditions of thermocompression bonding of the laser ridge stripe with an n{sup +}-GaAs conductive substrate based on Au–Au are selected to produce a mechanically stronger contact with a higher thermal conductivity.

Design of all solid state tunable single-mode Ti: sapphire laser for nuclear industry

International Nuclear Information System (INIS)

Lee, J.H.; Nam, S.M.; Lee, Y.J.; Lee, J.M.; Horn, Roland E.; Wendt, Klaus

1999-01-01

We designed a Ti:Sapphire laser pumped by a diode laser pumped solid state laser (DPSSL). The DPSSL was intra-cavity frequency doubled and it had 20 W output power. The Ti:Sapphire laser was designed for single longitudinal mode lasing. For single mode lasing, the laser used several solid etalons. We simulated temporal evolution of the laser pulse and single pass amplification rate of the photons in each modes from rate equations. From the result, we found that single mode lasing is viable in this cavity

Lasing with FELIX

International Nuclear Information System (INIS)

Amersfoort, P.W. van; Bakker, R.J.; Geer, C.A.J. van der; Jaroszynski, D.A.; Meer, A.F.G. van der; Oepts, D.

1992-01-01

The Free Electron Laser for Infrared eXperiments (FELIX) has produced the first laser radiation in the summer of 1991. This made FELIX the first infrared FEL in Europe to come on the air. Results obtained during the first half year of operation, such as measurements of the output power, tunability, the spectrum, and the stability, in relation with the performance of the electron accelerator are described. (author) 5 refs.; 5 figs

Tm-Yb Doped Optical Fiber Performance with Variation of Host-Glass Composition

Directory of Open Access Journals (Sweden)

Anirban Dhar

2014-01-01

Full Text Available The fabrication process of Thulium-Ytterbium doped optical fiber comprising different host glass through the Modified Chemical Vapor Deposition (MCVD coupled with solution doping technique is presented. The material and optical performance of different fibers are compared with special emphasis on their lasing efficiency for 2 µm application.

Lasing transition at 1.06 μm emission in Nd3+ -doped borate-based tellurium calcium zinc niobium oxide glasses for high-power solid-state lasers.

Science.gov (United States)

Ravi, O; Prasad, K; Jain, Rajiv; Venkataswamy, M; Chaurasia, Shivanand; Deva Prasad Raju, B

2017-08-01

The spectroscopic properties of Tellurium Calcium Zinc Niobium oxide Borate (TCZNB) glasses of composition (in mol%) 10TeO 2  + 15CaO + 5ZnO + 10 Nb 2 O 5  + (60 - x)B 2 O 3  + Nd 2 O 3 (x = 0.1, 0.5, 1.0 or 1.5 mol%) have been investigated experimentally. The three phenomenological intensity parameters Ω 2 , Ω 4, Ω 6 have been calculated using the Judd-Ofelt theory and in turn radiative properties such as radiative transition probabilities, emission cross-sections, branching ratios and radiative lifetimes have been estimated. The trend found in the JO intensity parameter is Ω 2  > Ω 6  > Ω 4 If Ω 6  > Ω 4 , the glass system is favourable for the laser emission 4 F 3 /2  →  4 I 11 /2 in the infrared (IR) wavelength. The experimental values of branching ratio of 4 F 3 /2  →  4 I 11 /2 transition indicate favourable lasing action with low threshold power. The evaluated total radiative transition probabilities (A T ), stimulated emission cross-section (σ e ) and gain bandwidth parameters (σ e  × Δλ p ) were compared with earlier reports. An energy level analysis has been carried out considering the experimental energy positions of the absorption and emission bands. Copyright © 2016 John Wiley & Sons, Ltd.

Optically Pumped Carbon Monoxide Cascade Laser

National Research Council Canada - National Science Library

Sawruk, Nicholas W

2005-01-01

...) overtone band of the CO, which induced lasing on the (3,2) and (2,1) bands around 4.7um. The laser output was spectrally separated to determine the spectral and temporal evolution of the CO lasing pulse...

Evaluation of primary tooth enamel surface morphology and microhardness after Nd:YAG laser irradiation and APF gel treatment--an in vitro study.

Science.gov (United States)

Banda, Naveen Reddy; Vanaja Reddy, G; Shashikiran, N D

2011-01-01

Laser irradiation and fluoride has been used as a preventive tool to combat dental caries in permanent teeth, but little has been done for primary teeth which are more prone to caries. The purpose of this study was to evaluate microhardness alterations in the primary tooth enamel after Nd-YAG laser irradiation alone and combined with topical fluoride treatment either before or after Nd-YAG laser irradiation. Ten primary molars were sectioned and assigned randomly to: control group, Nd-YAG laser irradiation, Nd-YAG lasing before APF and APF followed by Nd-YAG lasing. The groups were evaluated for microhardness. Surface morphological changes were observed using SEM. Statistical comparisons were performed. The control group's SEM showed a relatively smooth enamel surface and lasing group had fine cracks and porosities. In the lasing + fluoride group a homogenous confluent surface was seen. In the fluoride + lasing group an irregular contour with marked crack propagation was noted. There was a significant increase in the microhardness of the treatment groups. Nd-YAG laser irradiation and combined APF treatment of the primary tooth enamel gave morphologically hardened enamel surface which can be a protective barrier against a cariogenic attack.

Valgekihvade paraad / Hanneleele Kaldmaa

Index Scriptorium Estoniae

Kaldmaa, Hanneleele

2011-01-01

Tutvustus: Harris, Charlaine. Surnud, kuni jõuab öö / tõlkinud Annemari Oherd. Tallinn : Kirjastuskeskus, 2010 ; Lindqvist, John Ajvide. Lase sisse see õige / tõlkinud Kadi-Riin Haasma. Tallinn : Varrak, 2010. Ka raamatu "Lase sisse see õige" põhjal tehtud filmidest

Pramana – Journal of Physics | News

Indian Academy of Sciences (India)

Two popular methods to analyse the operation of CW CO 2 lasers use the temperature model and the rate equation model. Among the two, the latter model directly calculates the population densities in the various vibrational levels connected with the lasing action, and provides a clearer illustration of the processes involved ...

Individualized FAC on bottom tab subassemblies to minimize adhesive gap between emitter and optics

Science.gov (United States)

Sauer, Sebastian; Müller, Tobias; Haag, Sebastian; Beleke, Andreas; Zontar, Daniel; Baum, Christoph; Brecher, Christian

2017-02-01

High Power Diode Laser (HPDL) systems with short focal length fast-axis collimators (FAC) require submicron assembly precision. Conventional FAC-Lens assembly processes require adhesive gaps of 50 microns or more in order to compensate for component tolerances (e.g. deviation of back focal length) and previous assembly steps. In order to control volumetric shrinkage of fast-curing UV-adhesives shrinkage compensation is mandatory. The novel approach described in this paper aims to minimize the impact of volumetric shrinkage due to the adhesive gap between HPDL edge emitters and FAC-Lens. Firstly, the FAC is actively aligned to the edge emitter without adhesives or bottom tab. The relative position and orientation of FAC to emitter are measured and stored. Consecutively, an individual subassembly of FAC and bottom tab is assembled on Fraunhofer IPT's mounting station with a precision of +/-1 micron. Translational and lateral offsets can be compensated, so that a narrow and uniform glue gap for the consecutive bonding process of bottom tab to heatsink applies (Figure 4). Accordingly, FAC and bottom tab are mounted to the heatsink without major shrinkage compensation. Fraunhofer IPT's department assembly of optical systems and automation has made several publications regarding active alignment of FAC lenses [SPIE LASE 8241-12], volumetric shrinkage compensation [SPIE LASE 9730-28] and FAC on bottom tab assembly [SPIE LASE 9727-31] in automated production environments. The approach described in this paper combines these and is the logical continuation of that work towards higher quality of HPDLs.

High-power microcavity lasers based on highly erbium-doped sol-gel aluminosilicate glasses

International Nuclear Information System (INIS)

Le Ngoc Chung; Chu Thi Thu Ha; Nguyen Thu Trang; Pham Thu Nga; Pham Van Hoi; Bui Van Thien

2006-01-01

High-power whispering-gallery-mode (WGM) lasing from highly erbium-doped sol-gel aluminosilicate microsphere cavity coupled to a half-tapered optical fiber is presented. The lasing output power as high as 0.45 mW (-3.5 dBm) was obtained from sol-gel glass microsphere cavity with diameters in the range of 40-150 μm. The sol-gel method for making highly concentration Er-doped aluminosilicate glasses with Er-ion concentrations from 0.125 to 0.65 mol% of Er 3+ is described. Controlling collected lasing wavelength at each WGM is possible by adjusting the distance between the half-taper fiber and the microcavity and by diameter of the waist of half-taper fiber. Using the analytic formulas we calculated the TE and TM lasing modes and it is shown that the experimental results are in good agreement with the calculation prediction

Visible laser radiation from color centers brought on α-Al2O3 by fast electrons

International Nuclear Information System (INIS)

Arutyunyan, V.V.; Gevorkyan, V.A.; Ezoyan, R.K.; Eritsyan, G.N.; Sarkisov, V.Kh.

1988-01-01

A lamp-pumped lasing from colour centres brought on corundum crystals by 50 MeV electrons is reported. Lasing is observed only in an active element sample with C 3 -vector perpendicular l-vector - orientation. The lasing-action threshold was 1200 j. To find out the reasons for the dependence of lasing from the crystal axis C 3 -vector the absorption, excitation and luminescence spectra of crystals bombarded by different doses of fast electrons and with different thermal annealing are investigated. The results of investigation of spectra of additional absorption within the range 400-600 nm, luminescence excitation registered at the wavelength 560 nm and photoluminescence excitation registered at the wavelength 460 nm (F 2 + -centre) are presented. In the luminescence spectrum there are three bands with maxima near 560, 610, 710 nm and a narrow one at 695 nm resulting from uncontrollable admixture Cr 3+ ions. 3 refs.; 3 figs

Design and Characterisation of III-V Semiconductor Nanowire Lasers

Science.gov (United States)

Saxena, Dhruv

The development of small, power-efficient lasers underpins many of the technologies that we utilise today. Semiconductor nanowires are promising for miniaturising lasers to even smaller dimensions. III-V semiconductors, such as Gallium Arsenide (GaAs) and Indium Phosphide (InP), are the most widely used materials for optoelectronic devices and so the development of nanowire lasers based on these materials is expected to have technologically significant outcomes. This PhD dissertation presents a comprehensive study of the design of III-V semiconductor nanowire lasers, with bulk and quantum confined active regions. Based on the design, various III-V semiconductor nanowire lasers are demonstrated, namely, GaAs nanowire lasers, GaAs/AlGaAs multi-quantum well (MQW) nanowire lasers and InP nanowire lasers. These nanowire lasers are shown to operate at room temperature, have low thresholds, and lase from different transverse modes. The structural and optoelectronic quality of nanowire lasers are characterised via electron microscopy and photoluminescence spectroscopic techniques. Lasing is characterised in all these devices by optical pumping. The lasing characteristics are analysed by rate equation modelling and the lasing mode(s) in these devices is characterised by threshold gain modelling, polarisation measurements and Fourier plane imaging. Firstly, GaAs nanowire lasers that operate at room temperature are demonstrated. This is achieved by determining the optimal nanowire diameter to reduce threshold gain and by passivating nanowires to improve their quantum efficiency (QE). High-quality surface passivated GaAs nanowires of suitable diameters are grown. The growth procedure is tailored to improve both QE and structural uniformity of nanowires. Room-temperature lasing is demonstrated from individual nanowires and lasing is characterised to be from TM01 mode by threshold gain modelling. To lower threshold even further, nanowire lasers with GaAs/AlGaAs coaxial multi

A dye center laser pumped by emission from copper vapor and dye lasers

Energy Technology Data Exchange (ETDEWEB)

Loktyushin, A A; Chernyshev, A I; Soldatov, A N; Sukhanov, V B; Troitskiy, V O

1983-01-01

LiF:F2+ lasing is reported for the case of pumping by total emission with frequencies of 570.6 and 578.2 nanometers or by a single yellow copper vapor laser line and emission from an oxazene-17 dye laser excited by emission from a Cu laser. Lasing with a mean power level of 23 milliwatts with a maximum at 911 nanometers is obtained. The maximum efficiency was 3.4 percent with pumping of the dye centers by emission from the yellow Cu laser line. The lasing characteristics of the laser for all the types of pumping used are given.

Controlling the gain contribution of background emitters in few-quantum-dot microlasers

Science.gov (United States)

Gericke, F.; Segnon, M.; von Helversen, M.; Hopfmann, C.; Heindel, T.; Schneider, C.; Höfling, S.; Kamp, M.; Musiał, A.; Porte, X.; Gies, C.; Reitzenstein, S.

2018-02-01

We provide experimental and theoretical insight into single-emitter lasing effects in a quantum dot (QD)-microlaser under controlled variation of background gain provided by off-resonant discrete gain centers. For that purpose, we apply an advanced two-color excitation concept where the background gain contribution of off-resonant QDs can be continuously tuned by precisely balancing the relative excitation power of two lasers emitting at different wavelengths. In this way, by selectively exciting a single resonant QD and off-resonant QDs, we identify distinct single-QD signatures in the lasing characteristics and distinguish between gain contributions of a single resonant emitter and a countable number of off-resonant background emitters to the optical output of the microlaser. Our work addresses the important question whether single-QD lasing is feasible in experimentally accessible systems and shows that, for the investigated microlaser, the single-QD gain needs to be supported by the background gain contribution of off-resonant QDs to reach the transition to lasing. Interestingly, while a single QD cannot drive the investigated micropillar into lasing, its relative contribution to the emission can be as high as 70% and it dominates the statistics of emitted photons in the intermediate excitation regime below threshold.

The spectral analysis and threshold limits of quasi-supercontinuum self-assembled quantum dot interband lasers

KAUST Repository

Tan, Cheeloon

2009-09-01

This paper presents a theoretical model to explain the quasi-supercontinuum interband emission from InGaAs/GaAs self-assembled semiconductor quantum dot lasers by accounting for both inhomogeneous and homogeneous optical gain broadening. The experimental and theoretical agreement of a room temperature (293 K) broadband laser emission confirms the presence of multiple-state lasing actions in highly inhomogeneous dot ensembles. The corresponding full-width half-maximum of the photoluminescence is 76 meV as opposed to those wideband lasing coverage at only low temperature (∼60 K) from typical quantum dot lasers. A newly proposed change of homogeneous broadening with injection that occurs only in highly inhomogeneous quantum dot system is critical to account for the continuous wideband lasing but not the conventional ideas of carrier dynamics in semiconductor lasers. In addition, the analysis of threshold conditions reveals that broadband lasing only occurs when the energy spacing between quantized energy states is comparable to the inhomogeneous broadening of quantum-dot nanostructures. The study is important in providing a picture of this novel device and realization of broad lasing coverage for diverse applications, especially in the research field of short-pulse generation and ultra-fast phenomena in semiconductor quantum-dot laser. © 2009 IEEE.

CONTROL OF LASER RADIATION PARAMETERS: Influence of feedback loop characteristics on the field structure in a phase-conjugating ring mirror

Science.gov (United States)

Esayan, A. A.; Zozulya, A. A.; Tikhonchuk, Vladimir T.

1991-10-01

An analysis is made of stimulated scattering in a ring resonator formed by a self-intersecting beam with simultaneous rotation and contraction of the beam due to feedback. Conditions for the excitation of lasing are obtained and the phase conjugation quality is determined near the lasing threshold.

Solar pumped laser

Science.gov (United States)

Lee, J. H.; Hohl, F.; Weaver, W. R. (Inventor)

1984-01-01

A solar pumped laser is described in which the lasant is a gas that will photodissociate and lase when subjected to sunrays. Sunrays are collected and directed onto the gas lasant to cause it to lase. Applications to laser propulsion and laser power transmission are discussed.

Laser systems configured to output a spectrally-consolidated laser beam and related methods

Science.gov (United States)

Koplow, Jeffrey P [San Ramon, CA

2012-01-10

A laser apparatus includes a plurality of pumps each of which is configured to emit a corresponding pump laser beam having a unique peak wavelength. The laser apparatus includes a spectral beam combiner configured to combine the corresponding pump laser beams into a substantially spatially-coherent pump laser beam having a pump spectrum that includes the unique peak wavelengths, and first and second selectively reflective elements spaced from each other to define a lasing cavity including a lasing medium therein. The lasing medium generates a plurality of gain spectra responsive to absorbing the pump laser beam. Each gain spectrum corresponds to a respective one of the unique peak wavelengths of the substantially spatially-coherent pump laser beam and partially overlaps with all other ones of the gain spectra. The reflective elements are configured to promote emission of a laser beam from the lasing medium with a peak wavelength common to each gain spectrum.

On pulse duration of self-terminating lasers

International Nuclear Information System (INIS)

Bokhan, P A

2011-01-01

The problem of the maximum pulse duration τ max of self-terminating lasers is considered. It is shown that the duration depends on the transition probability in the laser channel, on the decay rate of the resonant state in all other channels, and on the excitation rate of the metastable state. As a result, τ max is found to be significantly shorter than previously estimated. The criteria for converting the 'self-terminating' lasing to quasi-cw lasing are determined. It is shown that in the case of nonselective depopulation of the metastable state, for example in capillary lasers or in a fast flow of the active medium gas, it is impossible to obtain continuous lasing. Some concrete examples are considered. It is established that in several studies of barium vapour lasers (λ = 1.5 μm) and nitrogen lasers (λ = 337 nm), collisional lasing is obtained by increasing the relaxation rate of the metastable state in collisions with working particles (barium atoms and nitrogen molecules). (lasers)

Closed cycle gas dynamic laser

International Nuclear Information System (INIS)

Pinsley, E.A.

1975-01-01

The device includes a closed cycle gasdynamic laser wherein the lasing fluid is recirculated in a closed loop. The closed loop includes a nozzle array, a lasing cavity and a diffuser. The exit of the diffuser is connected to the inlet to the nozzle array with a fuel heat exchanger located in the lasing flow and a pumping means located between the heat exchanger and the nozzle array. To provide for cooling of the pumping means and to improve diffuser performance, gas bled from the diffuser is cooled by two heat exchangers and pumped into cooling passages in the pumping means. The heat exchangers for cooling the flow to the pumping means are located in series and carry fuel from a supply to an injector in said combustor and the heat exchanger in the lasing flow cools the fluid and carries the fuel from a supply to an injector in said combustor. (U.S.)

PicoGreen dye as an active medium for plastic lasers

Science.gov (United States)

Pradeep, C.; Vallabhan, C. P. G.; Radhakrishnan, P.; Nampoori, V. P. N.

2015-08-01

Deoxyribonucleic acid lipid complex thin films are used as a host material for laser dyes. We tested PicoGreen dye, which is commonly used for the quantification of single and double stranded DNA, for its applicability as lasing medium. PicoGreen dye exhibits enhanced fluorescence on intercalation with DNA. This enormous fluorescence emission is amplified in a planar microcavity to achieve yellow lasing. Here the role of DNA is not only a host medium, but also as a fluorescence dequencher. With the obtained results we have ample reasons to propose PicoGreen dye as a lasing medium, which can lead to the development of DNA based bio-lasers.

Proton-Controlled Organic Microlaser Switch.

Science.gov (United States)

Gao, Zhenhua; Zhang, Wei; Yan, Yongli; Yi, Jun; Dong, Haiyun; Wang, Kang; Yao, Jiannian; Zhao, Yong Sheng

2018-05-25

Microscale laser switches have been playing irreplaceable roles in the development of photonic devices with high integration levels. However, it remains a challenge to switch the lasing wavelengths across a wide range due to relatively fixed energy bands in traditional semiconductors. Here, we report a strategy to switch the lasing wavelengths among multiple states based on a proton-controlled intramolecular charge-transfer (ICT) process in organic dye-doped flexible microsphere resonant cavities. The protonic acids can effectively bind onto the ICT molecules, which thus enhance the ICT strength of the dyes and lead to a red-shifted gain behavior. On this basis, the gain region was effectively modulated by using acids with different proton-donating ability, and as a result, laser switching among multiple wavelengths was achieved. The results will provide guidance for the rational design of miniaturized lasers with performances based on the characteristic of organic optoelectronic materials.

Light amplification by seeded Kerr instability

Science.gov (United States)

Vampa, G.; Hammond, T. J.; Nesrallah, M.; Naumov, A. Yu.; Corkum, P. B.; Brabec, T.

2018-02-01

Amplification of femtosecond laser pulses typically requires a lasing medium or a nonlinear crystal. In either case, the chemical properties of the lasing medium or the momentum conservation in the nonlinear crystal constrain the frequency and the bandwidth of the amplified pulses. We demonstrate high gain amplification (greater than 1000) of widely tunable (0.5 to 2.2 micrometers) and short (less than 60 femtosecond) laser pulses, up to intensities of 1 terawatt per square centimeter, by seeding the modulation instability in an Y3Al5O12 crystal pumped by femtosecond near-infrared pulses. Our method avoids constraints related to doping and phase matching and therefore can occur in a wider pool of glasses and crystals even at far-infrared frequencies and for single-cycle pulses. Such amplified pulses are ideal to study strong-field processes in solids and highly excited states in gases.

Gas dynamic laser having shutter doors

International Nuclear Information System (INIS)

Olinger, J.B. Jr.; Wahl, R.L.

1975-01-01

A gas dynamic laser is shown wherein gases containing constituents necessary to obtain a lasing action are passed through a nozzle array and directed into a lasing cavity and through a diffuser to an exit. An opening is located on each side of said lasing cavity with a shutter box outside of said cavity having a shutter door for opening or closing said opening. A mirror box is located behind each shutter box and contains a mirror. These mirrors are aligned with the openings in the lasing cavity with each door positioned between an opening and a mirror. Another outlet opening is positioned downstream of the first opening which provides an outlet opening for a laser beam. A shutter box is located around this opening and also houses a shutter door for opening and closing said opening. The mirror box which extends behind this shutter box includes opening means for permitting the output beam to pass through an aerodynamic window to atmosphere. Actuating means are provided for rapidly opening and closing said shutter doors. Bearing means including recirculating balls are located on the top and bottom of each shutter door to ride in tracks at an angle to the sealing surface on the laser device. Vacuum means are provided to reduce the pressure in the shutter box and mirror box independently of the pressure in the lasing cavity

Possibilities for achieving x-ray lasing action by use of high-order multiphoton processes

International Nuclear Information System (INIS)

Clark, C.W.; Littman, M.G.; McIlrath, T.J.; Miles, R.; Skinner, C.H.; Suckewer, S.; Valeo, E.

1985-12-01

We consider some possible mechanisms for producing gain in the 10 nm spectral region. They involve the creation of a population inversion in a confined plasma column by selective excitation of multicharged ions via absorption of many (>10) ultraviolet photons. Specific treatment is made of Kr-like ions pumped by a KrF excimer laser. 27 refs., 5 figs

Closed cycle device

International Nuclear Information System (INIS)

Ruby, L.E.; Witt, D.L.; Staley, C.F.

1975-01-01

A gas dynamic laser wherein the lasing fluid is recirculated in a closed loop is described. The flow can be assumed to start with the lasing gas passing through a cascade of supersonic nozzles. This low pressure, high velocity gas is then passed through a lasing cavity where the lasing action takes place. The energy of the high velocity gas stream is converted back to static pressure in a supersonic diffuser. The diffuser is constructed with (1) variable geometry, and (2) provisions for bleeding off the boundary layer for improved efficiency. Downstream of the supersonic diffuser there is a heat exchanger which partially cools the gas in the loop. This partially cooled gas is then supplied to a compressor where the pressure and temperature are raised back to the level at the start of the flow. The lasing gas is directed from the exit of the compressor to a manifold upstream of the cascade of supersonic nozzles. The compressor only supplies a pressure rise equal to the pressure loss by inefficiencies in the nozzle, the supersonic diffuser and the pressure drop in the heatexchanger and plumbing. To provide for cooling of the compressor, the gas bled from the diffuser is cooled by a second heat exchanger and pumped back to compressor inlet pressure and introduced into the compressor for cooling. In steady state operation, both heat exchangers referred to above, are designed to regulatethe nozzle inlet gas temperature by removing the amount of heat energy added by compressing minus the amount of energy extracted in the lasing beam and energy lost to the environment. The compressor and pumping means for cooling the compressor can be driven by any means desired. (U.S.)

Laser action benzimidazoles in various aggregate states

Science.gov (United States)

Gruzinskii, V. V.; Degtiarenko, K. M.; Shalaev, V. K.; Kopylova, T. N.; Verkhovskii, V. S.; Tarasenko, V. F.; Melchenko, S. V.

1983-04-01

Lasing has been obtained in solutions of benzimidazole (Bi) derivatives: 2-phenyl-Bi (with the band maximum lambda-r-max = 341-347 nm), 2-n-tolyl-Bi (344 nm), and 2-(4'-biphenilyl) Bi (366-374 nm). It is found that compounds of this class provide a basis for laser radiation covering a wide region of the spectrum. Lasing has been obtained on the vapors of 2-(4'-biphenilyl) Bi (361.2 nm) and 2-(n-tolyl) Bi (336.5 nm) with a pentane stabilizer of the excited states. High volatility, photostability, and lasing in wide ranges of concentration determine the efficiency of using this new class of compounds (chain arylbenzimidazoles) in lasers using the vapors of complex molecules.

Laser action benzimidazoles in various aggregate states

Energy Technology Data Exchange (ETDEWEB)

Gruzinskii, V V; Degtiarenko, K M; Shalaev, V K; Kopylova, T N; Verkhovskii, V S; Tarasenko, V F; Melchenko, S V

1983-04-01

Lasing has been obtained in solutions of benzimidazole (Bi) derivatives: 2-phenyl-Bi (with the band maximum lambda-r-max 341-347 nm), 2-n-tolyl-Bi (344 nm), and 2-(4'-biphenilyl) Bi (366-374 nm). It is found that compounds of this class provide a basis for laser radiation covering a wide region of the spectrum. Lasing has been obtained on the vapors of 2-(4'-biphenilyl) Bi (361.2 nm) and 2-(n-tolyl) Bi (336.5 nm) with a pentane stabilizer of the excited states. High volatility, photostability, and lasing in wide ranges of concentration determine the efficiency of using this new class of compounds (chain arylbenzimidazoles) in lasers using the vapors of complex molecules.

Photoluminescence and lasing in whispering gallery mode glass microspherical resonators

Energy Technology Data Exchange (ETDEWEB)

Ristić, D. [Ruđer Bošković Institute, Division of Materials Physics, Laboratory for Molecular Physics, Bijenička c. 54, Zagreb (Croatia); Center of Excellence for Advanced Materials and Sensing Devices, Research unit New Functional Materials, Bijenička c. 54, Zagreb (Croatia); Berneschi, S.; Camerini, M. [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Farnesi, D.; Pelli, S. [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Centro Studi e Ricerche ' E. Fermi' , Piazza del Viminale 2, 00184 Roma (Italy); Trono, C. [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Chiappini, A.; Chiasera, A.; Ferrari, M. [CSMFO Group, Istituto di Fotonica e Nanotecnologie, IFN-CNR, Via alla Cascata 56/C, 38050 Povo-Trento (Italy); Lukowiak, A. [Institute of Low Temperature and Structure Research, PAS, ul. Okolna 2, Wroclaw 50-950 (Poland); Dumeige, Y.; Féron, P. [Laboratoire d' Optronique, (CNRS-UMR 6082-Foton), ENSSAT, 6 rue de Kérampont, 22300 Lannion (France); Righini, G.C. [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Centro Studi e Ricerche ' E. Fermi' , Piazza del Viminale 2, 00184 Roma (Italy); Soria, S., E-mail: s.soria@ifac.cnr.it [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Conti, G. Nunzi [IFAC-CNR Istituto di Fisica Applicata, Via Madonna del Piano 10, 50019 Sesto Fiorentino (Italy); Centro Studi e Ricerche ' E. Fermi' , Piazza del Viminale 2, 00184 Roma (Italy)

2016-02-15

We report experimental results regarding the development of Er{sup 3+}-doped glass microspherical cavities for the fabrication of compact sources at 1.55 μm. We investigate several different approaches in order to fabricate the microspheres including direct melting of Er{sup 3+}-doped glass powders, synthesis of Er{sup 3+}-doped monolithic microspheres by drawing Er{sup 3+}-doped glass, and coating of silica microspheres with an Er{sup 3+}-doped sol–gel layer. Details of the different fabrication processes are presented together with the photoluminescence characterization in free space configuration of the microspheres and of the glass precursor. We have analyzed the photoluminescence spectra of the whispering gallery modes of the microspheres excited using evanescent coupling and we demonstrate tunable laser action in a wide range of wavelengths around 1.55 μm. As much as 90 μW of laser output power was measured in Er{sup 3+}-doped glass microspheres. - Highlights: • Different approaches in microsphere fabrication and various types of post-processing. • Trimming of photorefractive glass microsphere lasers with UV light. • Peak power record of 90 μW by pumping at 1480 nm.

Changes induced in a ZnS:Cr-based electroluminescent waveguide structure by intrinsic near-infrared laser radiation

International Nuclear Information System (INIS)

Vlasenko, N. A.; Oleksenko, P. F.; Mukhlyo, M. A.; Veligura, L. I.

2013-01-01

The causes of changes that occur in a thin-film electroluminescent metal-insulator-semiconductor-insulator-metal waveguide structure based on ZnS:Cr (Cr concentration of ∼4 × 10 20 cm −3 ) upon lasing (λ ≈ 2.6 μm) and that induce lasing cessation are studied. It is established that lasing ceases because of light-scattering inhomogeneities formed in the structure and, hence, optical losses enhance. The origin of the inhomogeneities and the causes of their formation are clarified by studying the surface topology and the crystal structure of constituent layers of the samples before and after lasing. The studies are performed by means of atomic force microscopy and X-ray radiography. It is shown that a substantial increase in the sizes of grains on the surface of the structure is the manifestation of changes induced in the ZnS:Cr film by recrystallization. Recrystallization is initiated by local heating by absorbed laser radiation in existing Cr clusters and quickened by a strong electric field (>1 MV cm −1 ). The changes observed in the ZnS:Cr film are as follows: the textured growth of ZnS crystallites, an increase in the content of Cr clusters, and the appearance of some CrS and a rather high ZnO content. Some ways for improving the stability of lasing in the ZnS:Cr-based waveguide structures are proposed

Plasmon-exciton-polariton lasing

NARCIS (Netherlands)

Ramezani, M.; Halpin, A.; Fernández-Dominguez, A.I.; Feist, J.; Rodriguez, S.R.K.; Gómez-Rivas, J.; Garcia-Vidal, F.J.

2016-01-01

Strong coupling of Frenkel excitons with surface plasmons leads to the formation of bosonic quasi-particles known as plasmon-exciton-polaritons (PEPs).Localized surface plasmons in nanoparticles are lossy due to radiative and nonradiative decays, which has hampered the realization of polariton

Plasmon exciton-polariton lasing

NARCIS (Netherlands)

Ramezani, M.; Halpin, H.A.; Feist, J.; Fernández-Dominguez, A.; Rodriguez, S.R.K.; Garcia-Vidal, F.J.; Gomez-Rivas, J.

2017-01-01

Strong light-matter interaction leads to the appearance of new states, i.e. exciton-polaritons, with photophysical properties rather distinct from their constituents. Recent developments in fabrication techniques allow us to make metallic structures with strong electric field confinement in

Optical gain in colloidal quantum dots achieved with direct-current electrical pumping

Science.gov (United States)

Lim, Jaehoon; Park, Young-Shin; Klimov, Victor I.

2018-01-01

Chemically synthesized semiconductor quantum dots (QDs) can potentially enable solution-processable laser diodes with a wide range of operational wavelengths, yet demonstrations of lasing from the QDs are still at the laboratory stage. An important challenge--realization of lasing with electrical injection--remains unresolved, largely due to fast nonradiative Auger recombination of multicarrier states that represent gain-active species in the QDs. Here we present population inversion and optical gain in colloidal nanocrystals realized with direct-current electrical pumping. Using continuously graded QDs, we achieve a considerable suppression of Auger decay such that it can be outpaced by electrical injection. Further, we apply a special current-focusing device architecture, which allows us to produce high current densities (j) up to ~18 A cm-2 without damaging either the QDs or the injection layers. The quantitative analysis of electroluminescence and current-modulated transmission spectra indicates that with j = 3-4 A cm-2 we achieve the population inversion of the band-edge states.

Whispering-gallery mode microcavity quantum-dot lasers

International Nuclear Information System (INIS)

Kryzhanovskaya, N V; Maximov, M V; Zhukov, A E

2014-01-01

This review examines axisymmetric-cavity quantum-dot microlasers whose emission spectrum is determined by whisperinggallery modes. We describe the possible designs, fabrication processes and basic characteristics of the microlasers and demonstrate the possibility of lasing at temperatures above 100 °C. The feasibility of creating multichannel optical sources based on a combination of a broadband quantum-dot laser and silicon microring modulators is discussed. (review)

Functional approach to the assessment of ocular hazards of low-power lasers

Energy Technology Data Exchange (ETDEWEB)

Raybourn, M.S.; Kong, R.L.

1984-01-01

An electrophysiological bioassay system has been developed to provide safety-related information about the functional consequences of non-thermal laser irradiation of the vertebrate retina. This in vitro preparation allows precise dosimetry at the retinal surface, provides for an intra-retinal control, comparing lased vs non-lased tissue, and permits quantitative assessment of the biophysical mechanisms of laser-induced retinal dysfunction.

Diode-pumped laser with improved pumping system

Science.gov (United States)

Chang, Jim J.

2004-03-09

A laser wherein pump radiation from laser diodes is delivered to a pump chamber and into the lasing medium by quasi-three-dimensional compound parabolic concentrator light channels. The light channels have reflective side walls with a curved surface and reflective end walls with a curved surface. A flow tube between the lasing medium and the light channel has a roughened surface.

Random nanolasing in the Anderson localized regime

DEFF Research Database (Denmark)

Liu, Jin; Garcia, P. D.; Ek, Sara

2014-01-01

The development of nanoscale optical devices for classical and quantum photonics is affected by unavoidable fabrication imperfections that often impose performance limitations. However, disorder may also enable new functionalities, for example in random lasers, where lasing relies on random...... multiple scattering. The applicability of random lasers has been limited due to multidirectional emission, lack of tunability, and strong mode competition with chaotic fluctuations due to a weak mode confinement. The regime of Anderson localization of light has been proposed for obtaining stable multimode...... random lasing, and initial work concerned macroscopic one-dimensional layered media. Here, we demonstrate on-chip random nanolasers where the cavity feedback is provided by the intrinsic disorder. The strong confinement achieved by Anderson localization reduces the spatial overlap between lasing modes...

Computational model of dual q-switching and lasing processes of the pulsed Cr4+:YAG laser pumped by Nd-glass laser

International Nuclear Information System (INIS)

Abdul Ghani, B.; Hammadi, M.

2007-01-01

A mathematical model describing the absorption and oscillation processes of intracavity Cr 4+ : YAG crystal pumped by Nd-glass laser has been developed, in order to describe the temporal behavior of laser-absorber system. The model has been assumed that the Cr 4+ ions excited to a higher level by excited state absorption, followed by relaxation directly to the upper laser level through fast channel, and indirectly through slow proposed intermediate channel at different lifetimes. The model offers simple kinetic mechanisms for pulsed solid state lasers and also the influence of the variations of the laser input parameters (pumping rate, maximum amplification coefficient and loss coefficient) on the output pulse characteristics of the passive Q-switched Nd-glass and pulsed Cr 4+ : YAG lasers. The model estimates the temporal behavior of the population densities of different levels and laser beam densities as well as predicts the nanosecond output laser pulses of passive Q-switched Nd-glass laser and pulsed Cr 4+ : YAG laser. The calculated results are in good agreement with the available experimental and theoretical data in the literature. (author)

Narrow linewidth short cavity Brillouin random laser based on Bragg grating array fiber and dynamical population inversion gratings

Science.gov (United States)

Popov, S. M.; Butov, O. V.; Chamorovski, Y. K.; Isaev, V. A.; Mégret, P.; Korobko, D. A.; Zolotovskii, I. O.; Fotiadi, A. A.

2018-06-01

We report on random lasing observed with 100-m-long fiber comprising an array of weak FBGs inscribed in the fiber core and uniformly distributed over the fiber length. Extended fluctuation-free oscilloscope traces highlight power dynamics typical for lasing. An additional piece of Er-doped fiber included into the laser cavity enables a stable laser generation with a linewidth narrower than 10 kHz.

Metal atom oxidation laser

International Nuclear Information System (INIS)

Jensen, R.J.; Rice, W.W.; Beattie, W.H.

1975-01-01

A chemical laser which operates by formation of metal or carbon atoms and reaction of such atoms with a gaseous oxidizer in an optical resonant cavity is described. The lasing species are diatomic or polyatomic in nature and are readily produced by exchange or other abstraction reactions between the metal or carbon atoms and the oxidizer. The lasing molecules may be metal or carbon monohalides or monoxides

Hollow Core Optical Fiber Gas Lasers: Toward Novel and Practical Systems in Fused Silica

Science.gov (United States)

2017-05-18

Hollow core Optically pumped Fiber Gas LASer’s (HOFGLAS’s) based on population inversion combine advantages of fiber lasers such as long interaction...polarization dependent fiber properties. Preliminary experiments were performed toward simultaneous lasing in the visible and near infrared; lasing in...words) Hollow core Optically pumped Fiber Gas LASer’s (HOFGLAS’s) based on population inversion combine advantages of fiber lasers such as long

Phonon induced optical gain in a current carrying two-level quantum dot

Energy Technology Data Exchange (ETDEWEB)

Eskandari-asl, Amir, E-mail: amir.eskandari.asl@gmail.com [Department of Physics, Shahid Beheshti University, G.C. Evin, Tehran 1983963113 (Iran, Islamic Republic of); School of Nano Science, Institute for Research in Fundamental Sciences (IPM), P.O. Box: 19395-5531, Tehran, Iran (Iran, Islamic Republic of)

2017-05-15

In this work we consider a current carrying two level quantum dot (QD) that is coupled to a single mode phonon bath. Using self-consistent Hartree-Fock approximation, we obtain the I-V curve of QD. By considering the linear response of our system to an incoming classical light, we see that depending on the parametric regime, the system could have weak or strong light absorption or may even show lasing. This lasing occurs at high enough bias voltages and is explained by a population inversion considering side bands, while the total electron population in the higher level is less than the lower one. The frequency at which we have the most significant lasing depends on the level spacing and phonon frequency and not on the electron-phonon coupling strength.

Evaluation of thermal cooling mechanisms for laser application to teeth.

Science.gov (United States)

Miserendino, L J; Abt, E; Wigdor, H; Miserendino, C A

1993-01-01

Experimental cooling methods for the prevention of thermal damage to dental pulp during laser application to teeth were compared to conventional treatment in vitro. Pulp temperature measurements were made via electrical thermistors implanted within the pulp chambers of extracted human third molar teeth. Experimental treatments consisted of lasing without cooling, lasing with cooling, laser pulsing, and high-speed dental rotary drilling. Comparisons of pulp temperature elevation measurements for each group demonstrated that cooling by an air and water spray during lasing significantly reduced heat transfer to dental pulp. Laser exposures followed by an air and water spray resulted in pulp temperature changes comparable to conventional treatment by drilling. Cooling by an air water spray with evacuation appears to be an effective method for the prevention of thermal damage to vital teeth following laser exposure.

Tunable on chip optofluidic laser

DEFF Research Database (Denmark)

Bakal, Avraham; Vannahme, Christoph; Kristensen, Anders

2016-01-01

On chip tunable laser is demonstrated by realizing a microfluidic droplet array. The periodicity is controlled by the pressure applied to two separate inlets, allowing to tune the lasing frequency over a broad spectral range.......On chip tunable laser is demonstrated by realizing a microfluidic droplet array. The periodicity is controlled by the pressure applied to two separate inlets, allowing to tune the lasing frequency over a broad spectral range....

Bistable laser device with multiple coupled active vertical-cavity resonators

Science.gov (United States)

Fischer, Arthur J.; Choquette, Kent D.; Chow, Weng W.

2003-08-19

A new class of bistable coupled-resonator vertical-cavity semiconductor laser devices has been developed. These bistable laser devices can be switched, either electrically or optically, between lasing and non-lasing states. A switching signal with a power of a fraction of a milliwatt can change the laser output of such a device by a factor of a hundred, thereby enabling a range of optical switching and data encoding applications.

Slow-light effects in photonic crystal membrane lasers

DEFF Research Database (Denmark)

Xue, Weiqi; Yu, Yi; Ottaviano, Luisa

2015-01-01

In this paper, we present a systematic investigation of photonic crystal cavity laser operating in the slow-light regime. The dependence of lasing threshold on the effect of slow-light will be particularly highlighted.......In this paper, we present a systematic investigation of photonic crystal cavity laser operating in the slow-light regime. The dependence of lasing threshold on the effect of slow-light will be particularly highlighted....

Effects of chemical kinetics and starting material regeneration on the efficiency of an iodine laser amplifier

International Nuclear Information System (INIS)

Fisk, G.A.

1977-05-01

A model of the chemical kinetics occurring in an iodine laser amplifier is presented and used to calculate the degree to which the starting material is consumed as a result of laser operation. The cost of purchasing new starting material is estimated and shown to be prohibitive. A scheme for regenerating the starting material from the species present in the amplifier after lasing is proposed. It is shown that the estimated efficiency of this chemical regeneration process is appreciably higher than the projected optimum efficiency of the pumping process

Population inversion and gain calculations for 4p54d-4p55p and 4p55s - 4p55p Kr-like transitions in Y IV, Zr V, Nb VI and Mo VII

International Nuclear Information System (INIS)

Fournier, K.B.; Goldstein, W.H.; Stutman, D.; Finkenthal, M.; Soukhanovskii, V.; May, M.J.

1999-01-01

We present calculations of the quasi-steady state gain coefficient for the 4p 5 4d 1 P-4p 5 5p 1/2[1/2] 0 transition in Kr-like Y IV, Zr V, Nb VI and Mo VII ions. Gain coefficients which can lead to FUV-VUV (∝260 to 60 nm) lasing are found in all ions. Large gain coefficients are found for each ion at temperatures in excess of the ion's equilibrium temperature; realizing lasing in these systems will require a transient excitation mechanism. The density at which the maximal gain coefficient obtains increases for increasing ionization state. The 4p 5 5s 1/2[1/2] 1 -4p 5 5p 1/2[1/2] 0 and 4p 5 5s 3/2[3/2] 1 -4p 5 5p 1/2[1/2] 0 transitions also show population inversion and modest gain coefficients. Attractive features of these ions as potential lasents are the large ratio between the energy of the lasing transition and the excitation energy of the upper level of the lasing transition as well as the case with which they are produced in a low temperature, table-top scale plasma source. (orig.)

The Effect of Diode Laser Treatment for Root Canal Disinfection on Fracture Resistance and Micro-hardness of the Tooth

International Nuclear Information System (INIS)

Elmiligy, H.H; Diab, A.H.; Sabet, N.E.; Saafan, A.M.

2014-01-01

This study evaluated the effect of diode laser treatment for root canal disinfection on fracture resistance and micro-hardness of the tooth. Sixty freshly extracted mandibular and maxillary premolars were accessed under coolant then root canals were flared up to apical preparation size 40 MFA coupled with 5.25% NaOCl as an irrigant. Teeth were divided into two groups, control group (group I) and lased group (group II) that was lased by diode laser with average power 2 w through fibrooptic into the canal 2 mm shorter than the apex. Each tooth was embedded in acrylic block, and then subjected to the fracture resistance test. Each root was then sectioned transversely and polished to record dentin Vickers hardness. Data was analysed with student t-test then with linear regression test. The Lased samples presented a significantly higher resistance to fracture than unlased samples. There was no statistically significant differences found between Vickers hardness (HV) of lased and unlased samples and there was no relation between fracture resistance and microhardness. Diode laser (980 nm) treatment had no adverse effect on dentin microhardness, also it increased the fracture resistance of dentin. Diode laser (980 nm) treatment could attain better function ability and maintenance of tooth after endodontic treatment.

Growth of GaN micro/nanolaser arrays by chemical vapor deposition.

Science.gov (United States)

Liu, Haitao; Zhang, Hanlu; Dong, Lin; Zhang, Yingjiu; Pan, Caofeng

2016-09-02

Optically pumped ultraviolet lasing at room temperature based on GaN microwire arrays with Fabry-Perot cavities is demonstrated. GaN microwires have been grown perpendicularly on c-GaN/sapphire substrates through simple catalyst-free chemical vapor deposition. The GaN microwires are [0001] oriented single-crystal structures with hexagonal cross sections, each with a diameter of ∼1 μm and a length of ∼15 μm. A possible growth mechanism of the vertical GaN microwire arrays is proposed. Furthermore, we report room-temperature lasing in optically pumped GaN microwire arrays based on the Fabry-Perot cavity. Photoluminescence spectra exhibit lasing typically at 372 nm with an excitation threshold of 410 kW cm(-2). The result indicates that these aligned GaN microwire arrays may offer promising prospects for ultraviolet-emitting micro/nanodevices.

The generation of a lower threshold multiwavelength fiber laser in the L-band region assisted by a Sagnac loop mirror

International Nuclear Information System (INIS)

Aziz, Siti Narimah; Arsad, Norhana; Bakar, Ahmad Ashrif Abu; Elias, Sayidatul Nadia; Menon, P Sushita; Shaari, Sahbudin

2015-01-01

A low threshold multiwavelength laser generated with the assistance of a Sagnac loop mirror is proposed. Two simple ring cavity designs are studied, namely a standard design ring cavity (design A) and a ring cavity with a Sagnac loop mirror (design B). Design B, which integrates a Sagnac loop mirror together with a polarization controller, exhibits the most optimum performance, generating seven lasing modes. Using only a 40 mW pump power from the erbium-doped fiber amplifier (EDFA), design B is the preferred ring cavity design, as it successfully produces seven lasing modes simultaneously within a 0.42 nm channel spacing in the L-band region. The ring cavity is characterized by investigating the lasing threshold through the tuning output power of the EDFA, the percentages of extracted power and cavity loss. (paper)

Diminuição da função do músculo levantador da pálpebra superior em pacientes submetidos à cirurgia de ptose palpebral involucional e dermatocálase Decrease of upper eyelid levator muscle function after involutional ptosis and dermatochalasis surgery

Directory of Open Access Journals (Sweden)

Eliana Forno

2008-12-01

Full Text Available OBJETIVO: Avaliar a diferença da função do músculo levantador da pálpebra superior (FMLPS, distância margem reflexo (DMR1 e altura do sulco palpebral (AS antes e depois da cirurgia de blefaroplastia superior associada à correção de ptose palpebral. MÉTODOS: Quarenta e quatro pacientes com blefaroptose e dermatocálase foram incluídos. Intervenção: exploração do tendão do músculo levantador da pálpebra superior (MLPS durante a blefaroplastia, em portadores de blefaroptose e dermatocálase. Nos casos de desinserção, o tendão foi refixado ao tarso. Desfechos analisados: foram analisados de forma bilateral a diferença entre FMLPS, DMR1 e AS antes e depois da intervenção. A dependência entre os olhos foi corrigida por meio de equações de estimativa generalizada. Foi utilizada a correlação de Pearson para quantificar a dependência entre os olhos para FMLPS, DMR1 e AS. RESULTADOS: Houve diferença significante entre as medidas de FMLPS antes e depois da cirurgia, havendo redução da excursão do MLPS após a cirurgia, diminuindo, em média, 1,1 mm (P0,01. CONCLUSÃO: A função do músculo levantador da pálpebra superior diminui após a cirurgia para a correção da ptose.PURPOSE: To evaluate the differences between upper eyelid levator muscle function (UELMF, margin reflex distance (MDR1, and eyelid crease height (ECH before and after ptosis and dermatochalasis surgery. METHODS: Forty-four patients with blepharoptosis and dermatochalasis were enrolled. Intervention: An exploration of the levator tendon (LT during a blepharoplasty procedure in patients with blepharoptosis and dermatochalasis and in case of its disinsertion, the tendon was reattached to the tarsus. Measured outcome: The differences between UELMF, MDR1, ECH before and after surgery were evaluated bilaterally. Dependency between both eyes was corrected by generalized estimating equations. Pearson correlation was used to evaluate the dependency of the two

Vertical cavity surface emitting lasers from all-inorganic perovskite quantum dots

Science.gov (United States)

Sun, Handong; Wang, Yue; Li, Xiaoming; Zeng, Haibo

We report the breakthrough in realizing the challenging while practically desirable vertical cavity surface emitting lasers (VCSELs) based on the CsPbX3 inorganic perovskite nanocrystals (IPNCs). These laser devices feature record low threshold (9 µJ/cm2), unidirectional output (beam divergence of 3.6º) and superb stability. We show that both single-mode and multimode lasing operation are achievable in the device. In contrast to traditional metal chacogenide colloidal quantum dots based lasers where the pump thresholds for the green and blue wavelengths are typically much higher than that of the red, these CsPbX3 IPNC-VCSEL devices are able to lase with comparable thresholds across the whole visible spectral range, which is appealing for achieving single source-pumped full-color lasers. We further reveal that these lasers can operate in quasi-steady state regime, which is very practical and cost-effective. Given the facile solution processibility, our CsPbX3 IPNC-VCSEL devices may hold great potential in developing low-cost yet high-performance lasers, promising in revolutionizing the vacuum-based epitaxial semiconductor lasers.

Possibility of combining nuclear level pumping in plasma with lasing in solid

International Nuclear Information System (INIS)

Karamyan, S.A.; Carroll, J.J.

2002-01-01

Nuclear isomers can be used for the storage and release of 'clean' nuclear energy, and the visible schemes are discussed. Resonance between the atomic and nuclear transitions may be manifested in a form of the hybridization of atomic-nuclear excitation at the appropriate case. The nuclear levels - candidates for triggering via atomic transitions are described. A variety of the ionization states and atomic-shell configurations arises in hot plasma generated by the short powerful pulse of laser light. The nonradiative conversion of the ionization energy within atom can be suppressed in the hot-plasma surroundings. Time-scales of different processes in nuclear, atomic and condensed-matter subsystems are compared. The processes of fast ionization in solid, X-ray radiance in plasma, sample melting and recrystallisation may precede nuclear fluorescence. Time-scale shorter 0.1 ns makes this sequence promising for the group excitation of short-lived modes in nuclear subsystem

ASPECTS CONCERNING THE ENZYMATIC ACTIVITY IN SEVERAL THERMOACTINOMYCETE STRAINS

Directory of Open Access Journals (Sweden)

Simona Dunca

2003-08-01

Full Text Available In the thermoactinomycete strains subjected to examination the values of their recorded enzymatic activities (i.e. α-amy lase, protease, exo-β-1,4 – glucanase, endo -β-1,4 – glucanase and β-glucosidase were lower in the stationary cultures as compared to the stirred ones. The strain Thermomonospora fusca BB255 was found to be highly cellulase- producing and at the same time able to synthesize α-amy lases and proteases.

Diagnostics for an XUV/soft x-ray laser

International Nuclear Information System (INIS)

Kauffman, R.L.; Matthews, D.L.; Ceglio, N.; Medecki, H.

1984-01-01

We have begun investigating the production of an XUV/soft x-ray laser, using our high-powered glass lasers as drivers. A major diagnostic for lasing is the measure of the absolute power produced in the lasing line. I have developed a spectrograph to time-resolved lasing lines in the energy range from 50 eV to greater than 200 eV. the spectrograph combines a transmission grating and x-ray streak camera to produce a flat field instrument. A cylindrical mirror is used in front of the grating to image the source and act as a collecting optic. The efficiency of the components is calibrated so that absolute intensities can be measured. I will compare the performance of this instrument with reflection grating systems. I will also discuss planned improvements to the system which should increase total throughput, image quality, and resolving power

Multimode quantum model of a cw atom laser

International Nuclear Information System (INIS)

Hope, J.J.; Haine, S.A.; Savage, C.M.

2002-01-01

Full text: Laser cooling allows dilute atomic gases to be cooled to within K of absolute zero. Ultracold gases were first achieved twenty years ago and have since found applications in areas such as spectroscopy, time standards, frequency standards, quantum information processing and atom optics. The atomic analogue of the lasing mode in optical lasers is Bose-Einstein Condensation (BEC), in which a cooled sample of atoms condense into the lowest energy quantum state. This new state of matter was recently achieved in dilute Bose gases in 1995. Atoms coupled out of a BEC exhibit long-range spatial coherence, and provide the coldest atomic source currently available. These atomic sources are called 'atom lasers' because the BEC is analogous to the lasing mode of an optical laser. The high spectral flux from optical lasers is caused by a process called gain-narrowing, which requires continuous wave (cw) operation. Coupling a BEC quickly into an untrapped state forms a coherent atomic beam but it has a spread in momentum as large as the trapped BEC. Coupling the atoms out more slowly reduces the output linewidth at the expense of reducing the overall flux. These atom lasers are equivalent to Q-switched optical lasers. A cw atom laser with gain-narrowing would produce an increasingly monoenergetic output as the flux increased, dramatically improving the spectral flux. A cw atom laser is therefore a major goal of the atom optics community, but there are several theoretical and practical obstacles to understanding the complexities of such a system. The main obstacle to the production of a cw atom laser is the technical difficulties involved in continuously pumping the lasing mode. No complete theory exists which describes a cw atom laser. Complete cw atom laser models require a quantum field description due to their non-Markovian dynamics, significant spatial effects and the dependence of the output on the quantum statistics of the lasing mode. The extreme dimensionality

Switchable lasing in multimode microcavities

DEFF Research Database (Denmark)

Zhukovsky, Sergei V.; Chigrin, Dmitry N.; Lavrinenko, Andrei

2007-01-01

can be caused by injecting an appropriate optical pulse at the onset of laser action (injection seeding). Temporal mode-to-mode switching by reseeding the cavity after a short cooldown period is demonstrated by direct numerical solution. A qualitative analytical explanation of the mode switching...

Investigation of Coronal Leakage of Root Fillings after Smear Layer Removal with EDTA or Er,Cr:YSGG Laser through Capillary Flow Porometry

Directory of Open Access Journals (Sweden)

Tom Edgard Maria Vergauwen

2014-01-01

Full Text Available No studies have been performed evaluating the marginal seal of root fillings after direct exposure of root canal (RC walls to Er,Cr:YSGG laser irradiation. Therefore, 75 root filled teeth (5 × 15–cold lateral condensation were analyzed for through-and-through leakage (TTL using capillary flow porometry (CFP. The cleaning protocol determined the experimental groups: (1 irrigation with NaOCl 2.5% and EDTA 17% or standard protocol (SP, (2 SP + Er,Cr:YSGG lasing (dried RC, (3 NaOCl 2.5% + Er,Cr:YSGG lasing (dried RC, (4 SP + Er,Cr:YSGG lasing (wet RC, and (5 NaOCl 2.5% + Er,Cr:YSGG lasing (wet RC. Groups 6 to 10 consisted of the same filled teeth with resected apices. Resection was performed after the first CFP measurement. CFP was used to assess minimum, mean flow, and maximum pore diameters after 48 h. Statistics were performed using nonparametric tests (P>0.05. Additional three roots per group were submitted to SEM of the RC walls. TTL was observed in all groups without statistically significant differences between the different groups for minimum, mean, and maximum pore diameter (P>0.05. In this study, the use of EDTA and/or Er,Cr:YSGG laser did not reduce through-and-through leakage in nonresected and resected roots.

ORF Sequence: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lase [Corynebacterium glutamicum ATCC 13032] MTVRPIVIHGDPVLHNPTQLVTEDVSELQELIADMYETMDVANGVGLAANQIGVSKRIFVYDCPDDEGVMHKGCFINPVLETSEIPET...MPADDGSDEEGCLSVPGEGFPTGRAHWAKVTGLNEKGEEVSVEAEGFLARCFQHEVGHLDGFLYTDVLIGRWKRMAKKAIKANGWTEPGLTWMPGEDEDPFGHDA

Intentionally Short Range Communications (ISRC)

Science.gov (United States)

1993-05-01

molecular oxygen in the atmosphere at 60 GHz (figure 9 LIppolito, 1981]). The MMW range is similar to that of the UV links. 3.3.1 Variable Range Similar to...option also requires that the signal be strong enough to overcome the noise from the solar and background sources, although the molecular oxygen and... emisions . Lasing will occur only within the cavity when the alignment is correct and not lasing othem ise. Such a cavity is dcteclable only when an observer

Feasibility of laser pumping with neutron fluxes from present-day large tokamaks

Energy Technology Data Exchange (ETDEWEB)

Jassby, D.L.

1986-08-01

The minimum fusion-neutron flux needed to observe nuclear-pumped lasing with tokamaks can be reduced substantially by optimizing neutron scattering into the laser cell, located between adjacent toroidal-field coils. The laser lines most readily pumped are probably the /sup 3/He-Ne lines at 0.633 ..mu.. and in the infrared, where the /sup 3/He-Ne gas is excited by energetic ions produced in the /sup 3/He(n,p)T reaction. These lines are expected to lase at the levels of D-T neutron flux foreseen for the TFTR in 1989 (>>10/sup 12/ n/cm/sup 2//s), while amplification should be observable at the existing levels of D-D neutron flux (greater than or equal to 5 x 10/sup 9/ n/cm/sup 2//s). Lasing on the 1.73 ..mu.. and 2.63 ..mu.. transitions of Xe may be observable at the maximum expected levels of D-T neutron flux in TFTR enhanced by scattering.

Feasibility of laser pumping with neutron fluxes from present-day large tokamaks

International Nuclear Information System (INIS)

Jassby, D.L.

1986-08-01

The minimum fusion-neutron flux needed to observe nuclear-pumped lasing with tokamaks can be reduced substantially by optimizing neutron scattering into the laser cell, located between adjacent toroidal-field coils. The laser lines most readily pumped are probably the 3 He-Ne lines at 0.633 μ and in the infrared, where the 3 He-Ne gas is excited by energetic ions produced in the 3 He(n,p)T reaction. These lines are expected to lase at the levels of D-T neutron flux foreseen for the TFTR in 1989 (>>10 12 n/cm 2 /s), while amplification should be observable at the existing levels of D-D neutron flux (≥ 5 x 10 9 n/cm 2 /s). Lasing on the 1.73 μ and 2.63 μ transitions of Xe may be observable at the maximum expected levels of D-T neutron flux in TFTR enhanced by scattering

Tests of a grazing-incidence ring resonator free-electron laser

International Nuclear Information System (INIS)

Dowell, D.H.; Laucks, M.L.; Lowrey, A.R.; Adamski, J.L.; Pistoresi, D.J.; Shoffstall, D.R.; Bentz, M.P.; Burns, R.H.; Guha, J.; Sun, K.; Tomita, W.

1991-01-01

This paper reports on the Boeing free-electron laser (FEL) optical cavity that has been changed from a simple concentric cavity using two spherical mirrors to a larger grazing-incidence ring resonator. The new resonator consists of two mirror telescopes located at each end of the wiggler with a round-trip path length of approximately 133 m. Each telescope is a grazing-incidence hyperboloid followed by a normal-incidence paraboloid. Initial tests showed that poorly positioned ring focus and unreliable pointing alignment resulted in reduced and structured FEL output. (First lasing operation occurred on March 23 and 24, 1990.) Later efforts concentrated on improving the resonator alignment techniques and lowering the single-pass losses. FEL performance and reliability have significantly improved due to better ring alignment. The alignment procedure and recent lasing results are described. The effect the electron beam has on lasing is also discussed. Measurements are presented showing how FEL temporal output and wavelength are sensitive to electron beam energy variations

Excitation enhancement and extraction enhancement with photonic crystals

Science.gov (United States)

Shapira, Ofer; Soljacic, Marin; Zhen, Bo; Chua, Song-Liang; Lee, Jeongwon; Joannopoulos, John

2015-03-03

Disclosed herein is a system for stimulating emission from at least one an emitter, such as a quantum dot or organic molecule, on the surface of a photonic crystal comprising a patterned dielectric substrate. Embodiments of this system include a laser or other source that illuminates the emitter and the photonic crystal, which is characterized by an energy band structure exhibiting a Fano resonance, from a first angle so as to stimulate the emission from the emitter at a second angle. The coupling between the photonic crystal and the emitter may result in spectral and angular enhancement of the emission through excitation and extraction enhancement. These enhancement mechanisms also reduce the emitter's lasing threshold. For instance, these enhancement mechanisms enable lasing of a 100 nm thick layer of diluted organic molecules solution with reduced threshold intensity. This reduction in lasing threshold enables more efficient organic light emitting devices and more sensitive molecular sensing.

Toward continuous-wave operation of organic semiconductor lasers

Science.gov (United States)

Sandanayaka, Atula S. D.; Matsushima, Toshinori; Bencheikh, Fatima; Yoshida, Kou; Inoue, Munetomo; Fujihara, Takashi; Goushi, Kenichi; Ribierre, Jean-Charles; Adachi, Chihaya

2017-01-01

The demonstration of continuous-wave lasing from organic semiconductor films is highly desirable for practical applications in the areas of spectroscopy, data communication, and sensing, but it still remains a challenging objective. We report low-threshold surface-emitting organic distributed feedback lasers operating in the quasi–continuous-wave regime at 80 MHz as well as under long-pulse photoexcitation of 30 ms. This outstanding performance was achieved using an organic semiconductor thin film with high optical gain, high photoluminescence quantum yield, and no triplet absorption losses at the lasing wavelength combined with a mixed-order distributed feedback grating to achieve a low lasing threshold. A simple encapsulation technique greatly reduced the laser-induced thermal degradation and suppressed the ablation of the gain medium otherwise taking place under intense continuous-wave photoexcitation. Overall, this study provides evidence that the development of a continuous-wave organic semiconductor laser technology is possible via the engineering of the gain medium and the device architecture. PMID:28508042

Polariton condensation phase diagram in wide-band-gap planar microcavities: GaN versus ZnO

Science.gov (United States)

Jamadi, O.; Réveret, F.; Mallet, E.; Disseix, P.; Médard, F.; Mihailovic, M.; Solnyshkov, D.; Malpuech, G.; Leymarie, J.; Lafosse, X.; Bouchoule, S.; Li, F.; Leroux, M.; Semond, F.; Zuniga-Perez, J.

2016-03-01

The polariton condensation phase diagram is compared in GaN and ZnO microcavities grown on mesa-patterned silicon substrate. Owing to a common platform, these microcavities share similar photonic properties with large quality factors and low photonic disorder, which makes it possible to determine the optimal spot diameter and to realize a thorough phase diagram study. Both systems have been investigated under the same experimental conditions. The experimental results and the subsequent analysis reveal clearly that longitudinal optical phonons have no influence in the thermodynamic region of the condensation phase diagram, while they allow a strong (slight) decrease of the polariton lasing threshold in the trade-off zone (kinetic region). Phase diagrams are compared with numerical simulations using Boltzmann equations, and are in satisfactory agreement. A lower polariton lasing threshold has been measured at low temperature in the ZnO microcavity, as is expected due to a larger Rabi splitting. This study highlights polariton relaxation mechanisms and their importance in polariton lasing.

Testing the Role of Recollision in N2+ Air Lasing

Science.gov (United States)

Britton, Mathew; Laferrière, Patrick; Ko, Dong Hyuk; Li, Zhengyan; Kong, Fanqi; Brown, Graham; Naumov, Andrei; Zhang, Chunmei; Arissian, Ladan; Corkum, P. B.

2018-03-01

It has been known for many years that during filamentation of femtosecond light pulses in air, gain is observed on the B to X transition in N2+ . While the gain mechanism remains unclear, it has been proposed that recollision, a process that is fundamental to much of strong field science, is critical for establishing gain. We probe this hypothesis by directly comparing the influence of the ellipticity of the pump light on gain in air filaments. Then, we decouple filamentation from gain by measuring the gain in a thin gas jet that we also use for high harmonic generation. The latter allows us to compare the dependence of the gain on the ellipticity of the pump with the dependence of the high harmonic signal on the ellipticity of the fundamental. We find that gain and harmonic generation have very different behavior in both filaments and in the jet. In fact, in a jet we even measure gain with circular polarization. Thus, we establish that recollision does not play a significant role in creating the inversion.

Continuous-wave and passively Q-switched cryogenic Yb: KLu(WO.sub.4./sub.).sub.2./sub. laser

Czech Academy of Sciences Publication Activity Database

Navrátil, Petr; Jambunathan, Venkatesan; Paul David, Samuel; Yue, Fangxin; Serres, J.M.; Mateos, X.; Aguilo, M.; Diaz, F.; Griebner, U.; Petrov, V.; Lucianetti, Antonio; Mocek, Tomáš

2017-01-01

Roč. 25, č. 21 (2017), s. 25886-25893 ISSN 1094-4087 R&D Projects: GA MŠk LO1602; GA MŠk LM2015086 EU Projects: European Commission(XE) 739573 - HiLASE CoE Grant - others:OP VVV - HiLASE-CoE(XE) CZ.02.1.01/0.0/0.0/15_006/0000674 Institutional support: RVO:68378271 Keywords : diode-pumped lasers * laser materials Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 3.307, year: 2016

Phosphate-core silica-clad Er/Yb-doped optical fiber and cladding pumped laser.

Science.gov (United States)

Egorova, O N; Semjonov, S L; Velmiskin, V V; Yatsenko, Yu P; Sverchkov, S E; Galagan, B I; Denker, B I; Dianov, E M

2014-04-07

We present a composite optical fiber with a Er/Yb co-doped phosphate-glass core in a silica glass cladding as well as cladding pumped laser. The fabrication process, optical properties, and lasing parameters are described. The slope efficiency under 980 nm cladding pumping reached 39% with respect to the absorbed pump power and 28% with respect to the coupled pump power. Due to high doping level of the phosphate core optimal length was several times shorter than that of silica core fibers.

Analysis of corneal endothelial cell density and morphology after laser in situ keratomileusis using two types of femtosecond lasers

Directory of Open Access Journals (Sweden)

Tomita M

2012-09-01

Full Text Available Minoru Tomita,1,2,* George O Waring IV,3,4 Miyuki Watabe,1,* 1Shinagawa LASIK Center, Chiyoda-ku, Tokyo, Japan; 2Department of Ophthalmology, Wenzhou Medical College, Wenzhou, China; 3Medical University of South Carolina, Storm Eye Institute, Charleston, SC, USA; 4Magill Laser Center, Charleston, SC, USA*These authors contributed equally to this studyPurpose: To compare two different femtosecond lasers used for flap creation during laser-assisted in situ keratomileusis (LASIK surgery in terms of their effects on the corneal endothelium.Methods: We performed LASIK surgery on 254 eyes of 131 patients using IntraLase FS60 (Abbott Medical Optics, Inc, Irvine, CA; IntraLase group and 254 eyes of 136 patients using Femto LDV (Ziemer Group AG, Port, Switzerland; LDV group for corneal flap creation. The mean cell density, coefficient of variation, and hexagonality of the corneal endothelial cells were determined and the results were statistically compared.Results: There were no statistically significant differences in the corneal morphology between pre and post LASIK results in each group, nor were there significant differences between the results of both groups at 3 months post LASIK.Conclusions: Both IntraLase FS60 and Ziemer Femto LDV are able to create flaps without significant adverse effects on the corneal endothelial morphology through 3 months after LASIK surgery.Keywords: LASIK, corneal endothelium, femtosecond laser, IntraLase FS60, Ziemer LDV

Investigation of Chirped InAs/InGaAlAs/InP Quantum Dash Lasers as Broadband Emitters

KAUST Repository

Khan, Mohammed Zahed Mustafa

2014-02-01

In this paper, we assessed the effect of additionally broadened quantum dash (Qdash) optical transitions in the multi-stack dash-in-a-well laser structure at both, material and device level. A broad photoluminescence linewidth of ?150 nm demonstrates the formation of highly inhomogeneous InAs-dashes across the stacks. The transmission electron microscopy revealed small (large) average dash height from the Qdash stack with thick (thin) over grown barrier layer. The Fabry-Perot laser diodes fabricated from this chirped structure exhibits unique device physics under the short pulsewidth (SPW) and quasi-continuous wave (QCW) operation. Varying the ridge-width W from 2 to 4 ?rm showed quenching of ultrabroad lasing signature in the SPW operation, and consistent even for a wide 15 ?rm oxide strip laser diode. A lasing spectral split with reduced intensity gap in the center is observed in the QCW operation with the gap decreasing with increasing ridge-width. Such atypical lasing operation, influenced by the waveguiding mechanism is qualitatively realized by associating to the reduced vertical coupling effect of the Qdash stacks in the operation of small ridge-width lasers compared with large ridge-width and oxide stripe lasers, and leading to varying non-uniform distribution of carriers among the inhomogeneously broadened Qdash stacks in each case. Our chirped 2 × 830 ?rm ridge laser demonstrated marked improvement in the internal quantum efficiency (?80) and -3 dB lasing bandwidth, >50 nm centered at ?1.61 ?m. © 2013 IEEE.

Factors influencing flap and INTACS decentration after femtosecond laser application in normal and keratoconic eyes.

Science.gov (United States)

Ertan, Aylin; Karacal, Humeyra

2008-10-01

To compare accuracy of LASIK flap and INTACS centration following femtosecond laser application in normal and keratoconic eyes. This is a retrospective case series comprising 133 eyes of 128 patients referred for refractive surgery. All eyes were divided into two groups according to preoperative diagnosis: group 1 (LASIK group) comprised 74 normal eyes of 72 patients undergoing LASIK with a femtosecond laser (IntraLase), and group 2 (INTACS group) consisted of 59 eyes of 39 patients with keratoconus for whom INTACS were implanted using a femtosecond laser (IntraLase). Decentration of the LASIK flap and INTACS was analyzed using Pentacam. Temporal decentration was 612.56 +/- 384.24 microm (range: 30 to 2120 microm) in the LASIK group and 788.33 +/- 500.34 microm (range: 30 to 2450 microm) in the INTACS group. A statistically significant difference was noted between the groups in terms of decentration (P decentration of the LASIK flap and INTACS correlated with the central corneal thickness in the LASIK group and preoperative sphere and cylinder in the INTACS group, respectively. Decentration with the IntraLase occurred in most cases, especially in keratoconic eyes. The applanation performed for centralization during IntraLase application may flatten and shift the pupil center, and thus cause decentralization of the LASIK flap and INTACS. Central corneal thickness in the LASIK group and preoperative sphere and cylinder in the INTACS group proved to be statistically significant parameters associated with decentration.

First demonstration of orange-yellow light emitter devices in InGaP/InAlGaP laser structure using strain-induced quantum well intermixing technique

KAUST Repository

Majid, Mohammed A.

2016-03-07

In this paper, a novel strain-induced quantum well intermixing (QWI) technique is employed on InGaP/InAlGaP material system to promote interdiffusion via application of a thick-dielectric encapsulant layer, in conjunction with cycle annealing at elevated temperature. Broad area devices fabricated from this novel cost-effective QWI technique lased at room-temperature at a wavelength as short as 608nm with a total output power of ~46mW. This is the shortest- wavelength electrically pumped visible semiconductor laser, and the first report of lasing action yet reported from post- growth interdiffused process. Furthermore, we also demonstrate the first yellow superluminescent diode (SLD) at a wavelength of 583nm with a total two-facet output power of ~4.5mW - the highest optical power ever reported at this wavelength in this material system. The demonstration of the yellow SLD without complicated multiquantum barriers to suppress the carrier overflow will have a great impact in realizing the yellow laser diode. © (2016) COPYRIGHT Society of Photo-Optical Instrumentation Engineers (SPIE). Downloading of the abstract is permitted for personal use only.

First demonstration of orange-yellow light emitter devices in InGaP/InAlGaP laser structure using strain-induced quantum well intermixing technique

KAUST Repository

Majid, Mohammed Abdul; Al-Jabr, Ahmad; Elafandy, Rami T.; Oubei, Hassan M.; Alias, Mohd Sharizal; Alnahhas, Bayan A.; Anjum, Dalaver H.; Ng, Tien Khee; Shehata, Mohamed; Ooi, Boon S.

2016-01-01

In this paper, a novel strain-induced quantum well intermixing (QWI) technique is employed on InGaP/InAlGaP material system to promote interdiffusion via application of a thick-dielectric encapsulant layer, in conjunction with cycle annealing at elevated temperature. Broad area devices fabricated from this novel cost-effective QWI technique lased at room-temperature at a wavelength as short as 608nm with a total output power of ~46mW. This is the shortest- wavelength electrically pumped visible semiconductor laser, and the first report of lasing action yet reported from post- growth interdiffused process. Furthermore, we also demonstrate the first yellow superluminescent diode (SLD) at a wavelength of 583nm with a total two-facet output power of ~4.5mW - the highest optical power ever reported at this wavelength in this material system. The demonstration of the yellow SLD without complicated multiquantum barriers to suppress the carrier overflow will have a great impact in realizing the yellow laser diode. © (2016) COPYRIGHT Society of Photo-Optical Instrumentation Engineers (SPIE). Downloading of the abstract is permitted for personal use only.

A Kinetics Model for KrF Laser Amplifiers

Science.gov (United States)

Giuliani, J. L.; Kepple, P.; Lehmberg, R.; Obenschain, S. P.; Petrov, G.

1999-11-01

A computer kinetics code has been developed to model the temporal and spatial behavior of an e-beam pumped KrF laser amplifier. The deposition of the primary beam electrons is assumed to be spatially uniform and the energy distribution function of the nascent electron population is calculated to be near Maxwellian below 10 eV. For an initial Kr/Ar/F2 composition, the code calculates the densities of 24 species subject to over 100 reactions with 1-D spatial resolution (typically 16 zones) along the longitudinal lasing axis. Enthalpy accounting for each process is performed to partition the energy into internal, thermal, and radiative components. The electron as well as the heavy particle temperatures are followed for energy conservation and excitation rates. Transport of the lasing photons is performed along the axis on a dense subgrid using the method of characteristics. Amplified spontaneous emission is calculated using a discrete ordinates approach and includes contributions to the local intensity from the whole amplifier volume. Specular reflection off side walls and the rear mirror are included. Results of the model will be compared with data from the NRL NIKE laser and other published results.

Efficient blue emission from ambient processed all-inorganic CsPbBr2Cl perovskite cubes

Science.gov (United States)

Paul, T.; Chatterjee, B. K.; Maiti, S.; Besra, N.; Thakur, S.; Sarkar, S.; Chanda, K.; Das, A.; Sardar, K.; Chattopadhyay, K. K.

2018-04-01

The recent resurgence of photovoltaic research has empowered all inorganic perovskite materials to take the center stage thus leading to a plethora of interesting results. Here, via a facile room-temperature synthesis protocol high quality cesium lead halide perovskite (CsPbBr2Cl) cubes has been realized. Surface morphology and crystallinity of the synthesized sample were investigated by FESEM and XRD respectively. To attain detail information of its chemical composition EDX analysis and elemental mapping were carried out. These single crystalline cubes crystallize in orthorhombic phase and exhibit strong photoluminescence emission at 482 nm with narrow FWHM value (˜18nm) and photoluminescence decay time of 10.44 ns. We believe, this facile synthesis protocol will pave the way for realization other perovskite cube and thereby their usage in several optoelectronic arena like as lasing, LEDs and photo detector etc.

Experimental coherent control of lasers

International Nuclear Information System (INIS)

Gordon, R.; Ramsay, A.J.; Cleaver, J.R.A.; Heberle, A.P.

2002-01-01

We experimentally demonstrate coherent control of a laser. A resonant 100-fs optical pulse is injected into a vertical cavity surface emitting laser to introduce a field component with well-defined phase and thereby excite beating oscillations between the transverse lasing modes. By changing the relative phase between two injected pulses, we can enhance or destroy the beating oscillations and select which lasing modes are excited. We discuss resonant pulse injection into lasers and show how mode competition improves controllability by suppressing the phase-sensitive effects of the carriers

CAS - CERN Accelerator School: Free Electron Lasers and Energy Recovery Linacs

CERN Document Server

2018-01-01

These proceedings collate lectures given at the course on Free Electron Lasers and Energy Recovery Linacs (FELsand ERLs), organised by the CERN Accelerator School (CAS). The course was held at the Hotel Scandic HamburgEmporio, Hamburg, Germany from 31 May to 10 June 2016, in collaboration with DESY. Following introductorylectures on radiation issues, the basic requirements on linear accelerators and ERLs are discussed. Undulators andthe process of seeding and lasing are then treated in some detail, followed by lectures on various beam dynamicsand controls issues.

Development of a sodium-pump/neon-lasant photopumped soft X-ray laser

International Nuclear Information System (INIS)

Stephanakis, S.J.; Apruzese, J.P.; Burkhalter, P.G.

1988-01-01

Resonant photopumping of heliumlike neon by heliumlike sodium is investigated to extend this potentially efficient technique for inversion and lasing to shorter wavelengths. Properties of the sodium-pump plasma and the neon-lasant plasma required to optimize fluorescence and lasing are determined. The implosion of a sodium-bearing plasma with a megampere pulsed-power driver (Gamble II) is used to produce a linear Z-pinch with up to 25 GW of sodium-pump-line radiation. A separate neon plasma, driven by part of the return current form the imploding sodium plasma, is created parallel to the sodium line source at a distance of 5 cm. Implosion requirements for the neon plasma and its dynamics in the Gamble II return-current geometry are described. Evidence for population inversion is indicated by fluorescence enhancement of the 11-A resonance line from the n = 4 level of neon when pumped by sodium. The neon spectra are in qualitative agreement with calculations based on the sodium-pump power. Improvements in the experiment required to achieve lasing are discussed

A wavelength-tunable fiber laser using a novel filter based on a compound interference effect

Science.gov (United States)

Zou, Hui; Lou, Shuqin; Su, Wei; Han, Bolin; Shen, Xiao

2015-01-01

A wavelength-tunable erbium-doped fiber laser is proposed and experimentally demonstrated by using a novel filter which is formed from a 2  ×  2 3 dB multimode coupler incorporating a segment of polarization maintaining fiber (PMF). By using the filter with 2.1 m lengths of PMF in a ring fiber laser, a stable single wavelength lasing is obtained experimentally. Its 3 dB bandwidth is less than 0.0147 nm and the side mode suppression ratio (SMSR) is higher than 58.91 dB. Experimental results demonstrate that mode competition can be effectively suppressed and the SMSR can be improved due to the compound interference effect aroused by the novel filter. Meanwhile the stability of the output lasing can be enhanced. By appropriately adjusting the polarization controllers (PCs), the output lasing wavelength can be tuned from 1563.51 to 1568.21 nm. This fiber laser has the advantage of a simple structure and stable operation at room temperature.

Tunable multi-wavelength polymer laser based on a triangular-lattice photonic crystal structure

International Nuclear Information System (INIS)

Huang, Wenbin; Pu, Donglin; Qiao, Wen; Wan, Wenqiang; Liu, Yanhua; Ye, Yan; Wu, Shaolong; Chen, Linsen

2016-01-01

A continuously tunable multi-wavelength polymer laser based on a triangular-lattice photonic crystal cavity is demonstrated. The triangular-lattice resonator was initially fabricated through multiple interference exposure and was then replicated into a low refractive index polymer via UV-nanoimprinting. The blend of a blue-emitting conjugated polymer and a red-emitting one was used as the gain medium. Three periods in the scalene triangular-lattice structure yield stable tri-wavelength laser emission (625.5 nm, 617.4 nm and 614.3 nm) in six different directions. A uniformly aligned liquid crystal (LC) layer was incorporated into the cavity as the top cladding layer. Upon heating, the orientation of LC molecules and thus the effective refractive index of the lasing mode changes which continuously shifts the lasing wavelength. A maximum tuning range of 12.2 nm was observed for the lasing mode at 625.5 nm. This tunable tri-wavelength polymer laser is simple constructed and cost-effective. It may find application in the fields of biosensors and photonic integrated circuits. (paper)

Switchable multi-wavelength erbium-doped fiber ring laser based on a tapered in-line Mach–Zehnder interferometer

Science.gov (United States)

Zhou, Yuxin; Wang, Xin; Tang, Zijuan; Lou, Shuqin

2018-05-01

In this paper, a switchable multi-wavelength erbium-doped fiber ring laser based on a tapered in-line Mach–Zehnder interferometer is proposed. The in-line Mach–Zehnder interferometer is fabricated by splicing a large-core fiber between two segments of single mode fibers, in which the first splicing point is tapered and the second splicing point is connected directly. By carefully rotating the polarization controller, switchable single-, dual-, triple- and quad-wavelength lasing outputs can be obtained with a side mode suppression ratio higher than 50 dB. The maximal peak power difference of multi-wavelength lasing is 3.67 dB, demonstrating a good power equalization performance. Furthermore, the proposed laser is proven to be very stable at room temperature. The wavelength shifts and peak power fluctuations are less than 0.02 nm and 1.3 dB over half an hour. In addition, stable quintuple-wavelength lasing with a side mode suppression ratio higher than 50 dB can also be realized when the filter length is changed.

Mechanism of single-pulse ablative generation of laser-induced periodic surface structures

Czech Academy of Sciences Publication Activity Database

Shugaev, M.V.; Gnilitskyi, I.; Bulgakova, Nadezhda M.; Zhigilei, L.

2017-01-01

Roč. 96, č. 20 (2017), s. 1-9, č. článku 205429. ISSN 2469-9950 R&D Projects: GA MŠk LO1602; GA ČR GA16-12960S; GA MŠk LM2015086 EU Projects: European Commission(XE) 739573 - HiLASE CoE Grant - others:OP VVV - HiLASE-CoE(XE) CZ.02.1.01/0.0/0.0/15_006/0000674 Institutional support: RVO:68378271 Keywords : molecular-dynamics simulations * metals * electron * spallation Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 3.836, year: 2016

A new undulator for the extension of the spectral range of the CLIO FEL

Energy Technology Data Exchange (ETDEWEB)

Marcouille, O.; Berset, J.M.; Glotin, F. [LURE, Orsay (France)] [and others

1995-12-31

We built a new undulator in order to extend the lasing range of the CLIO infrared FEL. Presently, CLIO operates in the wavelength range 2 - 17 {mu}m. Beyond 14 {mu}m, the power decreases rapidly, because of the diffraction losses of the vacuum chamber (7 mm height and 2 m long). Thus, lasing at higher wavelengths implies installing a chamber with a height approximately twice. Then the minimum gap is increased and the maximum deflection parameter, K, is reduced from 2 to 1 : the laser tunability is greatly reduced. This is why a new undulator has been built.

Self-consistent Maxwell-Bloch model of quantum-dot photonic-crystal-cavity lasers

DEFF Research Database (Denmark)

Cartar, William; Mørk, Jesper; Hughes, Stephen

2017-01-01

-level emitters are solved numerically. Phenomenological pure dephasing and incoherent pumping is added to the optical Bloch equations to allow for a dynamical lasing regime, but the cavity-mediated radiative dynamics and gain coupling of each QD dipole (artificial atom) is contained self-consistently within......-mode to multimode lasing is also observed, depending on the spectral peak frequency of the QD ensemble. Using a statistical modal analysis of the average decay rates, we also show how the average radiative decay rate decreases as a function of cavity size. In addition, we investigate the role of structural disorder...

Quantum-dot micropillars for parametric THz emission

DEFF Research Database (Denmark)

Mariani, S.; Andronico, A.; Favero, I.

2013-01-01

We report on the design, fabrication and optical investigation of AlGaAs microcavities for THz Difference Frequency Generation (DFG) between Whispering Gallery Modes (WGMs), where the pump and DFG wavelengths (λ ≈ 1.3 μm and λ ≈ 75-150 μm, respectively) lie on opposite sides of the Restrahlen band....... For the pump modes, we demonstrate CW lasing of quantum-dot layers under electrical injection at room temperature. We control the number of lasing WGMs via vertical notches on the pillars sidewalls, providing a selection mechanism for funneling the power only to the modes contributing to DFG. In parallel...

Watt-level ~2 μm laser output in Tm3+-doped tungsten tellurite glass double-cladding fiber.

Science.gov (United States)

Li, Kefeng; Zhang, Guang; Hu, Lili

2010-12-15

We report, for the first time to the best of our knowledge, a watt level cw fiber laser at ~2 μm from a piece of 40-cm-long newly developed highly thulium-doped (3.76 × 10(20) ions/cm(3)) tungsten tellurite glass double cladding fiber pumped by a commercial 800 nm laser diode. The maximum output power of the fiber laser reaches 1.12 W. The slope efficiency and the optical-optical efficiency with respect to the absorbed pump are 20% and 16%, respectively. The lasing threshold is 1.46 W, and the lasing wavelength is centered at 1937 nm.

Thermal analysis of line-defect photonic crystal lasers

DEFF Research Database (Denmark)

Xue, Weiqi; Ottaviano, Luisa; Chen, Yaohui

2015-01-01

under CW optical pumping, whereas InGaAsP membranes only lase under pulsed conditions. By varying the duty cycle of the pump beam, we quantify the heating induced by optical pumping in the two material platforms and compare their thermal properties. Full 3D finite element simulations show the spatial......We report a systematic study of thermal effects in photonic crystal membrane lasers based on line-defect cavities. Two material platforms, InGaAsP and InP, are investigated experimentally and numerically. Lasers with quantum dot layers embedded in an InP membrane exhibit lasing at room temperature...

Proton-transfer lasers based on solid copolymers of modified 2-(2'-hydroxyphenyl)benzimidazoles with methacrylate monomers

Science.gov (United States)

Costela, A.; García-Moreno, I.; Mallavia, Ricardo; Amat-Guerri, F.; Barroso, J.; Sastre, R.

1998-06-01

We report on the lasing action of two newly synthesized 2-(2'-hydroxyphenyl) benzimidazole derivatives copolymerized with methyl methacrylate. The laser samples were transversely pumped with a N 2 laser at 337 nm. The influence on the proton-transfer laser performance of the distance between the chromophore group and the polymeric main chain and of the rigidity of the polymeric host matrix, were studied. Significant increases in lasing efficiency and photostability are demonstrated for some of the new materials, as compared to those previously obtained with related proton-transfer dyes also covalently bound to methacrylic monomers.

Electronic transport and lasing in microstructures

International Nuclear Information System (INIS)

Lax, M.

1992-01-01

We consider the interaction of hot carriers with hot phonons in a quantum well. Transport is considered in the transverse direction and tunneling through the well barriers. Time-dependent transport effects down to the femto-second regime are included, as are strong and/or microwave fields, with negative resistance effects. Resonant tunneling assisted by phonon relaxation and infra-red radiation will be explored. The limitations on transmission of information due to partition noise, as influenced by the design of semiconductor feedback lasers will be considered. The use of light scattering and decision theory to detect shell-like aerosols is examined

Calculation of the characteristics of a photoionization TEA CO/sub 2/ laser

Energy Technology Data Exchange (ETDEWEB)

Aver' yanov, N E; Baloshin, Yu A

1979-01-01

Energy and time characteristics have been studied for molecular lasers with active mixture pressures up to atmospheric or high levels. According to the model employed, which was developed for lasers with low active mixture pressure, the basic kinetic equations describing the dynamics of populations of carbon dioxide molecules in a high pressure laser are not written for discrete levels, but for energies stored in each type of oscillation: rate constants of the primary processes of excitation and deexcitation of molecules, relaxation time of different channels of relaxation, and the distribution function of electrons will have a different relationship as a function of partial gas pressures. Earlier equations were used to compute characteristics of lasing pulses of TEA CO/sub 2/ lasers operating under conditions of a semi-self-maintained discharge with preionization of the main volume by uv emission. A new model had to be devised to handle high pressure lasers. Helium was found to be the main supplier of photoelectrons, in spite of the highest ionization potential: addition of nitrogen shapes a uv spectrum optimum for photoionization of helium. CO/sub 2/ is the lasing molecule and also absorbs uv emission. Consideration of CO/sub 2/ molecule dissociation makes the theoretical concept more reliable in comparison with experiment.

Prospects for CW and LP operation of the European XFEL in hard X-ray regime

International Nuclear Information System (INIS)

Brinkmann, R.; Schneidmiller, E.A.; Sekutowicz, J.; Yurkov, M.V.

2014-03-01

The European XFEL will operate nominally at 17.5 GeV in SP (short pulse) mode with 0.65 ms long bunch train and 10 Hz repetition rate. A possible upgrade of the linac to CW (continuous wave) or LP (long pulse) modes with a corresponding reduction of electron beam energy is under discussion since many years. Recent successes in the dedicated R and D program allow to forecast a technical feasibility of such an upgrade in the foreseeable future. One of the challenges is to provide sub-Aangstrom FEL operation in CW and LP modes. In this paper we perform a preliminary analysis of a possible operation of the European XFEL in the hard X-ray regime in CW and LP modes with the energies of 7 GeV and 10 GeV, respectively. We consider lasing in the baseline XFEL undulator as well as in a new undulator with a reduced period. We show that, with reasonable requirements on electron beam quality, lasing on the fundamental will be possible in sub-Aangstrom regime. As an option for generation of brilliant photon beams at short wavelengths we also consider harmonic lasing that has recently attracted a significant attention.

Water vapor spectroscopy in the 815-nm wavelength region for Differential Absorption Lidar measurements

Science.gov (United States)

Ponsardin, Patrick; Browell, Edward V.

1995-01-01

The differential absorption lidar (DIAL) technique was first applied to the remote measurement of atmospheric water vapor profiles from airborne platforms in 1981. The successful interpretation of the lidar profiles relies strongly on an accurate knowledge of specific water vapor absorption line parameters: line strength, pressure broadening coefficient, pressure-induced shift coefficient and the respective temperature-dependence factors. NASA Langley Research Center has developed and is currently testing an autonomous airborne water vapor lidar system: LASE (Lidar Atmospheric Sensing Experiment). This DIAL system uses a Nd:YAG-pumped Ti:Sapphire laser seeded by a diode laser as a lidar transmitter. The tunable diode has been selected to operate in the 813-818 nm wavelength region. This 5-nm spectral interval offers a large distribution of strengths for temperature-insensitive water vapor absorption lines. In support of the LASE project, a series of spectroscopic measurements were conducted for the 16 absorption lines that have been identified for use in the LASE measurements. Prior to this work, the experimental data for this water vapor absorption band were limited - to our knowledge - to the line strengths and to the line positions.

Prospects for CW and LP operation of the European XFEL in hard X-ray regime

Energy Technology Data Exchange (ETDEWEB)

Brinkmann, R.; Schneidmiller, E.A.; Sekutowicz, J.; Yurkov, M.V.

2014-03-15

The European XFEL will operate nominally at 17.5 GeV in SP (short pulse) mode with 0.65 ms long bunch train and 10 Hz repetition rate. A possible upgrade of the linac to CW (continuous wave) or LP (long pulse) modes with a corresponding reduction of electron beam energy is under discussion since many years. Recent successes in the dedicated R and D program allow to forecast a technical feasibility of such an upgrade in the foreseeable future. One of the challenges is to provide sub-Aangstrom FEL operation in CW and LP modes. In this paper we perform a preliminary analysis of a possible operation of the European XFEL in the hard X-ray regime in CW and LP modes with the energies of 7 GeV and 10 GeV, respectively. We consider lasing in the baseline XFEL undulator as well as in a new undulator with a reduced period. We show that, with reasonable requirements on electron beam quality, lasing on the fundamental will be possible in sub-Aangstrom regime. As an option for generation of brilliant photon beams at short wavelengths we also consider harmonic lasing that has recently attracted a significant attention.

Multiband carbon monoxide laser (2.5 -- 4.0 and 5.0 -- 6.5 micron) pumped by capacitive slab RF discharge

Science.gov (United States)

Ionin, Andrey; Kozlov, Andrey; Seleznev, Leonid; Sinitsyn, Dmitry

2008-10-01

Overtone lasing and fundamental band tuning was for the first time obtained in a carbon monoxide laser excited by repetitively pulsed capacitive slab RF discharge (81.36 MHz). RF discharge pulse repetition rate was 100--500 Hz. The active volume was 3x30x250 cubic mm. Laser electrodes were cooled down to 120 K. Gas mixture CO:air:He at gas pressure 15 Torr was used. The optical scheme ``frequency selective master oscillator - laser amplifier'' was applied for getting fundamental band tuning. Single line lasing with average power up to several tens of mW was observed on about 100 rotational-vibrational transitions of CO molecule within the spectral range 5.0--6.5 micron. Multiline overtone lasing was observed on about 80 spectral lines within the spectral range 2.5-4.0 micron, with maximum single line average output power 12 mW. The total output power of the slab overtone CO laser came up to 0.35 W, with laser efficiency 0.5 percent. The results of parametric studies of capacitive slab RF discharge in carbon monoxide mixtures, and overtone and fundamental band CO laser characteristics are discussed.

Reduced dimer production in solar-simulator-pumped continuous wave iodine lasers based on model simulations and scaling and pumping studies

Science.gov (United States)

Costen, Robert C.; Heinbockel, John H.; Miner, Gilda A.; Meador, Willard E., Jr.; Tabibi, Bagher M.; Lee, Ja H.; Williams, Michael D.

1995-01-01

A numerical rate equation model for a continuous wave iodine laser with longitudinally flowing gaseous lasant is validated by approximating two experiments that compare the perfluoroalkyl iodine lasants n-C3F7I and t-C4F9I. The salient feature of the simulations is that the production rate of the dimer (C4F9)2 is reduced by one order of magnitude relative to the dimer (C3F7)2. The model is then used to investigate the kinetic effects of this reduced dimer production, especially how it improves output power. Related parametric and scaling studies are also presented. When dimer production is reduced, more monomer radicals (t-C4F9) are available to combine with iodine ions, thus enhancing depletion of the laser lower level and reducing buildup of the principal quencher, molecular iodine. Fewer iodine molecules result in fewer downward transitions from quenching and more transitions from stimulated emission of lasing photons. Enhanced depletion of the lower level reduces the absorption of lasing photons. The combined result is more lasing photons and proportionally increased output power.

kW-class picosecond thin-disc prepulse laser Perla for efficient EUV generation

Czech Academy of Sciences Publication Activity Database

Endo, Akira; Smrž, Martin; Mužík, Jiří; Novák, Ondřej; Chyla, Michal; Mocek, Tomáš

2017-01-01

Roč. 16, č. 4 (2017), s. 1-6, č. článku 041011. ISSN 1932-5150 R&D Projects: GA MŠk LO1602; GA ČR GA16-12960S; GA MŠk LM2015086 EU Projects: European Commission(XE) 739573 - HiLASE CoE Grant - others:OP VVV - HiLASE-CoE(XE) CZ.02.1.01/0.0/0.0/15_006/0000674 Institutional support: RVO:68378271 Keywords : EUV source * laser produced plasma * FEL * prepulse * thin-disc laser Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.350, year: 2016

The onset of coherence collapse in DBR lasers

International Nuclear Information System (INIS)

Woodward, S.L.; Koch, T.L.; Koren, U.

1990-01-01

The authors investigate how the onset of coherence collapse depends on laser output power. The lasers were three-section multiquantum-well distributed-Bragg-reflector (MQW-DBR) lasers. The fraction of light reflected back into the lasing mode was varied, and the point at which the transition to coherence collapse occurred was measured. This feedback level varies approximately linearly with laser output power. For these lasers, when the output power is 1 mW, the transition to coherence collapse beings when the optical feedback into the lasing mode is below - 40 dBm; when the feedback power is - 35 dBm the laser line is completely collapsed

KrCl lasers for fusion. Final report

International Nuclear Information System (INIS)

1984-01-01

The lasing characteristics of the Krypton Chloride excimer have been investigated in an e-beam laser facility. The results of experiments have been compared with the predictions of a comprehensive numerical kinetics model. The model predicts that the formation efficiency for KrCl* should be quite high (approx. = 20%) and these predictions appear to be borne out by experimental gain measurements. However, observed intrinsic laser efficiencies are poor, about 1 percent being the best observed in this program. We conclude that the poor lasing performance results from an adverse gain to loss ratio and an extreme sensitivity to optics losses because of the low characteristics magnitude of the gain

X-ray laser implementation by means of a strong source of high-spin metastable atoms

International Nuclear Information System (INIS)

Helman, J.S.; Rau, C.; Bunge, C.F.

1983-01-01

High-spin metastable atomic beams of high density and extremely small divergence can be produced by electron capture during grazing-angle scattering of ion beams at ferromagnetic surfaces. This can be used to generate a long-lived reservoir of Li 1s2s2p 4 P/sub 5/2//sup ts0/ with enough density of metastables so that after laser-induced transfer to Li 1s2p/sup ts2/P strong lasing at 207 A should occur. This novel technique can also be used to produce a variety of other metastables known as potential candidates for lasing at shorter wavelengths

Wavelengths of the Ni-like 4d to 4p X-ray laser lines

International Nuclear Information System (INIS)

Utsumi, Takayuki; Sasaki, Akira

2000-01-01

The wavelengths of the Ni-like 4d to 4p X-ray laser lines for elements ranging from Pd(Z=46) to U(Z=92) calculated using the relativistic multi-configuration Dirac-Fock code, i.e. grasp92, are presented. These optimal level calculations agree well with measurements and previous calculations. To obtain accurate lasing wavelengths is important to grasp the energy level structure of the complicated Ni-like ions, and especially for the development of collisionally pumped X-ray lasers. The lasing wavelengths are also essential to identify the lines and when the X-ray laser is utilized for imaging and interferometry. (author)

Volume Bragg grating narrowed high-power and highly efficient cladding-pumped Raman fiber laser.

Science.gov (United States)

Liu, Jun; Yao, Weichao; Zhao, Chujun; Shen, Deyuan; Fan, Dianyuan

2014-12-10

High-power and highly efficient operation of a single-mode cladding-pumped Raman fiber laser with narrow lasing bandwidth is demonstrated. The spectral narrowing was realized by an external cavity containing a volume Bragg grating with a center wavelength of 1658 nm. A maximum output power of 10.4 W at 1658.3 nm with a spectral linewidth (FWHM) of ∼0.1  nm was obtained for the launched pump power of 18.4 W, corresponding to a slope efficiency of 109% with respect to the launched pump power. Lasing characteristics of free-running operation are also evaluated and discussed.

Semiconductor laser with longitudinal electron-beam pumping and based on a quantum-well ZnCdSe/ZnSe structure grown on a ZnSe substrate by molecular beam epitaxy

International Nuclear Information System (INIS)

Kozlovskii, Vladimir I; Korostelin, Yurii V; Skasyrsky, Yan K; Shapkin, P V; Trubenko, P A; Dianov, Evgenii M

1998-01-01

The method of molecular beam epitaxy on a ZnSe substrate was used to grow a ZnCdSe/ZnSe structure with 115 quantum wells. This structure was made up into a cavity which included part of the substrate. Lasing was excited by longitudinal pumping with a scanning electron beam of E e = 40 - 70 keV energy. At T = 80 K for E e = 65 keV the threshold current density was 60 A cm -2 and the output power was 0.15 W at the 465 nm wavelength. At T= 300 K the lasing (λ= 474 nm) occurred in the ZnSe substrate. (lasers)

Bleaching and enamel surface interactions resulting from the use of highly-concentrated bleaching gels.

Science.gov (United States)

Grazioli, Guillermo; Valente, Lisia Lorea; Isolan, Cristina Pereira; Pinheiro, Helena Alves; Duarte, Camila Gonçalves; Münchow, Eliseu Aldrighi

2018-03-01

Tooth bleaching is considered a non-invasive treatment, although the use of highly-concentrated products may provoke increased surface roughness and enamel demineralization, as well as postoperative sensitivity. Thus, the aim of this study was to investigate whether hydrogen peroxide (H 2 O 2 ) concentration would affect tooth bleaching effectiveness and the enamel surface properties. Enamel/dentin bovine specimens (6 × 4 mm) were immersed in coffee solution for 7 days and evaluated with a spectrophotometer (Easyshade; baseline), using the CIEL * a * b * color parameters. Hardness was measured using a hardness tester. The specimens were randomly assigned into four groups: one negative control, in which the specimens were not bleached, but they were irradiated with a laser-light source (Whitening Lase II, DMC Equipments); and three groups using distinct H 2 O 2 concentration, namely LP15% (15% Lase Peroxide Lite), LP25% (25% Lase Peroxide Sensy), and LP35% (35% Lase Peroxide Sensy), all products from DMC. The bleached specimens were also irradiated with the laser-light source. After bleaching, all specimens were evaluated using scanning electron microscopy (SEM). pH kinetics and rate was monitored during bleaching. The data were analyzed using ANOVA and Tukey's test (p bleaching gels produced similar color change (p > 0.05). Concerning hardness, only the LP25% and LP35% significantly reduced hardness after bleaching; also, there was a progressive tendency for a greater percentage reduction in hardness with increased H 2 O 2 concentration of the gel (R 2  = 0.9973, p bleaching effectiveness, and may increase the possibility for alteration of enamel hardness, surface morphology, and acidity of the medium. When using H 2 O 2 -based bleaching agents, dental practitioners should choose for less concentrated gels, e.g., around the 15% level. Copyright © 2017 Elsevier Ltd. All rights reserved.

Rolled-up nanotechnology: 3D photonic materials by design

International Nuclear Information System (INIS)

Böttner, Stefan; Jorgensen, Matthew R.; Schmidt, Oliver G.

2016-01-01

Rolled-up nanotechnology involves the deposition of strained material layers for subsequent release and relaxation into functional structures with applications spanning several disciplines. Originally developed for use with semiconductor materials, over the last decade the processes involved in rolled-up nanotechnology have been applied across a wide palette of materials resulting in applications (among others) in micro robotics, energy storage, electronics, and photonics. Here we highlight the key advancements and future directions in rolled-up photonics, focusing on the diverse demonstrations of rolled-up three-dimensional microresonators which enable integrated sensing, micro-lasing, and out-of-plane routing of light.

Multielement (P-Yb-Zr-Ce-Al-Ca) fiber for moderate-power laser application with enhanced photodarkening resistivity

Energy Technology Data Exchange (ETDEWEB)

Dhar, Anirban; Paul, Mukul Chandra [CSIR-Central Glass and Ceramic Research Institute, 196 Raja S. C. Mullick Road, Jadavpur, Kolkata 700 032 (India); Das, Shyamal; Reddy, Pinninty Harshavardhan; Siddiki, Salim H.; Dutta, Debjit; Pal, Mrinmay [Academy of Scientific and Innovative Research (AcSIR), CSIR-CGCRI Campus, Kolkata 700 032 (India); Kir' yanov, Alexander V. [Centro de Investigaciones en Optica, Loma del Bosque 115, Col. Lomas del Campestre, Leon 37150, Guanajuato (Mexico)

2017-06-15

Multielement (ME) (P-Yb-Zr-Ce-Al-Ca) nanophase separated silica-glass-based optical fiber is fabricated through a conventional-modified chemical vapor deposition (MCVD) process, coupled with solution doping technique. The lasing and photodarkening behaviors of this ME fiber have been demonstrated and compared, in terms of its photodarkening (PD) performance at moderate pump powers (tens of Watts), with standard Yb-doped fiber with phospho-alumino-silicate (PAS) glass composition, which clearly reveals that the ME-Yb doped fiber is a promising candidate for laser applications with enhanced PD resistivity. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Yb3+ sensitized Tm3+ upconversion in tellurite lead oxide glass.

Science.gov (United States)

Mohanty, Deepak Kumar; Rai, Vineet Kumar; Dwivedi, Y

2012-04-01

Triply ionized thulium/thulium--ytterbium doped/codoped TeO2-Pb3O4 (TPO) glasses have been fabricated by classical quenching method. The upconversion emission spectra in the Tm3+/Tm3+-Yb3+ doped/codoped glasses upon excitation with a diode laser lasing at ∼980 nm has been studied. Effect of the addition of the Yb3+ on the upconversion emission intensity in the visible and near infrared regions of the Tm3+ doped in TPO glass has been studied and the processes involved explored. Copyright © 2011 Elsevier B.V. All rights reserved.

Spectral Analysis of Quantum-Dash Lasers: Effect of Inhomogeneous Broadening of the Active-Gain Region

KAUST Repository

Khan, Mohammed Zahed Mustafa

2012-05-01

The effect of the active region inhomogeneity on the spectral characteristics of InAs/InP quantum-dash (Qdash) lasers is examined theoretically by solving the coupled set of carrier-photon rate equations. The inhomogeneity due to dash size or composition fluctuation is included in the model by considering dispersive energy states and characterized by a Gaussian envelope. In addition, the technique incorporates multilongitudinal photon modes and homogeneous broadening of the optical gain. The results predict a red shift in the central lasing wavelength of Qdash lasers on increasing the inhomogeneous broadening either explicitly or implicitly, which supports various experimental observations. The threshold current density and the lasing bandwidth are also found to increase. © 2012 IEEE.

Spectral Analysis of Quantum-Dash Lasers: Effect of Inhomogeneous Broadening of the Active-Gain Region

KAUST Repository

Khan, Mohammed Zahed Mustafa; Ng, Tien Khee; Ooi, Boon S.; Schwingenschlö gl, Udo

2012-01-01

The effect of the active region inhomogeneity on the spectral characteristics of InAs/InP quantum-dash (Qdash) lasers is examined theoretically by solving the coupled set of carrier-photon rate equations. The inhomogeneity due to dash size or composition fluctuation is included in the model by considering dispersive energy states and characterized by a Gaussian envelope. In addition, the technique incorporates multilongitudinal photon modes and homogeneous broadening of the optical gain. The results predict a red shift in the central lasing wavelength of Qdash lasers on increasing the inhomogeneous broadening either explicitly or implicitly, which supports various experimental observations. The threshold current density and the lasing bandwidth are also found to increase. © 2012 IEEE.

Solar-pumped electronic-to-vibrational energy transfer lasers

Science.gov (United States)

Harries, W. L.; Wilson, J. W.

1981-01-01

The possibility of using solar-pumped lasers as solar energy converters is examined. The absorbing media considered are halogens or halogen compounds, which are dissociated to yield excited atoms, which then hand over energy to a molecular lasing medium. Estimates of the temperature effects for a Br2-CO2-He system with He as the cooling gas are given. High temperatures can cause the lower energy levels of the CO2 laser transition to be filled. The inverted populations are calculated and lasing should be possible. However, the efficiency is less than 0.001. Examination of other halogen-molecular lasant combinations (where the rate coefficients are known) indicate efficiencies in all cases of less than 0.005.

Saturation and kinetic issues for optical-field-ionized plasma x-ray lasers

International Nuclear Information System (INIS)

Eder, D.C.; Amendt, P.; Rosen, M.D.; Nash, J.K.; Wilks, S.C.

1991-01-01

Lasing between excited states and the ground state following optical-field ionization is studied. Saturation of an x-ray laser when the lower lasing level is a ground state of a H-like or Li-like ion is discussed. Efficiencies of 10 -5 to 10 -4 are calculated for the 3d 5/2 --2p 3/2 transition at 98 Angstrom in Li-like Ne. The assumption that the fine-structure levels are populated according to their statistical weights is shown to be justified through comparisons with calculations using a detailed atomic model. The effect of saturation by a given fine-structure transition on the populations of the fine-structure levels is analyzed. 4 refs., 2 figs

Study on the gain media with four energy level model using two dimensional FDTD method

Energy Technology Data Exchange (ETDEWEB)

Wu, Bo; Sun, Bingbing; Xue, Hui; Xiao, Feng [Key Laboratory of Intelligent Computing and Signal Processing, Anhui University, Hefei 230039 (China); Huang, Zhixiang, E-mail: zxhuang@ahu.edu.cn [Key Laboratory of Intelligent Computing and Signal Processing, Anhui University, Hefei 230039 (China); Wu, Xianliang, E-mail: xlwu@ahu.edu.cn [Key Laboratory of Intelligent Computing and Signal Processing, Anhui University, Hefei 230039 (China); Department of Physics and Electronic Engineering, Hefei Normal University, Hefei 230061 (China)

2013-08-15

A four energy level model is applied to the gain media, which shows possible application to the complex metamaterials system due to its amplification effect. The coupled equations named polarization equation, rate equations of electronic population and Maxwell's equations are used to describe the coupling between the atoms and electromagnetic wave. Population inversion and lasing threshold are investigated using numerical simulations based on a novel finite-difference time-domain (FDTD) treatment of the optical field. The validations of the method are also tested. The numerical results show the good agreement with the classic lasing theory. Our numerical model can be used as an efficient design tool for investigating novel physical phenomena for new laser devices.

Quantitative verification of ab initio self-consistent laser theory.

Science.gov (United States)

Ge, Li; Tandy, Robert J; Stone, A D; Türeci, Hakan E

2008-10-13

We generalize and test the recent "ab initio" self-consistent (AISC) time-independent semiclassical laser theory. This self-consistent formalism generates all the stationary lasing properties in the multimode regime (frequencies, thresholds, internal and external fields, output power and emission pattern) from simple inputs: the dielectric function of the passive cavity, the atomic transition frequency, and the transverse relaxation time of the lasing transition.We find that the theory gives excellent quantitative agreement with full time-dependent simulations of the Maxwell-Bloch equations after it has been generalized to drop the slowly-varying envelope approximation. The theory is infinite order in the non-linear hole-burning interaction; the widely used third order approximation is shown to fail badly.

The Study of Electromagnetic Wave Propogation in Photonic Crystals Via Planewave Based Transfer (Scattering) Matrix Method with Active Gain Material Applications

Energy Technology Data Exchange (ETDEWEB)

LI, Ming [Iowa State Univ., Ames, IA (United States)

2007-01-01

In this dissertation, a set of numerical simulation tools are developed under previous work to efficiently and accurately study one-dimensional (1D), two-dimensional(2D), 2D slab and three-dimensional (3D) photonic crystal structures and their defects effects by means of spectrum (transmission, reflection, absorption), band structure (dispersion relation), and electric and/or magnetic fields distribution (mode profiles). Furthermore, the lasing property and spontaneous emission behaviors are studied when active gain materials are presented in the photonic crystal structures. Various physical properties such as resonant cavity quality factor, waveguide loss, propagation group velocity of electromagnetic wave and light-current curve (for lasing devices) can be obtained from the developed software package.

Generation of radiation by benzimidazoles in various aggregate states

Energy Technology Data Exchange (ETDEWEB)

Gruzinsky, V V; Degtyarenko, K M; Shalaev, V K; Kopylova, T N; Verkhovsky, V S; Tarasenko, V F; Melochenko, S V

1983-04-01

Lasing has been obtained on the solutions of new derivatives of benzimidazole (Bi): 2-phenyl-Bi (the band maximum lambda/sub r.max/ = 341/347 nm), 2-n-tolyl-Bi (344 nm) and 2-(4'-biphenilyl) Bi (366/374 nm). Compounds of this class provide a perspective basis for laser radiation covering of a wide spectrum region. Lasing has been obtained on the vapors of 2-(4'-biphenilyl)Bi (361.2 nm) and 2-(n-tolyl) Bi (336.3 nm) with pentane stabilizer of excited states. High volatility, photostability and laser-action over wide concentration ranges determine the efficiency of using the new class of compounds - chain arylbenzimitazoles - in lasers based on complex molecule vapors.

Comparing laser induced plasmas formed in diode and excimer pumped alkali lasers.

Science.gov (United States)

Markosyan, Aram H

2018-01-08

Lasing on the D 1 transition (6 2 P 1/2 → 6 2 S 1/2 ) of cesium can be reached in both diode and excimer pumped alkali lasers. The first uses D 2 transition (6 2 S 1/2 → 6 2 P 3/2 ) for pumping, whereas the second is pumped by photoexcitation of ground state Cs-Ar collisional pairs and subsequent dissociation of diatomic, electronically-excited CsAr molecules (excimers). Despite lasing on the same D 1 transition, differences in pumping schemes enables chemical pathways and characteristic timescales unique for each system. We investigate unavoidable plasma formation during operation of both systems side by side in Ar/C 2 H 6 /Cs.

[INVITED] Coherent perfect absorption of electromagnetic wave in subwavelength structures

Science.gov (United States)

Yan, Chao; Pu, Mingbo; Luo, Jun; Huang, Yijia; Li, Xiong; Ma, Xiaoliang; Luo, Xiangang

2018-05-01

Electromagnetic (EM) absorption is a common process by which the EM energy is transformed into other kinds of energy in the absorber, for example heat. Perfect absorption of EM with structures at subwavelength scale is important for many practical applications, such as stealth technology, thermal control and sensing. Coherent perfect absorption arises from the interplay of interference and absorption, which can be interpreted as a time-reversed process of lasing or EM emitting. It provides a promising way for complete absorption in both nanophotonics and electromagnetics. In this review, we discuss basic principles and properties of a coherent perfect absorber (CPA). Various subwavelength structures including thin films, metamaterials and waveguide-based structures to realize CPAs are compared. We also discuss the potential applications of CPAs.

Laser Supported Reduction of Specific Microorganisms in the Periodontal Pocket with the Aid of an Er,Cr:YSGG Laser: A Pilot Study

Directory of Open Access Journals (Sweden)

N. Gutknecht

2015-01-01

Full Text Available Objective. The aim of this study was to evaluate the effectiveness of a radial firing tip of an Er,Cr:YSGG laser as an adjunct to a nonsurgical periodontal treatment. Methods. Twelve patients with chronic or aggressive periodontitis were treated by conventional periodontal treatment using ultrasonic devices and hand instruments and, additionally, in two quadrants with an Er,Cr:YSGG laser. A new radial firing tip (RFPT 14-5, Biolase was used with 1.5 W, 30 Hz, 11% air, 20% water, and pulse duration 140 μs. Microbiological smears were taken before treatment, one day after lasing, and three and six months after lasing. Pocket depths of all periodontal sites were measured before and six months after treatment. Results. The total bacterial load of Prevotella intermedia, Tannerella forsythia, Treponema denticola, Fusobacterium nucleatum, Porphyromonas gingivalis, and Aggregatibacter actinomycetemcomitans inside the pocket was reduced significantly throughout the whole examination time. Greater pocket depth reductions were observed in all groups. There was a slight higher reduction of pocket depth in the lased group after six months. Conclusions. These results support the thesis that Er,Cr:YSGG laser supported periodontal treatment leads to a significant reduction of periopathogenes and thereby helps the maintenance of periodontal health.

Design study of high gradient, low impedance accelerating structures for the FERMI free electron laser linac upgrade

Science.gov (United States)

Shafqat, N.; Di Mitri, S.; Serpico, C.; Nicastro, S.

2017-09-01

The FERMI free-electron laser (FEL) of Elettra Sincrotrone Trieste, Italy, is a user facility driven by a 1.5 GeV 10-50 Hz S-band radiofrequency linear accelerator (linac), and it is based on an external laser seeding scheme that allows lasing at the shortest fundamental wavelength of 4 nm. An increase of the beam energy to 1.8 GeV at a tolerable breakdown rate, and an improvement of the final beam quality is desired in order to allow either lasing at 4 nm with a higher flux, or lasing at shorter wavelengths. This article presents the impedance analysis of newly designed S-band accelerating structures, for replacement of the existing backward travelling wave structures (BTWS) in the last portion of the FERMI linac. The new structure design promises higher accelerating gradient and lower impedance than those of the existing BTWS. Particle tracking simulations show that, with the linac upgrade, the beam relative energy spread, its linear and nonlinear z-correlation internal to the bunch, and the beam transverse emittances can be made smaller than the ones in the present configuration, with expected advantage to the FEL performance. The repercussion of the upgrade on the linac quadrupole magnets setting, for a pre-determined electron beam optics, is also considered.

Widely tunable single-/dual-wavelength fiber lasers with ultra-narrow linewidth and high OSNR using high quality passive subring cavity and novel tuning method.

Science.gov (United States)

Feng, Ting; Ding, Dongliang; Yan, Fengping; Zhao, Ziwei; Su, Hongxin; Yao, X Steve

2016-08-22

High stability single- and dual-wavelength compound cavity erbium-doped fiber lasers (EDFLs) with ultra-narrow linewidth, high optical signal to noise ratio (OSNR) and widely tunable range are demonstrated. Different from using traditional cascaded Type-1/Type-2 fiber rings as secondary cavities, we nest a Type-1 ring inside a Type-2 ring to form a passive subring cavity to achieve single-longitudinal-mode (SLM) lasing with ultra-narrow linewidth for the first time. We also show that the SLM lasing stability can be further improved by inserting a length of polarization maintaining fiber in the Type-2 ring. Using a uniform fiber Bragg grating (FBG) and two superimposed FBGs as mode restricting elements, respectively, we obtain a single-wavelength EDFL with a linewidth as narrow as 715 Hz and an OSNR as high as 73 dB, and a dual-wavelength EDFL with linewidths less than 1 kHz and OSNRs higher than 68 dB for both lasing wavelengths. Finally, by employing a novel self-designed strain adjustment device capable of applying both the compression and tension forces to the FBGs for wavelength tuning, we achieve the tuning range larger than 10 nm for both of the EDFLs.

Photon-phonon laser on crystalline silicon: a feasibility study

International Nuclear Information System (INIS)

Zadernovsky, A A

2015-01-01

We discuss a feasibility of photon-phonon laser action in bulk silicon with electron population inversion. It is well known, that only direct gap semiconductors are used as an active medium in optical lasers. In indirect gap semiconductors, such as crystalline silicon, the near-to-gap radiative electron transitions must be assisted by emission or absorption of phonons to conserve the momentum. The rate of such two-quantum transitions is much less than in direct gap semiconductors, where the similar radiative transitions are single-quantum. As a result, the quantum efficiency of luminescence in silicon is too small to get it as a laser material. Numerous proposals to overcome this problem are aimed at increasing the rate of radiative recombination. We suggest enhancing the quantum efficiency of luminescence in silicon by stimulating the photon part of the two-quantum transitions by light from an appropriate external laser source. This allows us to obtain initially an external-source-assisted lasing in silicon and then a true photon-phonon lasing without any external source of radiation. Performed analysis revealed a number of requirements to the silicon laser medium (temperature, purity and perfection of crystals) and to the intensity of stimulating radiation. We discuss different mechanisms that may hinder the implementation of photon-phonon lasing in silicon

Compact compressive arc and beam switchyard for energy recovery linac-driven ultraviolet free electron lasers

Science.gov (United States)

Akkermans, J. A. G.; Di Mitri, S.; Douglas, D.; Setija, I. D.

2017-08-01

High gain free electron lasers (FELs) driven by high repetition rate recirculating accelerators have received considerable attention in the scientific and industrial communities in recent years. Cost-performance optimization of such facilities encourages limiting machine size and complexity, and a compact machine can be realized by combining bending and bunch length compression during the last stage of recirculation, just before lasing. The impact of coherent synchrotron radiation (CSR) on electron beam quality during compression can, however, limit FEL output power. When methods to counteract CSR are implemented, appropriate beam diagnostics become critical to ensure that the target beam parameters are met before lasing, as well as to guarantee reliable, predictable performance and rapid machine setup and recovery. This article describes a beam line for bunch compression and recirculation, and beam switchyard accessing a diagnostic line for EUV lasing at 1 GeV beam energy. The footprint is modest, with 12 m compressive arc diameter and ˜20 m diagnostic line length. The design limits beam quality degradation due to CSR both in the compressor and in the switchyard. Advantages and drawbacks of two switchyard lines providing, respectively, off-line and on-line measurements are discussed. The entire design is scalable to different beam energies and charges.

An externally heated copper vapour laser

International Nuclear Information System (INIS)

Rochefort, P.A.; Sopchyshyn, F.C.; Selkirk, E.B.; Green, L.W.

1993-08-01

A pulsed Copper Vapour Laser (CVL), with a nominal 6 kHz repetition rate, was designed, build, and commissioned at Chalk River laboratories. The laser was required for Resonant Ionization Mass Spectroscopy (RIMS) experiments and for projects associated with Atomic Vapour laser Isotope Separation (AVLIS) studies. For the laser to operate, copper coupons position along the length of a ceramic tube must be heated sufficiently to create an appropriate vapour pressure. The AECL CVL uses an external heater element with a unique design to raise the temperature of the tube. The Cylindrical graphite heating element is shaped to compensate for the large radiation end losses of the laser tube. The use of an external heater saves the expensive high-current-voltage switching device from heating the laser tube, as in most commercial lasers. This feature is especially important given the intermittent usage typical of experimental research. As well, the heater enables better parametric control of the laser output when studying the lasing of copper (or other) vapour. This report outlines the lasing process in copper vapour, describes in detail all three major laser sub-systems: the laser body; the laser tube heater; the high voltage pulsed discharge; and, reports parametric measurements of the individual sub-systems and the laser system as a whole. Also included are normal operating procedures to heat up, run and shut down the laser

Luminescence behaviour of room temperature chemical processed all-inorganic CsPbCl3 perovskite cubes

Science.gov (United States)

Paul, T.; Chatterjee, B. K.; Maiti, S.; Besra, N.; Thakur, S.; Sarkar, S.; Chanda, K.; Das, A.; Sarkar, P. K.; Sardar, K.; Chattopadhyay, K. K.

2018-05-01

All inorganic perovskites with different halide constituent have recently truncated the eyes of researchers owing to their intriguing optoelectronic features and thereby their usage perspective in photovoltaic applications, light emitting didoes and lasing devices. Here, adopting a simple, environment benign ambient conditioned chemical synthesis approach we have realized high quality cesium lead halide perovskite (CsPbCl3) cube. The crystallinity and morphological characterizations were performed by X-ray diffraction and field emission scanning electron microscope measurements respectively while the chemical composition were examined via energy-dispersive X-ray spectroscopic measurement. The as synthesized cubes crystallized in cubic phase and exhibited intense photoluminescence emission at ˜418 nm with a small FWHM value and prolonged photoluminescence decay time˜41 ns. Besides photoluminescence, these cubes displayed strong cathodoluminescence also. Accelerating voltage dependent cathodoluminescence study showed discernable differences in luminescence behaviour. We expect this synthetic strategy to be promising as it can be easily scaled up to produce bulk quantity nanoforms of different inorganic perovskites in subtle manner for the realization of several types of nanoscale devices.

Rauno Pukonen : Meie toodangut armastatakse, meid endid mitte / Rauno Pukonen ; interv. Svea Talving

Index Scriptorium Estoniae

Pukonen, Rauno

2004-01-01

Farmaatsiafirmast Eli Lilly, ravimifirmade madalast mainest. Eli Lilly filiaali juhi sõnul ei lase väike turg ja tagasihoidlik kompensatsioon võimalikku ravimivalikut Eestisse tuua. Lisa: Fakte ettevõttest

Mirrorless Lasing in Optically Pumped Rubidium Vapor

Science.gov (United States)

2013-03-01

2 or 6P1/2-6S1/2, I is the pump intensity, and Isat is found using equation 4.3. sat = hν32(32 + 30) 32 , (4.3) where ν32 is the...is the small signal gain coefficient, Isat is the saturation intensity, and z is the gain path length. With this assumption the IR pulse energy at

Optical Properties and Lasing in GaN

National Research Council Canada - National Science Library

Song, J

2001-01-01

.... In the second article. femtosecond pump-probe transmission spectroscopy was used to study the nonequilibrium carrier dynamics in a GaN thin film at 10 K with carrier densities ranging from 4 x 10(exp 17) to 10(exp 19)/cu cm...

Improvement of a triple-wavelength erbium-doped fiber laser using a Fabry–Perot laser diode

International Nuclear Information System (INIS)

Peng, P C; Hu, H L; Wang, J B

2013-01-01

This work demonstrates the feasibility of a simple construct of a tunable triple-wavelength fiber ring laser using a Fabry–Perot laser diode (FP-LD) and an optical tunable bandpass filter. An optical tunable bandpass filter is used within the cavity of an erbium-doped fiber laser to select the lasing wavelength. Because the Fabry–Perot laser diode is in combination with the tunable bandpass filter, the erbium-doped fiber laser can stably lase three wavelengths simultaneously. Moreover, this laser is easily tuned dynamically. This triple-wavelength output performs satisfactorily, with its optical side-mode-suppression-ratio (SMSR) exceeding 40 dB. Furthermore, the wavelength tuning range of this triple-wavelength erbium-doped fiber laser is greater than 27 nm. (paper)

Fusion pumped laser

Science.gov (United States)

Pappas, D.S.

1987-07-31

The apparatus of this invention may comprise a system for generating laser radiation from a high-energy neutron source. The neutron source is a tokamak fusion reactor generating a long pulse of high-energy neutrons and having a temperature and magnetic field effective to generate a neutron flux of at least 10/sup 15/ neutrons/cm/sup 2//center dot/s. Conversion means are provided adjacent the fusion reactor at a location operable for converting the high-energy neutrons to an energy source with an intensity and energy effective to excite a preselected lasing medium. A lasing medium is spaced about and responsive to the energy source to generate a population inversion effective to support laser oscillations for generating output radiation. 2 figs., 2 tabs.

NONLINEAR OPTICAL PHENOMENA Intracavity SRS conversion in diode-pumpedmultifunctional Nd3+:SrMoO4 laser crystal

Science.gov (United States)

Basiev, Tasoltan T.; Smetanin, Sergei N.; Fedin, Aleksandr V.; Shurygin, Anton S.

2010-10-01

Lasing of a miniature all-solid-state SRS laser based on a Nd3+:SrMoO4 crystal with a LiF:F2--passive Q-switch is studied. The dependences of the laser and SRS self-conversion parameters on the initial transmission of the passive Q-switch are studied experimentally and theoretically. Simulation of the lasing kinetics has shown the possibility of nonlinear cavity dumping upon highly efficient SRS self-conversion of laser radiation. An increase in the active medium length from 1 to 3mm resulted in an increase in the energy of the output 1.17-μm SRS radiation from 20 μJ to record-high 60 μJ at the absorbed multimode diode pump energy of 3.7 mJ.

Diode-pumped two-frequency lasers based on c-cut vanadate crystals

International Nuclear Information System (INIS)

Sirotkin, A A; Garnov, Sergei V; Zagumennyi, A I; Zavartsev, Yu D; Kutovoi, S A; Vlasov, V I; Shcherbakov, Ivan A

2009-01-01

The luminescent and lasing properties of the neo-dymium ion at the 4 F 3/2 - 4 I 11/2 transition in c-cut vanadate crystals (Nd:YVO 4 , Nd:GdVO 4 , and Nd:Gd 1-x Y x VO 4 ) are studied. Tuning of the laser radiation wavelength (Δλ = 5.4 nm) is demonstrated. Two-frequency laser schemes with the use of a Lyot filter, a Fabry-Perot etalon, and a Brewster prism as spectral selection elements are proposed and experimentally realised. Stable two-frequency lasing of a laser based on the c-cut Nd:GdVO 4 crystal was obtained in the cw, Q-switched (nanosecond pulses), and active acousto-optic mode-locked (picosecond pulses) regimes. (lasers)

Coaxial direct-detection lidar-system

DEFF Research Database (Denmark)

2014-01-01

The invention relates to a coaxial direct-detection LIDAR system for measuring velocity, temperature and/or particulate density. The system comprises a laser source for emitting a laser light beam having a lasing center frequency along an emission path. The system further comprises an optical....... Finally, the system comprises a detector system arranged to receive the return signal from the optical delivery system, the detector system comprising a narrowband optical filter and a detector, the narrowband optical filter having a filter center frequency of a pass-band, wherein the center lasing...... frequency and/or the center filter frequency may be scanned. The invention further relates to an aircraft airspeed measurement device, and a wind turbine airspeed measurement device comprising the LIDAR system....

Conceptual design of 100 J cryogenically-cooled multi-slab laser for fusion research

Directory of Open Access Journals (Sweden)

Divoky M.

2013-11-01

Full Text Available We present a comparison of two alternative laser layouts for HiLASE and ELI Beamlines projects. The cryogenically cooled laser is 100 J class with 2 ns pulse length and operates at 10 Hz repetition rate. The laser beam is intended for industrial applications in HiLASE, for OPCPA pumping in ELI Beamlines and can serve as a test bed for large scale high repetition rate fusion lasers. First layout utilizes classical scheme with preamplifier and main amplifier, while the second layout utilizes single amplifier scheme with two amplifier heads. The comparison is based on the results obtained from homemade MATLAB code for evaluation of amplified spontaneous emission and stored energy and on a beam propagation simulated in MIRÓ code.

Forward voltage short-pulse technique for measuring high power laser array junction temperature

Science.gov (United States)

Meadows, Byron L. (Inventor); Amzajerdian, Frazin (Inventor); Barnes, Bruce W. (Inventor); Baker, Nathaniel R. (Inventor)

2012-01-01

The present invention relates to a method of measuring the temperature of the P-N junction within the light-emitting region of a quasi-continuous-wave or pulsed semiconductor laser diode device. A series of relatively short and low current monitor pulses are applied to the laser diode in the period between the main drive current pulses necessary to cause the semiconductor to lase. At the sufficiently low current level of the monitor pulses, the laser diode device does not lase and behaves similar to an electronic diode. The voltage across the laser diode resulting from each of these low current monitor pulses is measured with a high degree of precision. The junction temperature is then determined from the measured junction voltage using their known linear relationship.

Relationship of light-output nonlinearities and light-output spikes in proton-bombarded stripe-geometry double-heterostructure (Al,Ga)As lasers

International Nuclear Information System (INIS)

Dixon, R.W.; Joyce, W.B.; Miller, R.C.

1979-01-01

By using a fast photodetector and a simple spatial filtering technique, the relationship between the optical spike which frequently appears at the leading edge of a pulsed-GaAs-laser response and the optical nonlinearities called kinks has been investigated. It is suggested that the spike can be viewed consistently as a transition period during which the lasing mode distortion, which has been previously associated with kinks, occurs. It is the time taken for the kink to become established. During the spike, light emisson occurs with a spatial and angular intensity distribution consistent with the lasing which would be appropriate if the kink did not exist. It is shown that the experimental technique can also be used to investigate sustained laser optical-intensity oscillations

Random lasing in Nd{sup 3+} doped potassium gadolinium tungstate crystal powder

Energy Technology Data Exchange (ETDEWEB)

Moura, André L., E-mail: andre.moura@fis.ufal.br [Grupo de Física da Matéria Condensada, Núcleo de Ciências Exatas – NCEx, Campus Arapiraca, Universidade Federal de Alagoas, 57309-005, Arapiraca, AL (Brazil); Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Fewo, Serge I. [Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Laboratory of Mechanics, Department of Physics, University of Yaoundé I, Yaoundé (Cameroon); Carvalho, Mariana T.; Gomes, Anderson S. L.; Araújo, Cid B. de [Departamento de Física, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Kuzmin, Andrey N.; Prasad, Paras N. [Institute for Lasers, Photonics and Biophotonics, The State University of New York, Buffalo, New York 14260-3000 (United States)

2015-02-28

Random laser (RL) emission in Nd{sup 3+} doped potassium gadolinium tungstate—KGd(WO{sub 4}){sub 2}:Nd{sup 3+}—crystal powder is demonstrated. The powder was excited at 813 nm in resonance with the Nd{sup 3+} transition {sup 4}I{sub 9/2}→{sup 4}F{sub 5/2}. RL emission at 1067 nm due to the {sup 4}F{sub 3/2}→{sup 4}I{sub 11/2} transition was observed and characterized. An intensity threshold dependent on the laser spot area and bandwidth narrowing from ≈2.20 nm to ≈0.40 nm were observed and measured. For a beam spot area of 0.4 mm{sup 2}, a RL threshold of 6.5 mJ/mm{sup 2} (90 MW/cm{sup 2}) was determined. For excitation intensity smaller than the RL threshold, only spontaneous emission from level {sup 4}F{sub 3/2} with decay time in the tens microsecond range was observed, but for excitation above the RL threshold, significant shortening of excited level lifetime, characteristic of a stimulated process was found. The overall characteristics measured show that KGd(WO{sub 4}){sub 2}:Nd{sup 3+} is an efficient material for operation of solid state RLs in the near-infrared.

Rapid prototyping of 2D glass microfluidic devices based on femtosecond laser assisted selective etching process

Science.gov (United States)

Kim, Sung-Il; Kim, Jeongtae; Koo, Chiwan; Joung, Yeun-Ho; Choi, Jiyeon

2018-02-01

Microfluidics technology which deals with small liquid samples and reagents within micro-scale channels has been widely applied in various aspects of biological, chemical, and life-scientific research. For fabricating microfluidic devices, a silicon-based polymer, PDMS (Polydimethylsiloxane), is widely used in soft lithography, but it has several drawbacks for microfluidic applications. Glass has many advantages over PDMS due to its excellent optical, chemical, and mechanical properties. However, difficulties in fabrication of glass microfluidic devices that requires multiple skilled steps such as MEMS technology taking several hours to days, impedes broad application of glass based devices. Here, we demonstrate a rapid and optical prototyping of a glass microfluidic device by using femtosecond laser assisted selective etching (LASE) and femtosecond laser welding. A microfluidic droplet generator was fabricated as a demonstration of a microfluidic device using our proposed prototyping. The fabrication time of a single glass chip containing few centimeter long and complex-shaped microfluidic channels was drastically reduced in an hour with the proposed laser based rapid and simple glass micromachining and hermetic packaging technique.

Room Temperature Ultralow Threshold GaN Nanowire Polariton Laser

KAUST Repository

Das, Ayan; Heo, Junseok; Jankowski, Marc; Guo, Wei; Zhang, Lei; Deng, Hui; Bhattacharya, Pallab

2011-01-01

, and 2 orders of magnitude lower than any existing room-temperature polariton devices. Spectral, polarization, and coherence properties of the emission were measured to confirm polariton lasing. © 2011 American Physical Society.

Random laser action in 3-D ZnO nanostructures

Energy Technology Data Exchange (ETDEWEB)

Miao, L.; Tanemura, S. [Key Laboratory of Renewable Energy and Gas Hydrate, Guangzhou Institute of Energy Conversion, Chinese Academy of Sciences, No. 2 Nengyuan Rd. Tianhe district, Guangzhou (China); Materials R and D Laboratory, Japan Fine Ceramics Centre, Mutsuno, Atsuta-ku, Nagoya 456-8587 (Japan); Yang, H.Y.; Lau, S.P. [School of Electrical and Electronic Engineering, Nanyang Technological University (Singapore); Xu, G. [Key Laboratory of Renewable Energy and Gas Hydrate, Guangzhou Institute of Energy Conversion, Chinese Academy of Sciences, No. 2 Nengyuan Rd. Tianhe district, Guangzhou (China)

2009-05-15

Room-temperature ultraviolet random lasing with low threshold pumping power was successfully achieved by ZnO 3-D random-wall nanostructure fabricated on ZnO/SiO{sub 2}/Si substrate through a thermal chemical reaction and vapor transportation deposition method in a simple horizontal tube furnace from the mixed ZnO and graphite powders. The nanorods grown along c-axis on the substrate are coalesced to form the 3-D nano-wall with 80{proportional_to}100 nm in wall thickness and irregular height ranging of 95-250 nm. Mueller matrix spectroscopic ellipsometry reveals that evaluated refractive indices n(E) of ZnO nanowalls are well interpreted by taking account of the ratio between ZnO and void achieved by effective medium theory analysis and isotropic depolarization feature of the designated nanowalls. Random lasing action observed in the wide wavelength range between 375 and 395 nm is realized by coherent amplification of the closed-loop scattered light inside 3-D random-wall nanostructure. It is demonstrated that both transverse electric (TE) and transverse magnetic (TM) modes show the same threshold and pumping power dependent trend, while the intensity of TM lasing is weaker than that of TE due to the different scattering strength originated from the features of the inside of nanowall. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Research on tunable multiwavelength fiber lasers with two-section birefringence fibers and a nonlinear optical loop

Science.gov (United States)

Chen, Jiao; Tong, Zhengrong; Zhang, Weihua; Xue, Lifang; Pan, Honggang

2018-05-01

Two types of tunable multiwavelength fiber lasers based on two-section polarization maintaining fibers (PMFs) cascaded/in parallel and nonlinear optical loop are proposed and experimentally demonstrated. Two-section cascaded PMFs and two polarization controllers (PCs) form the two-stage Lyot filter, which can generate comb spectrum to achieve multiwavelength output. When two sections of PMFs are in parallel, PCs in two paths are adjusted to change the beam’s polarization to suppress the light of one branch, and then the light of the other branch passes through the cavity. Additionally, a nonlinear optical loop acts as an intensity-dependent component, which can suppress the mode competition to maintain a stable output of multiwavelength lasing. The nonlinear optical loop is made by a 3 dB coupler, a PC3, and a 200 m high nonlinear fiber. Two types of tunable multiwavelength fiber lasers can achieve tuning of the channel space and the number of lasing wavelengths by adjusting PC1 and PC2. The channel space of the multiwavelengh laser can be tuned at nearly 0.4, 0.68, and 0.92 nm. Meanwhile, the spectral range of multiwavelength lasing can be controlled by PC3 in the nonlinear optical loop, and the tuning range of two multiwavelength lasers is about 2.28 and 1.45 nm, respectively.

The dynamic characteristics and linewidth enhancement factor of quasi-supercontinuum self-assembled quantum dot lasers

KAUST Repository

Tan, Cheeloon

2009-09-01

The theoretical analysis of optical gain and chirp characteristics of a semiconductor quantum dot (Qdot) broadband laser is presented. The model based on population rate equations, has been developed to investigate the multiple states lasing or quasi-supercontinuum lasing in InGaAs/GaAs Qdot laser. The model takes into account factors such as Qdot size fluctuation, finite carrier lifetime in each confined energy states, wetting layer induced nonconfined states and the presence of continuum states. Hence, calculation of the linewidth enhancement factor together with the variation of optical gain and index change across the spectrum of interest becomes critical to yield a basic understanding on the limitation of this new class of lasers. Such findings are important for the design of a practical single broadband laser diode for applications in low coherence interferometry sensing and optical fiber communications. Calculation results show that the linewidth enhancement factor from the ground state of broadband Qdot lasers (α ∼ 3) is slightly larger but in the same order of magnitude as compared to that of conventional Qdot lasers. The gain spectrum of the quasi-supercontinuum lasing system exhibits almost twice the bandwidth than conventional lasers but with comparable material differential gain (∼ 10-16 cm2) and material differential refractive index (∼ 10sup>-20 cm3 ) near current threshold. © 2009 IEEE.

Oscillator and system development on the VULCAN glass laser system for the plasma beat-wave program

International Nuclear Information System (INIS)

Danson, C.N.

1990-03-01

This thesis describes the oscillator and system development on the VULCAN glass laser undertaken in support of the RAL Plasma Beat-wave experiments. This program seeks to evaluate advanced particle acceleration schemes for a new generation of machines for fundamental research in high energy physics. The experiments required two synchronised high power laser pulses of slightly different wavelength. These pulses were generated using two different laser media; Nd:YAG and Nd:YLF operating at 1.064 and 1.053 microns respectively. The first oscillator system developed operated with both lasing media housed in the same laser cavity. Problems with the stability of the optical output required the development of a second system which housed the two lasing media in separate cavities. The second aspect of the development work, described in this thesis, was the reconfiguration of the VULCAN glass laser system to amplify the two laser pulses to power levels of 0.5 TW per pulse. The first scheduled experiment required the two pulses to be propagated co-linearly. To amplify the pulses to the high output powers required two amplifying media to be used which preferentially amplify the two lasing wavelengths. For the later experiments the two laser pulses were amplified in separate amplifier chains which required the design of an efficient beam combiner. (author)

Optically-ionized plasma recombination x-ray lasers

International Nuclear Information System (INIS)

Amendt, P.; Eder, D.C.; Wilks, S.C.; Dunning, M.J.; Keane, C.J.

1991-01-01

Design studies for recombination x-ray lasers based on plasmas ionized by high intensity, short pulse optical lasers are presented. Transient lasing on n = 3 to n = 2 transitions in Lithium-like Neon allows for moderately short wavelengths (≤ 100 angstrom) without requiring ionizing intensities associated with relativistic electron quiver energies. The electron energy distribution following the ionizing pulse affects directly the predicted gains for this resonance transition. Efficiencies of 10 -6 or greater are found for plasma temperatures in the vicinity of 40 eV. Simulation studies of parametric heating phenomena relating to stimulated Raman and Compton scattering are presented. For electron densities less than about 2.5 x 10 20 cm -3 and peak driver intensity of 2 x 10 17 W/cm 2 at 0.25 μm with pulse length of 100 fsec, the amount of electron heating is found to be marginally significant. For Lithium-like Aluminum, the required relativistic ionizing intensity gives excessive electron heating and reduced efficiency, thereby rendering this scheme impractical for generating shorter wavelength lasing (≤ 50 angstrom) in the transient case. Following the transient lasing phase, a slow hydrodynamic expansion into the surrounding cool plasma is accompanied by quasi-static gain on the n = 4 to n = 3 transition in Lithium-like Neon. Parametric heating effects on gain optimization in this regime are also discussed. 18 refs., 6 figs

The dynamic characteristics and linewidth enhancement factor of quasi-supercontinuum self-assembled quantum dot lasers

KAUST Repository

Tan, Cheeloon; Wang, Yang; Djie, Hery Susanto; Ooi, Boon S.

2009-01-01

The theoretical analysis of optical gain and chirp characteristics of a semiconductor quantum dot (Qdot) broadband laser is presented. The model based on population rate equations, has been developed to investigate the multiple states lasing or quasi-supercontinuum lasing in InGaAs/GaAs Qdot laser. The model takes into account factors such as Qdot size fluctuation, finite carrier lifetime in each confined energy states, wetting layer induced nonconfined states and the presence of continuum states. Hence, calculation of the linewidth enhancement factor together with the variation of optical gain and index change across the spectrum of interest becomes critical to yield a basic understanding on the limitation of this new class of lasers. Such findings are important for the design of a practical single broadband laser diode for applications in low coherence interferometry sensing and optical fiber communications. Calculation results show that the linewidth enhancement factor from the ground state of broadband Qdot lasers (α ∼ 3) is slightly larger but in the same order of magnitude as compared to that of conventional Qdot lasers. The gain spectrum of the quasi-supercontinuum lasing system exhibits almost twice the bandwidth than conventional lasers but with comparable material differential gain (∼ 10-16 cm2) and material differential refractive index (∼ 10sup>-20 cm3 ) near current threshold. © 2009 IEEE.

Multimode laser emission from free-standing cylindrical microcavities

Energy Technology Data Exchange (ETDEWEB)

Peter, Jaison, E-mail: jaisonpeter@cusat.ac.in; Radhakrishnan, P.; Nampoori, V.P.N.; Kailasnath, M.

2014-05-01

We report a well resolved whispering gallery mode (WGM) laser emission from a free-standing microring cavity based on a dye doped hollow polymer optical fiber (DDHPOF), which is transversely pumped by a pulsed Nd:YAG laser. The microring laser is characterized by a well-defined, low threshold pump power at which the emission spectral intensity dramatically increases and collapses into several dominant microcavity laser modes with reduced mode spacing and high Q-value. Resonant modes are excited inside the gain medium which is strongly confined along the radial direction so that the spacing of lasing modes is controlled by the diameter of the cylindrical microcavity. A variation in the free spectral range of WGM spectra from 0.23 to 0.09 nm coupled with a red-shift is observed with an increase in the diameter of DDHPOFs. - Highlights: • Different diameter free-standing cylindrical microcavity lasers have been fabricated and their performances have been evaluated. • The microring laser is characterized by a well-defined, low threshold pump power, with reduced mode spacing and high Q-value. • When the diameter of DDHPOF increases, the number of lasing peaks increases along with the decrease of the FSR as observed from our studies. • It is also found that whispering gallery lasing envelope is shifted from 559 to 571 nm (Stokes shift) with the diameter.

Free Electron Lasers 1998. Proceedings of the Twentieth International Free Electron Laser Conference Held in Williamsburg, Virginia, USA, on August 16-21, 1998

National Research Council Canada - National Science Library

Neil, G

1999-01-01

.... Sessions highlighting research in the following topics were: New Lasing, FEL Theory, SASE FELs, Accelerator Technology, FEL Technology, Linac-Based FELS, Storage-Ring-Based FELs, UV and X-ray Sources, and New Concepts...

Isolation and characterization of β-glucosidase producing bacteria ...

African Journals Online (AJOL)

Administrator

2011-10-26

Oct 26, 2011 ... lase enzyme system, along with endoglucanase and cellobiohydrolase. ... biomass substrates, for synthesis of useful glucosides, in flavor industry for ... 2007) and in the bioconversion of phenolic anti-oxidants from defatted ...

Dead souls

Index Scriptorium Estoniae

2008-01-01

Venemaa ei lase end gaasijuhtme Nord Stream kavandamisel häirida Euroopa Parlamendi liikme Andres Tarandi ja ajaloolase Mati Õuna väitel gaasijuhtme piirkonda jäävatest laevavrakkidest ja sõjahaudadest

The Development of a Hibachi Window for Electron Beam Transmission in a KrF Laser

International Nuclear Information System (INIS)

Gentile, C.A.; Parsells, R.; Butler, J.E.; Sethian, J.D.; Ciebiera, L.; Hegeler, F.; Jun, C.; Langish, S.; Myers, M.

2003-01-01

In support of Inertial Fusion Energy (IFE), a 150 (micro)m thick silicon (Si) wafer coated on one side with a 1.2 (micro)m nanocrystalline diamond foil is being fabricated as an electron beam transmission (hibachi) window for use in KrF lasers. The hibachi window separates the lasing medium from the electron beam source while allowing the electron beam to pass through. The hibachi window must be capable of withstanding the challenging environment presented in the lasing chamber, which include: fluorine gas, delta pressure >2 atm at 5 Hz, and a high heat flux due to the transmission of electrons passing through the foil. Tests at NRL/Electra and at PPPL have shown that a device employing these novel components in the stated configuration provide for a robust hibachi window with structural integrity

Fusion pumped light source

Science.gov (United States)

Pappas, Daniel S.

1989-01-01

Apparatus is provided for generating energy in the form of light radiation. A fusion reactor is provided for generating a long, or continuous, pulse of high-energy neutrons. The neutron flux is coupled directly with the lasing medium. The lasing medium includes a first component selected from Group O of the periodic table of the elements and having a high inelastic scattering cross section. Gamma radiation from the inelastic scattering reactions interacts with the first component to excite the first component, which decays by photon emission at a first output wavelength. The first output wavelength may be shifted to a second output wavelength using a second liquid component responsive to the first output wavelength. The light outputs may be converted to a coherent laser output by incorporating conventional optics adjacent the laser medium.

Development of transient collisional excitation x-ray laser with ultra short-pulse laser

International Nuclear Information System (INIS)

Kado, Masataka; Kawachi, Tetsuya; Hasegawa, Noboru; Tanaka, Momoko; Sukegawa, Kouta; Nagashima, Keisuke; Kato, Yoshiaki

2001-01-01

We have observed lasing on Ne-like 3s-3p line from titanium (32.4 nm), Ni-like 4p-4d line from silver (13.9 nm) and tin (11.9 nm) with the transient collisional excitation (TCE) scheme that uses combination of a long pre-pulse (∼ns) and a short main pulse (∼ps). A gain coefficient of 23 cm -1 was measured for plasma length up to 4 mm with silver slab targets. We have also observed lasing on Ne-like and Ni-like lines with new TCE scheme that used pico-seconds laser pulse to generate plasma and observed strong improvement of x-ray laser gain coefficient. A gain coefficient of 14 cm -1 was measured for plasma length up to 6 mm with tin targets. (author)

Line overlap measurements for resonant photo-pumping of x-ray lasers

International Nuclear Information System (INIS)

Elliott, S.R.; Beiersdorfer, P.; Nilsen, J.

1993-01-01

Measurement taken on the LLNL EBIT to search for the possible photo-pumping of the 3p-3s lasing transitions in Ni-like ions of elements with Z=30--40 and the 4d-4p lasing transitions in Ne-like ions of elements with Z=47-73 are reported. A high-resolution crystral spectrometer was used to measure wavelengths of the Ne-like 2p-4d and the Ni-like 3d-5f and 3d-6f laser level feeding transitions relative to candidate pump lines in various H-, He-, and Ni-like ions. To date, the most promising candidate is Ni-like Pt pumping Ne-like Rb at 2512 eV. The line energies differ by 0.4±0.1 eV or by 160 ppm

Demonstration of a transient high gain nickel-like xenon ion x-ray laser

International Nuclear Information System (INIS)

Lu, Peixiang; Kawachi, Tetsuya; Kishimoto, Maki

2003-01-01

We demonstrate a high gain nickel-like xenon ion x-ray laser using a picosecond-laser-irradiated gas puff target. The elongated x-ray laser plasma column was produced by irradiating the gas puff target with line-focused double picosecond laser pulses with a total energy of 18 J in a travelling-wave excitation scheme. Strong lasing at 9.98 nm was observed, and a high gain coefficient of 17.4 cm -1 was measured on the transient collisionally excited 4d-4p, J=0-1 transition for nickel-like xenon ion with target lengths up to 0.45 cm. A weak nickel-like lasing line at a shorter wavelength of 9.64 nm was also observed with a gain coefficient of 5.9 cm -1 . (author)

Eksminister jäi Citigroupis jänni / Tõnis Oja

Index Scriptorium Estoniae

Oja, Tõnis, 1957-

2009-01-01

USA endine rahandusminister ja Citigroupi nõukogu liige Robert Rubin teatas, et astub nõuniku kohalt tagasi ning ei lase end enam nõukogu liikmeks tagasi valida. Diagramm: Citigroupi aktsia hind ja majandusnäitajad

BeZnCdSe quantum-well ridge-waveguide laser diodes under low threshold room-temperature continuous-wave operation

Energy Technology Data Exchange (ETDEWEB)

Feng, Jijun [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); Electronics and Photonics Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba, Ibaraki 305-8568 (Japan); Akimoto, Ryoichi, E-mail: r-akimoto@aist.go.jp [Electronics and Photonics Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba, Ibaraki 305-8568 (Japan)

2015-10-19

Low threshold current ridge-waveguide BeZnCdSe quantum-well laser diodes (LDs) have been developed by completely etching away the top p-type BeMgZnSe/ZnSe:N short-period superlattice cladding layer, which can suppress the leakage current that flows laterally outside of the electrode. The waveguide LDs are covered with a thick SiO{sub 2} layer and planarized with chemical-mechanical polishing and a reactive ion etching process. Room-temperature lasing under continuous-wave condition is achieved with the laser cavity formed by the cleaved waveguide facets coated with high-reflectivity dielectric films. For a 4 μm-wide green LD lasing around a wavelength of 535 nm, threshold current and voltage of 7.07 mA and 7.89 V are achieved for a cavity length of 300 μm, and the internal differential quantum efficiency, internal absorption loss, gain constant, and nominal transparency current density are estimated to be 27%, 4.09 cm{sup −1}, 29.92 (cm × μm)/kA and 6.35 kA/(cm{sup 2 }× μm), respectively. This compact device can realize a significantly improved performance with much lower threshold power consumption, which would benefit the potential application for ZnSe-based green LDs as light sources in full-color display and projector devices installed in consumer products such as pocket projectors.

Evaluation of crystalline changes and resistance to demineralization of the surface of human dental enamel treated with Er:YAG laser and fluoride using x-ray diffraction analysis and Vickers microhardness

Science.gov (United States)

Behroozibakhsh, Marjan; Shahabi, Sima; Ghavami-Lahiji, Mehrsima; Sadeghian, Safura; Sadat Faal Nazari, Neda

2018-06-01

This study aimed to investigate the changes in crystalline structure and resistance to demineralization of human dental surface enamel treated with erbium-doped yttrium aluminium garnet laser (Er:YAG) laser and fluoride. The enamel surfaces were divided into four groups according to the treatment process including, (L): irradiated with Er:YAG; (F): treated with acidulated phosphate fluoride gel (LF): Pre-irradiated surfaces with Er:YAG subjected to acidulated phosphate fluoride gel and (FL): laser irradiation was performed on the fluoridated enamel surface. Before and after the treatment procedure, the samples were evaluated using X-ray diffraction, scanning electron microscope (SEM) and the Vickers microhardness test. The surface microhardness values also were measured after a pH-cycling regime and acid challenge. The a-axis of all lased groups was contracted after treatment procedure. Measurement of the area under the peaks showed the highest crysallinity in the FL group. The hardness values of all laser treated samples significantly reduced after treatment procedure compared to the F group (p  ⩽  0.001). The morphological observations showed remarkable changes on the lased enamel surfaces including cracks, craters and exposed prisms. These findings suggest, irradiation of the Er:YAG laser accompanying with fluoride application can induce some beneficial crystalline changes regarding the acid-resistance properties of enamel, however, the craters and cracks produced by laser irradiation can promote enamel demineralization and consequently the positive effects of the Er:YAG laser will be eliminated.

High Performance self-injection locked 524 nm green laser diode for high bitrate visible light communications

KAUST Repository

Shamim, Md. Hosne Mobarok; Shemis, Mohamed; Shen, Chao; Oubei, Hassan M.; Ng, Tien Khee; Ooi, Boon S.; Khan, Mohammed Zahed Mustafa

2018-01-01

First demonstration of self-injection locking on 524 nm visible laser diode is presented. Enhancement by ~440 MHz (~30%) in modulation bandwidth, ~7 times reduction in lasing linewidth, and ~10 dB improvement in SMSR is achieved.

Kantsler Angela Merkel lubas Saksa majanduse käima tõmmata / Kaivo Kopli

Index Scriptorium Estoniae

Kopli, Kaivo

2005-01-01

Saksa kantsler Angela Merkel pidas parlamendis esimese programmilise kõne. Kriitikute hinnangul jäi Merkel üldsõnaliseks. Lisa: Saksamaa ei lase end shantazheerida. Vt. samas: Aino Siebert. Saksamaa liidukantsler saab palka töölepinguta

High Performance self-injection locked 524 nm green laser diode for high bitrate visible light communications

KAUST Repository

Shamim, Md. Hosne Mobarok

2018-03-05

First demonstration of self-injection locking on 524 nm visible laser diode is presented. Enhancement by ~440 MHz (~30%) in modulation bandwidth, ~7 times reduction in lasing linewidth, and ~10 dB improvement in SMSR is achieved.

Rare-Earth Oxide Ion (Tm3+, Ho3+, and U3+) Doped Glasses and Fibres for 1.8 to 4 Micrometer Coherent and Broadband Sources

National Research Council Canada - National Science Library

Richards, Billy; Shen, Shaoxiong; Jha, Animesh

2006-01-01

... (TeO2), fluorine-containing silicate (SiOF2) and germanate (GeOF2) glass hosts for each dopant by characterising the spectroscopic properties, including absorption and emission cross-sections and the lifetimes of the lasing levels...

Comparison of various excitation and detection schemes for dye-doped polymeric whispering gallery mode micro-lasers.

Science.gov (United States)

Siegle, Tobias; Kellerer, Jonas; Bonenberger, Marielle; Krämmer, Sarah; Klusmann, Carolin; Müller, Marius; Kalt, Heinz

2018-02-05

We compare different excitation and collection configurations based on free-space optics and evanescently coupled tapered fibers for both lasing and fluorescence emission from dye-doped doped polymeric whispering gallery mode (WGM) micro-disk lasers. The focus of the comparison is on the lasing threshold and efficiency of light collection. With the aid of optical fibers, we localize the pump energy to the cavity-mode volume and reduce the necessary pump energy to achieve lasing by two orders of magnitude. When using fibers for detection, the collection efficiency is enhanced by four orders of magnitude compared to a free-space read-out perpendicular to the resonator plane. By enhancing the collection efficiency we are able to record a pronounced modulation of the dye fluorescence under continuous wave (cw) pumping conditions evoked by coupling to the WGMs. Alternatively to fibers as a collection tool, we present a read-out technique based on the detection of in-plane radiated light. We show that this method is especially beneficial in an aqueous environment as well as for size-reduced micro-lasers where radiation is strongly pronounced. Furthermore, we show that this technique allows for the assignment of transverse electric (TE) and transverse magnetic (TM) polarization to the observed fundamental modes in a water environment by performing polarization-dependent photoluminescence (PL) spectroscopy. We emphasize the importance of the polarization determination for sensing applications and verify expected differences in the bulk refractive index sensitivity for TE and TM WGMs experimentally.

Optical defect modes in chiral liquid crystals

International Nuclear Information System (INIS)

Belyakov, V. A.; Semenov, S. V.

2011-01-01

An analytic approach to the theory of optical defect modes in chiral liquid crystals (CLCs) is developed. The analytic study is facilitated by the choice of the problem parameters. Specifically, an isotropic layer (with the dielectric susceptibility equal to the average CLC dielectric susceptibility) sandwiched between two CLC layers is studied. The chosen model allows eliminating the polarization mixing and reducing the corresponding equations to the equations for light of diffracting polarization only. The dispersion equation relating the defect mode (DM) frequency to the isotropic layer thickness and an analytic expression for the field distribution in the DM structure are obtained and the corresponding dependences are plotted for some values of the DM structure parameters. Analytic expressions for the transmission and reflection coefficients of the DM structure (CLC-defect layer-CLC) are presented and analyzed for nonabsorbing, absorbing, and amplifying CLCs. The anomalously strong light absorption effect at the DM frequency is revealed. The limit case of infinitely thick CLC layers is considered in detail. It is shown that for distributed feedback lasing in a defect structure, adjusting the lasing frequency to the DM frequency results in a significant decrease in the lasing threshold. The DM dispersion equations are solved numerically for typical values of the relevant parameters. Our approach helps clarify the physics of the optical DMs in CLCs and completely agrees with the corresponding results of the previous numerical investigations.

Single-mode surface plasmon distributed feedback lasers.

Science.gov (United States)

Karami Keshmarzi, Elham; Tait, R Niall; Berini, Pierre

2018-03-29

Single-mode surface plasmon distributed feedback (DFB) lasers are realized in the near infrared using a two-dimensional non-uniform long-range surface plasmon polariton structure. The surface plasmon mode is excited onto a 20 nm-thick, 1 μm-wide metal stripe (Ag or Au) on a silica substrate, where the stripe is stepped in width periodically, forming a 1st order Bragg grating. Optical gain is provided by optically pumping a 450 nm-thick IR-140 doped PMMA layer as the top cladding, which covers the entire length of the Bragg grating, thus creating a DFB laser. Single-mode lasing peaks of very narrow linewidth were observed for Ag and Au DFBs near 882 nm at room temperature. The narrow linewidths are explained by the low spontaneous emission rate into the surface plasmon lasing mode as well as the high quality factor of the DFB structure. The lasing emission is exclusively TM polarized. Kinks in light-light curves accompanied by spectrum narrowing were observed, from which threshold pump power densities can be clearly identified (0.78 MW cm-2 and 1.04 MW cm-2 for Ag and Au DFB lasers, respectively). The Schawlow-Townes linewidth for our Ag and Au DFB lasers is estimated and very narrow linewidths are predicted for the lasers. The lasers are suitable as inexpensive, recyclable and highly coherent sources of surface plasmons, or for integration with other surface plasmon elements of similar structure.

Guide Structures in CD-ROM Dic- tionaries, with Specific Reference ...

African Journals Online (AJOL)

Not all the search options in CD-ROM dictionaries necessarily maintain the boundaries ... In this article all derivatives of lase are highlighted in the microstructure, ... searches frustrates the user and should be addressed in future editions of the.

Emission dynamics of InAs/InP quantum-dash laser

KAUST Repository

Khan, Mohammed Zahed Mustafa

2012-01-01

The effect of current pulse width on the lasing spectra of chirp InAs/InP quantum-dash laser is presented. The spectra shows unusual splitting with increasing current injection which is correlated to the active region inhomogeneity.

Ultrafast-Laser-Induced Backward Stimulated Raman Scattering for Tracing Atmospheric Gases

Directory of Open Access Journals (Sweden)

Zheltiko A.

2013-03-01

Full Text Available By combining tunable broadband pulse generation with nonlinear spectral compression, we demonstrate a prototype scheme for highly selective coherent standoff sensing of air molecules and discuss its coupling to the recently demonstrated backward atmospheric lasing.

Coupled Photonic Crystal Cavity Array Laser

DEFF Research Database (Denmark)

Schubert, Martin

in the quadratic lattice. Processing techniques are developed and optimized in order fabricate photonic crystals membranes in gallium arsenide with quantum dots as gain medium and in indium gallium arsenide phosphide with quantum wells as gain medium. Several key issues in process to ensure good quality....... The results are in good agreement with standard coupled mode theory. Also a novel type of photonic crystal structure is proposed called lambda shifted cavity which is a twodimensional photonic crystal laser analog of a VCSEL laser. Detailed measurements of the coupled modes in the photonic crystals...... with quantum dots are carried out. In agreement with a simple gain model the structures do not show stimulated emission. The spectral splitting due to the coupling between single cavities as well as arrays of cavities is studied theoretically and experimentally. Lasing is observed for photonic crystal cavity...

Stability of optically injected two-state quantum-dot lasers

Energy Technology Data Exchange (ETDEWEB)

Meinecke, Stefan; Lingnau, Benjamin; Roehm, Andre; Luedge, Kathy [Institut fuer Theoretische Physik, Technische Universitaet Berlin (Germany)

2017-12-15

Simultaneous two-state lasing is a unique property of semiconductor quantum-dot (QD) lasers. This not only changes steady-state characteristics of the laser device but also its dynamic response to perturbations. In this paper we investigate the dynamic stability of QD lasers in an external optical injection setup. Compared to conventional single-state laser devices, we find a strong suppression of dynamical instabilities in two-state lasers. Furthermore, depending on the frequency and intensity of the injected light, pronounced areas of bistability between both lasing frequencies appear, which can be employed for fast optical switching in all-optical photonic computing applications. These results emphasize the suitability of QD semiconductor lasers in future integrated optoelectronic systems where a high level of stability is required. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Stability of optically injected two-state quantum-dot lasers

International Nuclear Information System (INIS)

Meinecke, Stefan; Lingnau, Benjamin; Roehm, Andre; Luedge, Kathy

2017-01-01

Simultaneous two-state lasing is a unique property of semiconductor quantum-dot (QD) lasers. This not only changes steady-state characteristics of the laser device but also its dynamic response to perturbations. In this paper we investigate the dynamic stability of QD lasers in an external optical injection setup. Compared to conventional single-state laser devices, we find a strong suppression of dynamical instabilities in two-state lasers. Furthermore, depending on the frequency and intensity of the injected light, pronounced areas of bistability between both lasing frequencies appear, which can be employed for fast optical switching in all-optical photonic computing applications. These results emphasize the suitability of QD semiconductor lasers in future integrated optoelectronic systems where a high level of stability is required. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Quantum squeezed light for probing mitochondrial membranes and study of neuroprotectants

International Nuclear Information System (INIS)

Gourley, Paul Lee; Copeland, Robert Guild; McDonald, Anthony Eugene; Hendricks, Judy K.; Naviaux, Robert K.

2005-01-01

We report a new nanolaser technique for measuring characteristics of human mitochondria. Because mitochondria are so small, it has been difficult to study large populations using standard light microscope or flow cytometry techniques. We recently discovered a nano-optical transduction method for high-speed analysis of submicron organelles that is well suited to mitochondrial studies. This ultrasensitive detection technique uses nano-squeezing of light into photon modes imposed by the ultrasmall organelle dimensions in a semiconductor biocavity laser. In this paper, we use the method to study the lasing spectra of normal and diseased mitochondria. We find that the diseased mitochondria exhibit larger physical diameter and standard deviation. This morphological differences are also revealed in the lasing spectra. The diseased specimens have a larger spectral linewidth than the normal, and have more variability in their statistical distributions

Cw and Q-switched Nd:NaLa(MoO4)2 laser noncritical to the temperature drift of the diode pump laser wavelength

International Nuclear Information System (INIS)

Ushakov, S N; Lis, Denis A; Subbotin, Kirill A; Romanyuk, V A; Shestakov, A V; Ryabochkina, P A; Shestakova, I A; Zharikov, Evgeny V

2010-01-01

Lasing in Nd:NaLa(MoO 4 ) 2 crystals is obtained without stabilisation of the diode pump wavelength. A dependence of the cw laser power (at a wavelength of 1059 nm) on the pump diode temperature is found within a range of 10-458C. It is shown that the variations in the diode temperature within this region change the lasing efficiency no more than by 30%. In the passive Q-switching regime, the experiments were performed under both pulsed and cw pumping. Upon pulsed pumping, the laser energy was 16 μJ at the output pulse duration of 11 ns. The laser wavelength was 1059 nm, as well as in the case of cw operation. Upon cw pumping with a power of 1.5 W, laser pulses were obtained with an energy of 15 μJ. (lasers)

Soft-solution route to ZnO nanowall array with low threshold power density

Science.gov (United States)

Jang, Eue-Soon; Chen, Xiaoyuan; Won, Jung-Hee; Chung, Jae-Hun; Jang, Du-Jeon; Kim, Young-Woon; Choy, Jin-Ho

2010-07-01

ZnO nanowall array (ZNWA) has been directionally grown on the buffer layer of ZnO nanoparticles dip-coated on Si-wafer under a soft solution process. Nanowalls on substrate are in most suitable shape and orientation not only as an optical trap but also as an optical waveguide due to their unique growth habit, V[011¯0]≫V[0001]≈V[0001¯]. Consequently, the stimulated emission at 384 nm through nanowalls is generated by the threshold power density of only 25 kW/cm2. Such UV lasing properties are superior to those of previously reported ZnO nanorod arrays. Moreover, there is no green (defect) emission due to the mild procedure to synthesize ZNWA.

Electron beam induced emission from carbon plasmas

International Nuclear Information System (INIS)

Whetstone, S.; Kammash, T.

1989-01-01

Plasma use as a lasing medium has many potential advantages over conventional techniques including increased power levels and greater wavelength ranges. The basic concept is to heat and then rapidly cool a plasma forcing inversion through bottleneck creation between the recombination reaction populating a given energy level and the subsequent decay processes. Much effort has been devoted to plasmas heated by lasers and pinch devices. The authors are concerned here with electron beam heated plasmas focusing on the CIV 5g-4f transition occurring at 2530 Angstroms. These studies were initiated to provide theoretical support for experiments being performed at the University of Michigan using the Michigan Electron Long-Pulse Beam Accelerator (MELBA)

Fast pulsing dynamics of a vertical-cavity surface-emitting laser operating in the low-frequency fluctuation regime

International Nuclear Information System (INIS)

Sciamanna, M.; Rogister, F.; Megret, P.; Blondel, M.; Masoller, C.; Abraham, N. B.

2003-01-01

We analyze the dynamics of a vertical-cavity surface-emitting laser with optical feedback operating in the low-frequency fluctuation regime. By focusing on the fast pulsing dynamics, we show that the two linearly polarized modes of the laser exhibit two qualitatively different behaviors: they emit pulses in phase just after a power dropout and they emit pulses out of phase after the recovery process of the output power. As a consequence, two distinct statistical distributions of the fast pulsating total intensity are observed, either monotonically decaying from the noise level or peaked around the mean intensity value. We further show that gain self-saturation of the lasing transition strongly modifies the shape of the intensity distribution

Change the morphology of lithium oxides by Nd-Yag laser beam to use as a sand in water-cooled reactors

Science.gov (United States)

Karwi, Abbas Ali Mahmmod

2018-04-01

Laser has many attractive specifications which made it adaptable for material processing. Laser has been taken as a modern heat treatment source to prevent the formation of non-protective oxide layer with intensity equals to (1.31×105 w/cm2), lasing time equals to (300 µs), wave length equals to (1.063 µm), and the spot radius equals to (125 µm). Lithium is depleted through the conventional heat treatment processes. The main factors affected on lithium depletion are temperature and time. Lithium kept as a solid solution at casting method. Micro hardness of the affected zone reaches to acceptable values for various ageing times and hardening depths. The main conventional heat treatment processes are; homogenization, solution heat treatment, and ageing. Alloys prepared with the specific amounts of lithium concentration (2-2.5%). Oxides with different shapes are formed. Temperature distribution, heating, and cooling rates used externally and internally to see the effect of pulse generation by laser on bulk body.

Expression Pattern of Lysosomal Protective Protein/Cathepsin A: Implications for the analysis of hnman galactosialidosis

NARCIS (Netherlands)

R.J. Rottier (Robbert)

1998-01-01

textabstractThe lysosome represents a well characterized, membrane-contained intracellular digestive system. Iu this important organelle a battery of lysosomal hydro lases and accessory proteins work in concert on the step-wise conversion of macromolecular substrates into small biological building

Electrical properties of in-situ grown and transferred organic nanofibers

DEFF Research Database (Denmark)

Oliveira Hansen, Roana Melina de; Madsen, Morten; Kjelstrup-Hansen, Jakob

2010-01-01

Para-hexaphenylene (p6P) molecules have the ability to self-assemble into organic nanofibers, which exhibit a range of interesting optical and optoelectronic properties such as intense, polarized luminescence, waveguiding and lasing. The nanofibers are typically grown on specific single...

Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"

Index Scriptorium Estoniae

2005-01-01

Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga

Ultraviolet lasing behavior in ZnO optical microcavities

Directory of Open Access Journals (Sweden)

Hongxing Dong

2017-12-01

Full Text Available Zinc oxide (ZnO optical microcavity modulated UV lasers have been attracting a wide range of research interests. As one of the most important materials in developing high quality microcavity and efficient UV–visible optoelectronic devices due to its wide band gap (3.37 eV and large exciton binding energy (∼60 meV. In this review, we summarized the latest development of ZnO optical cavity based microlasers, mainly including Fabry-Perot mode lasers and whispering gallery mode lasers. The synthesis and optical studies of ZnO optical microcavities with different morphologies were discussed in detail. Finally, we also consider that the research focus in the near future would include new nanotechnology and physical effects, such as nano/micro fabrication, surface plasmon enhancement, and quantum dot coupling, which may result in new and interesting physical phenomena.

Optical bistability in Er-Yb codoped phosphate glass microspheres at room temperature

NARCIS (Netherlands)

Warda, Jonathan M.; O'Shea, Danny G.; Shortt, Brian J.; Chormaic, Sile Nic

2007-01-01

We experimentally demonstrate optical bistability in Er(3+)-Yb(3+) phosphate glass microspheres at 295 K. Bistability is associated with both Er(3+) fluorescence and lasing behavior, and chromatic switching. The chromatic switching results from an intrinsic mechanism exploiting the thermal coupling

O-band electrically injected quantum dot micro-ring lasers on on-axis (001) GaP/Si and V-groove Si.

Science.gov (United States)

Wan, Yating; Jung, Daehwan; Norman, Justin; Shang, Chen; MacFarlane, Ian; Li, Qiang; Kennedy, M J; Gossard, Arthur C; Lau, Kei May; Bowers, John E

2017-10-30

We report statistical comparisons of lasing characteristics in InAs quantum dot (QD) micro-rings directly grown on on-axis (001) GaP/Si and V-groove (001) Si substrates. CW thresholds as low as 3 mA and high temperature operation exceeding 80 °C were simultaneously achieved on the GaP/Si template template with an outer-ring radius of 50 µm and a ring width of 4 μm, while a sub-milliamp threshold of 0.6 mA was demonstrated on the V-groove Si template with a smaller cavity size of 5-μm outer-ring radius and 3-μm ring width. Evaluations were also made with devices fabricated simultaneously on native GaAs substrates over a significant sampling analysis. The overall assessment spotlights compelling insights in exploring the optimum epitaxial scheme for low-threshold lasing on industry standard Si substrates.

VUV Optics Development for the Elettra Storage Ring FEL

CERN Document Server

Guenster, Stefan

2004-01-01

Vacuum ultraviolet optical components for the storage ring FEL at Elettra are under continuous development in the European research consortium EUFELE. Target of the project is the progress to shorter lasing wavelengths in the VUV spectral range. The current status allows lasing with oxide mirror systems down to 190 nm. The main obstacles for the development of optical coatings for shorter wavelengths is the high energetic background of the synchrotron radiation impinging onto the front mirror in the laser cavity. Investigations in single layer systems and multilayer stacks of oxide or fluoride materials demonstrate that fluoride mirrors reach highest reflectivity values down to 140 nm, and oxide coatings possess a satisfactory resistance against the high energetic background irradiation. However, pure oxide multilayer stacks exhibit significant absorption below 190 nm and pure fluoride stacks suffer from strong degradation effects under synchrotron radiation. A solution could be hybrid systems, combining fluo...

Recent developments in x-ray laser research at LLE

International Nuclear Information System (INIS)

Boehly, T.; Yaakobi, B.; Craxton, R.S.; Epstein, R.; Richardson, M.C.; Russotto, M.; Soures, J.M.; Wang, J.

1989-01-01

The authors present results and analysis of recent experiments using multiple-foil target designs for a collisional excitation x-ray laser in Ne-like nickel and germanium. These targets, which are designed to yield higher gains than single-exploding-foil targets, are irradiated by 600 ps pulses of 351 nm light in a single 18-mm line from GDL. The lasing lines at --230 A are observed with a 1-m grazing incidence grating spectrometer. They discuss the relative merit of different pump-laser wavelengths and present experimental results for three wavelengths: 1.06 μm, 527 nm, and 351 nm. They present plans for the conversion of the GDL laser to a --100 J - 10 ps laser (10 TW) which will be used for producing a recombinationally pumped laser in Al which is predicted to lase at 39 A. Results of computer simulation of these proposed experiments are presented

Electrically Injected UV-Visible Nanowire Lasers

Energy Technology Data Exchange (ETDEWEB)

Wang, George T.; Li, Changyi; Li, Qiming; Liu, Sheng; Wright, Jeremy Benjamin; Brener, Igal; Luk, Ting -Shan; Chow, Weng W.; Leung, Benjamin; Figiel, Jeffrey J.; Koleske, Daniel D.; Lu, Tzu-Ming

2015-09-01

There is strong interest in minimizing the volume of lasers to enable ultracompact, low-power, coherent light sources. Nanowires represent an ideal candidate for such nanolasers as stand-alone optical cavities and gain media, and optically pumped nanowire lasing has been demonstrated in several semiconductor systems. Electrically injected nanowire lasers are needed to realize actual working devices but have been elusive due to limitations of current methods to address the requirement for nanowire device heterostructures with high material quality, controlled doping and geometry, low optical loss, and efficient carrier injection. In this project we proposed to demonstrate electrically injected single nanowire lasers emitting in the important UV to visible wavelengths. Our approach to simultaneously address these challenges is based on high quality III-nitride nanowire device heterostructures with precisely controlled geometries and strong gain and mode confinement to minimize lasing thresholds, enabled by a unique top-down nanowire fabrication technique.

LASERS: Parameters of a trigatron-driven low-pulse-repetition-rate TEA CO2 laser preionised by a surface corona discharge

Science.gov (United States)

Aram, M.; Behjat, A.; Shabanzadeh, M.; Mansori, F.

2007-01-01

The design of a TEA CO2 laser with UV preionisation by a surface corona discharge is described and the dependences of its average output energy on the gas-flow rate, discharge voltage and pulse repetition rate are presented. The scheme of the electric circuit and the geometry of the pre-ionisation system are considered. The electric circuit is designed to produce only impulse voltage difference between the laser electrodes. The triggering system of the trigatron is used to prevent the appearance of the arc. The dependences of the current, voltage and average output energy on the gas-mixture composition and applied voltages at a low pulse repetition rate are presented. The central output wavelength of the laser was measured with an IR spectrometer. Lasing at two adjacent vibrational-rotational transitions of the CO2 molecule was observed, which demonstrates the possibility of simultaneous lasing at several lines.

Parameters of a trigatron-driven low-pulse-repetition-rate TEA CO2 laser preionised by a surface corona discharge

International Nuclear Information System (INIS)

Aram, M; Shabanzadeh, M; Mansori, F; Behjat, A

2007-01-01

The design of a TEA CO 2 laser with UV preionisation by a surface corona discharge is described and the dependences of its average output energy on the gas-flow rate, discharge voltage and pulse repetition rate are presented. The scheme of the electric circuit and the geometry of the pre-ionisation system are considered. The electric circuit is designed to produce only impulse voltage difference between the laser electrodes. The triggering system of the trigatron is used to prevent the appearance of the arc. The dependences of the current, voltage and average output energy on the gas-mixture composition and applied voltages at a low pulse repetition rate are presented. The central output wavelength of the laser was measured with an IR spectrometer. Lasing at two adjacent vibrational-rotational transitions of the CO 2 molecule was observed, which demonstrates the possibility of simultaneous lasing at several lines. (lasers)

Initial conceptual design study of self-critical nuclear pumped laser systems

Science.gov (United States)

Rodgers, R. J.

1979-01-01

An analytical study of self-critical nuclear pumped laser system concepts was performed. Primary emphasis was placed on reactor concepts employing gaseous uranium hexafluoride (UF6) as the fissionable material. Relationships were developed between the key reactor design parameters including reactor power level, critical mass, neutron flux level, reactor size, operating pressure, and UF6 optical properties. The results were used to select a reference conceptual laser system configuration. In the reference configuration, the 3.2 m cubed lasing volume is surrounded by a graphite internal moderator and a region of heavy water. Results of neutronics calculations yield a critical mass of 4.9 U(235) in the form (235)UF6. The configuration appears capable of operating in a continuous steady-state mode. The average gas temperature in the core is 600 K and the UF6 partial pressure within the lasing volume is 0.34 atm.

Experimental investigation of terahertz quantum cascade laser with variable barrier heights

Energy Technology Data Exchange (ETDEWEB)

Jiang, Aiting; Vijayraghavan, Karun; Belkin, Mikhail A., E-mail: mbelkin@ece.utexas.edu [Department of Electrical and Computer Engineering, The University of Texas at Austin, Austin, Texas 78758 (United States); Matyas, Alpar; Jirauschek, Christian [Institute for Nanoelectronics, Technische Universität München, D-80333 Munich (Germany); Wasilewski, Zbig R. [Department of Electrical and Computer Engineering, University of Waterloo, Waterloo, Ontario N2L 3G (Canada)

2014-04-28

We report an experimental study of terahertz quantum cascade lasers with variable barrier heights based on the Al{sub x}Ga{sub 1–x}As/GaAs material system. Two new designs are developed based on semiclassical ensemble Monte Carlo simulations using state-of-the-art Al{sub 0.15}Ga{sub 0.85}As/GaAs three-quantum-well resonant phonon depopulation active region design as a reference. The new designs achieved maximum lasing temperatures of 188 K and 172 K, as compared to the maximum lasing temperature of 191 K for the reference structure. These results demonstrate that terahertz quantum cascade laser designs with variable barrier heights provide a viable alternative to the traditional active region designs with fixed barrier composition. Additional design space offered by using variable barriers may lead to future improvements in the terahertz quantum cascade laser performance.

Ultrafast dynamics and laser action of organic semiconductors

CERN Document Server

Vardeny, Zeev Valy

2009-01-01

Spurred on by extensive research in recent years, organic semiconductors are now used in an array of areas, such as organic light emitting diodes (OLEDs), photovoltaics, and other optoelectronics. In all of these novel applications, the photoexcitations in organic semiconductors play a vital role. Exploring the early stages of photoexcitations that follow photon absorption, Ultrafast Dynamics and Laser Action of Organic Semiconductors presents the latest research investigations on photoexcitation ultrafast dynamics and laser action in pi-conjugated polymer films, solutions, and microcavities.In the first few chapters, the book examines the interplay of charge (polarons) and neutral (excitons) photoexcitations in pi-conjugated polymers, oligomers, and molecular crystals in the time domain of 100 fs-2 ns. Summarizing the state of the art in lasing, the final chapters introduce the phenomenon of laser action in organics and cover the latest optoelectronic applications that use lasing based on a variety of caviti...

Solid state microcavity dye lasers fabricated by nanoimprint lithography

DEFF Research Database (Denmark)

Nilsson, Daniel; Nielsen, Theodor; Kristensen, Anders

2004-01-01

propagating TE–TM modes. The laser cavity has the lateral shape of a trapezoid, supporting lasing modes by reflection on the vertical cavity walls. The solid polymer dye lasers emit laterally through one of the vertical cavity walls, when pumped optically through the top surface by means of a frequency...... doubled, pulsed Nd:YAG laser. Lasing in the wavelength region from 560 to 570 nm is observed from a laser with a side-length of 50 µm. In this proof of concept, the lasers are multimode with a mode wavelength separation of approximately 1.6 nm, as determined by the waveguide propagation constant......We present a solid state polymer microcavity dye laser, fabricated by thermal nanoimprint lithography (NIL) in a dye-doped thermoplast. The thermoplast poly-methylmethacrylate (PMMA) is used due to its high transparency in the visible range and its robustness to laser radiation. The laser dye...

Stabilization of He2(A(sup 3)Sigma(sub u)(+)) molecules in liquid helium by optical pumping for vacuum UV laser

Science.gov (United States)

Zmuidzinas, J. S. (Inventor)

1978-01-01

A technique is disclosed for achieving large populations of metastable spin-aligned He2(a 3 Sigma u +) molecules in superfluid helium to obtain lasing in the vacuum ultraviolet wavelength regime around 0.0800 micron m by electronically exciting liquid (superfluid) helium with a comparatively low-current electron beam and spin aligning the metastable molecules by means of optical pumping with a modestly-powered (100mW) circularly-polarized continuous wave laser operating at, for example, 0.9096 or 0.4650 micron m. Once a high concentration of spin-aligned He2 (a 3 Sigma u +) is achieved with lifetimes of a few milliseconds, a strong microwave signal destroys the spin alignment and induces a quick collisional transition of He2 (a 3 Sigma u +) molecules to the a 1 Sigma u + state and thereby a lasing transition to the X 1 Sigma g + state.

Efficient Exciton Diffusion and Resonance-Energy Transfer in Multi-Layered Organic Epitaxial Nanofibers

DEFF Research Database (Denmark)

Tavares, Luciana; Cadelano, Michele; Quochi, Francesco

2015-01-01

Multi-layered epitaxial nanofibers are exemplary model systems for the study of exciton dynamics and lasing in organic materials due to their well-defined morphology, high luminescence efficiencies, and color tunability. We resort to temperature-dependent cw and picosecond photoluminescence (PL......) spectroscopy to quantify exciton diffusion and resonance-energy transfer (RET) processes in multi-layered nanofibers consisting of alternating layers of para-hexaphenyl (p6P) and α-sexithiophene (6T), serving as exciton donor and acceptor material, respectively. The high probability for RET processes...... is confirmed by Quantum Chemical calculations. The activation energy for exciton diffusion in p6P is determined to be as low as 19 meV, proving p6P epitaxial layers also as a very suitable donor material system. The small activation energy for exciton diffusion of the p6P donor material, the inferred high p6P...

Photoionization of excited states of neon-like Mg III

Indian Academy of Sciences (India)

plasma were used in vacuum ultra-violet lasing [4] and also soft X-ray laser simulation for ... et al [11], in terms of discrete R-matrix basis functions of adequate LS ... inside a sphere of radius a, containing the charge distribution of the residual ...

Geometrical features in longitudinal sputtering hollow cathode discharges for laser applications

NARCIS (Netherlands)

Mihailova, D.B.; Dijk, van J.; Hagelaar, G.J.M.; Karatodorov, S.; Zahariev, P.; Grozeva, M.; Mullen, van der J.J.A.M.

2012-01-01

Longitudinal sputtering hollow cathode discharge (HCD) used as active medium for lasing is studied by means of numerical modelling. Due to the longitudinal non-uniformities of the discharge, the laser operation could be strongly affected. The non-uniformity of the discharge is mainly influenced by

Lattice design of beam transport system of FELI

International Nuclear Information System (INIS)

Miyauchi, Y.; Koga, A.; Morii, Y.; Sato, S.; Keishi, T.; Tomimasu, T.

1994-01-01

A plan of lasing wide range FEL (Free Electron Laser) is in progress at FELI. For this purpose, an S-band linac accelerator system of four output energy levels is under construction. This paper describes the lattice design of its beam transport (BT) system. (author)

Computational modelling of Er(3+): Garnet laser materials

Science.gov (United States)

Spangler, Lee H.

1994-01-01

The Er(3+) ion has attracted a lot of interest for four reasons: (1) Its (4)I(sub 13/2) yields (4)I(sub 15/2) transition lases in the eyesafe region near 1.5 micron; (2) the (4)I(sub 13/2) transition lases near 2.8 micron, an important wavelength for surgical purposes; (3) it displays surprisingly efficient upconversion with lasing observed at 1.7, 1.2, 0.85, 0.56, 0.55, and 0.47 micron following 1.5 micron pumping; and (4) it has absorption bands at 0.96 and 0.81 micron and thus can be diode pumped. However, properties desirable for upconversion reduce the efficiency of 1.5 and 3 micron laser operation and vice versa. Since all of the processes are influenced by the host via the crystal field induced stark splittings in the Er levels, this project undertook modelling of the host influence on the Er lasinng behavior. While growth and measurement of all ten Er(3+) doped garnets is the surest way of identifying hosts which maximize upconversion (or conversly, 1.5 and 3 micron performance), it is also expensive - costing approximately $10,000/material or approximately $100,000 for the materials computationally investigated here. The calculations were performed using a quantum mechanical point charge model developed by Clyde Morrison at Harry Diamond Laboratories. The programs were used to fit the Er:YAG experimental energy levels so that the crystal field parameters, B(sub nm) could be extracted. From these radial factors, rho (sub n) were determined for Er(3+) in garnets. These, in combination with crystal field components, Anm, available from X-ray data, were used to predict energy levels for Er in the other nine garnet hosts. The levels in Er:YAG were fit with an rms error of 12.2/cm over a 22,000/cm range. Predicted levels for two other garnets for which literature values were available had rms errors of less than 17/cm , showing the calculations to be reliable. Based on resonances between pairs of calculated stark levels, the model predicts GSGG as the best host

Size- and Wavelength-Dependent Two-Photon Absorption Cross-Section of CsPbBr3 Perovskite Quantum Dots

NARCIS (Netherlands)

Chen, Junsheng; Zidek, Karel; Chabera, Pavel; Liu, Dongzhou; Cheng, Pengfei; Nuuttila, Lauri; Al-Marri, Mohammed J.; Lehtivuori, Heli; Messing, Maria E.; Han, Keli; Zheng, Kaibo; Pullerits, Tonu

2017-01-01

All-inorganic colloidal perovskite quantum dots (QDs) based on cesium, lead, and halide have recently emerged as promising light emitting materials. CsPbBr3 QDs have also been demonstrated as stable two-photon-pumped lasing medium. However, the reported two photon absorption (TPA) cross sections for

Cavity quantum electrodynamics with three-dimensional photonic bandgap crystals

NARCIS (Netherlands)

Vos, Willem L.; Woldering, L.A.; Ghulinyan, M.; Pavesi, L.

2015-01-01

This paper is Chapter 8 of the book "Light Localisation and Lasing: Random and Pseudorandom Photonic Structures", edited by Mher Ghulinyan and Lorenzo Pavesi (Cambridge University Press, Cambridge, 2015). It provides an overview of much recent work on 3D photonic crystals with a complete photonic

Iharus iseenda järele / Vaapo Vaher

Index Scriptorium Estoniae

Vaher, Vaapo, 1945-

2006-01-01

Tutvustus: Gide, André. Surra, et elada / tlk. Leena Tomasberg. Tallinn : Varrak, 2006 ; Soosaar, Martti. Lase vareseid! Tallinn : Tänapäev, 2006 ; Otsides : Juhan Peegel. Meenutusi pikalt teelt / koost. Maarja Lõhmus. Tallinn : Tänapäev, 2006 ; Steffenson, Jakob. Meie, ruhnlased. Tartu : A. Tuulberg, 2006

Shocked plate metal atom oxidation laser

International Nuclear Information System (INIS)

De Koker, J.G.; Rice, W.W. Jr.; Jensen, R.J.

1975-01-01

A method and apparatus for producing metal atom oxidation lasing wherein an explosively shocked grooved metal plate produces metal vapor jets directed through an appropriate gaseous oxidizer are described. Reaction of the metal vapor with the oxidizer produces molecular species having a population inversion therein. (U.S.)

Tunable organic distributed feedback dye laser device excited through Förster mechanism

Science.gov (United States)

Tsutsumi, Naoto; Hinode, Taiki

2017-03-01

Tunable organic distributed feedback (DFB) dye laser performances are re-investigated and characterized. The slab-type waveguide DFB device consists of air/active layer/glass substrate. Active layer consisted of tris(8-quinolinolato)aluminum (Alq3), 4-(dicyanomethylene)-2-methyl-6-(4-dimethylaminostyryl)-4H-pyran (DCM) dye, and polystyrene (PS) matrix. Effective energy transfer from Alq3 to DCM through Förster mechanism enhances the laser emission. Slope efficiency in the range of 4.9 and 10% is observed at pump energy region higher than 0.10-0.15 mJ cm-2 (lower threshold), which is due to the amplified spontaneous emission (ASE) and lasing. Typical slope efficiency for lasing in the range of 2.0 and 3.0% is observed at pump energy region higher than 0.25-0.30 mJ cm-2 (higher threshold). The tuning wavelength for the laser emission is ranged from 620 to 645 nm depending on the ASE region.

Transient Spectroscopy of Photoexcitations and Morphology Control of Organometal Trihalide Perovskites

Science.gov (United States)

Zhai, Yaxin; Lafalce, Evan; Sheng, Chuan-Xiang; Zhang, Chuang; Sun, Dali; Vardeny, Zeev Valy

We studied the photoexcitation dynamics in various hybrid perovskites by using broadband ps transient photomodulation (PM) spectroscopy and variable stripe length (VSL) technique. We observed both excitonic and free carriers spectral features in MAPbI3 but mainly excitonic transition in MAPbI1.1Br1.9 and MAPbI3-xClx films. We also fabricated MAPbBr3 films with nano-crystal pinning (NCP) treatment, which allows for smaller crystalline grain size. The transient spectra show a narrower and longer-lived photobleaching band in NCP treated films consistent with the increase in the photoluminescence efficiency. In addition the net optical gain measured by VSL is markedly increased up to 300 cm-1, and the lasing threshold is concurrently reduced. Measurement of the waveguide losses in the NCP films shows that the improvement in lasing properties can partly be attributed to the reduced optical scattering. Work supported by the AFOSR through a MURI Grant RA 9550-14-1-0037.

Design of three-well indirect pumping terahertz quantum cascade lasers for high optical gain based on nonequilibrium Green's function analysis

Science.gov (United States)

Liu, Tao; Kubis, Tillmann; Jie Wang, Qi; Klimeck, Gerhard

2012-03-01

The nonequilibrium Green's function approach is applied to the design of three-well indirect pumping terahertz (THz) quantum cascade lasers (QCLs) based on a resonant phonon depopulation scheme. The effects of the anticrossing of the injector states and the dipole matrix element of the laser levels on the optical gain of THz QCLs are studied. The results show that a design that results in a more pronounced anticrossing of the injector states will achieve a higher optical gain in the indirect pumping scheme compared to the traditional resonant-tunneling injection scheme. This offers in general a more efficient coherent resonant-tunneling transport of electrons in the indirect pumping scheme. It is also shown that, for operating temperatures below 200 K and low lasing frequencies, larger dipole matrix elements, i.e., vertical optical transitions, offer a higher optical gain. In contrast, in the case of high lasing frequencies, smaller dipole matrix elements, i.e., diagonal optical transitions are better for achieving a higher optical gain.

Tunable microwave signal generation based on an Opto-DMD processor and a photonic crystal fiber

International Nuclear Information System (INIS)

Wang Tao; Sang Xin-Zhu; Yan Bin-Bin; Li Yan; Song Fei-Jun; Zhang Xia; Wang Kui-Ru; Yuan Jin-Hui; Yu Chong-Xiu; Ai Qi; Chen Xiao; Zhang Ying; Chen Gen-Xiang; Xiao Feng; Kamal Alameh

2014-01-01

Frequency-tunable microwave signal generation is proposed and experimentally demonstrated with a dual-wavelength single-longitudinal-mode (SLM) erbium-doped fiber ring laser based on a digital Opto-DMD processor and four-wave mixing (FWM) in a high-nonlinear photonic crystal fiber (PCF). The high-nonlinear PCF is employed for the generation of the FWM to obtain stable and uniform dual-wavelength oscillation. Two different short passive sub-ring cavities in the main ring cavity serve as mode filters to make SLM lasing. The two lasing wavelengths are electronically selected by loading different gratings on the Opto-DMD processor controlled with a computer. The wavelength spacing can be smartly adjusted from 0.165 nm to 1.08 nm within a tuning accuracy of 0.055 nm. Two microwave signals at 17.23 GHz and 27.47 GHz are achieved. The stability of the microwave signal is discussed. The system has the ability to generate a 137.36-GHz photonic millimeter signal at room temperature

Perspectives: Nanofibers and nanowires for disordered photonics

Directory of Open Access Journals (Sweden)

Dario Pisignano

2017-03-01

Full Text Available As building blocks of microscopically non-homogeneous materials, semiconductor nanowires and polymer nanofibers are emerging component materials for disordered photonics, with unique properties of light emission and scattering. Effects found in assemblies of nanowires and nanofibers include broadband reflection, significant localization of light, strong and collective multiple scattering, enhanced absorption of incident photons, synergistic effects with plasmonic particles, and random lasing. We highlight recent related discoveries, with a focus on material aspects. The control of spatial correlations in complex assemblies during deposition, the coupling of modes with efficient transmission channels provided by nanofiber waveguides, and the embedment of random architectures into individually coded nanowires will allow the potential of these photonic materials to be fully exploited, unconventional physics to be highlighted, and next-generation optical devices to be achieved. The prospects opened by this technology include enhanced random lasing and mode-locking, multi-directionally guided coupling to sensors and receivers, and low-cost encrypting miniatures for encoders and labels.

Los Alamos KrF laser program

International Nuclear Information System (INIS)

Jensen, R.J.; Cartwright, D.C.

1985-01-01

Los Alamos is currently developing the krypton fluoride (KrF) laser - a highly efficient laser able to emit very intense bursts of short-wavelength photons - as a research tool for the general study of high-density matter, as well as for use in laser fusion. The KrF laser operates at 1/4 μm, close to the short-wavelength limit for conventional optical material, but still in the region where standard optical techniques can be used. The excited-state lifetime of the KrF lasing medium is short - as a result of both spontaneous emission and deactivation from collisions - making it impossible to store energy within the lasing medium for times significant to electrical pumping. However, an optical multiplexing scheme is being developed that will generate short, intense pulses of 1/4-μm light by overcoming the short storage time of the laser and taking advantage of the high gain of the KrF medium

Surface-Emitting Distributed Feedback Terahertz Quantum-Cascade Lasers in Metal-Metal Waveguides

Science.gov (United States)

Kumar, Sushil; Williams, Benjamin S.; Qin, Qi; Lee, Alan W. M.; Hu, Qing; Reno, John L.

2007-01-01

Single-mode surface-emitting distributed feedback terahertz quantumcascade lasers operating around 2.9 THz are developed in metal-metal waveguides. A combination of techniques including precise control of phase of reflection at the facets, and u e of metal on the sidewalls to eliminate higher-order lateral modes allow robust single-mode operation over a range of approximately 0.35 THz. Single-lobed far-field radiation pattern is obtained using a pi phase-shift in center of the second-order Bragg grating. A grating device operating at 2.93 THz lased up to 149 K in pulsed mode and a temperature tuning of 19 .7 GHz was observed from 5 K to 147 K. The same device lased up to 78 K in continuous-wave (cw) mode emitting more than 6 m W of cw power at 5 K. ln general, maximum temperature of pulsed operation for grating devices was within a few Kelvin of that of multi-mode Fabry-Perot ridge lasers

JAERI FEL applications in nuclear energy industries

International Nuclear Information System (INIS)

Minehara, Eisuke J.

2005-01-01

The JAERI FEL has first discovered the new FEL lasing of 255fs ultra fast pulse, 6-9% high efficiency, 1GW high peak power, a few kilowatts average power, and wide tunability of medium and far infrared wavelength regions at the same time. Using the new lasing and energy-recovery linac technology, we could extend a more powerful and more efficient free-electron laser (FEL) than 10kW and 25%, respectively, for nuclear energy industries, and others. In order to realize such a tunable, highly-efficient, high average power, high peak power and ultra-short pulse FEL, we need the efficient and powerful FEL driven by the JAERI compact, stand alone and zero boil-off super-conducting RF linac with an energy-recovery geometry. Our discussions on the FEL will cover the application of non-thermal peeling, cutting, and drilling to prevent cold-worked stress-corrosion cracking failures in nuclear energy and other heavy industries. (author)

Microscale vortex laser with controlled topological charge

Science.gov (United States)

Wang, Xing-Yuan; Chen, Hua-Zhou; Li, Ying; Li, Bo; Ma, Ren-Min

2016-12-01

A microscale vortex laser is a new type of coherent light source with small footprint that can directly generate vector vortex beams. However, a microscale laser with controlled topological charge, which is crucial for virtually any of its application, is still unrevealed. Here we present a microscale vortex laser with controlled topological charge. The vortex laser eigenmode was synthesized in a metamaterial engineered non-Hermitian micro-ring cavity system at exceptional point. We also show that the vortex laser cavity can operate at exceptional point stably to lase under optical pumping. The microscale vortex laser with controlled topological charge can serve as a unique and general building block for next-generation photonic integrated circuits and coherent vortex beam sources. The method we used here can be employed to generate lasing eigenmode with other complex functionalities. Project supported by the “Youth 1000 Talent Plan” Fund, Ministry of Education of China (Grant No. 201421) and the National Natural Science Foundation of China (Grant Nos. 11574012 and 61521004).

Continuously tunable S and C+L bands ultra wideband erbium-doped fiber ring laser

International Nuclear Information System (INIS)

Wang, Q; Yu, Q X

2009-01-01

This paper presents an ultra wideband tunable silica-based erbium doped fiber ring laser (EDFRL) that can be continuously tuned in S and C+L bands from 1475 to 1619 nm. It is the first time that a fiber ring laser's tuning range reaches 144 nm using a standard silica-based C-band erbium-doped fiber as gain media. In the laser configuration two isolators are used in the fiber loop for suppressing the ASE in C-band and elevating the lasing gain in S-band. As a result the available lasing wavelength is extended toward the shorter wavelength of the gain bandwidth. The optimized erbium-doped fiber length, output coupling ratio and pumping laser power have been obtained through experimental study. This ring fiber laser has simple configuration, low threshold, flat laser spectral distribution and high signal-to-ASE-noise ratio. The laser will have many potential applications in fiber sensor wavelength interrogation, high-resolution spectroscopy and fiber optic communications

Investigation of 1.3 μm AlGaInAs multi-quantum wells for electro-absorption modulated laser

Energy Technology Data Exchange (ETDEWEB)

Binet, Guillaume [III-V Lab., Route de Nozay, 91461, Marcoussis (France); Institut Jean le Rond d' Alembert, Sorbonne Universites, UPMC Univ. Paris 06, CNRS, UMR 7190, 75005, Paris (France); Decobert, Jean; Lagay, Nadine; Chimot, Nicolas; Kazmierski, Christophe [III-V Lab., Route de Nozay, 91461, Marcoussis (France)

2016-10-15

Monolithic photonic integrated circuits (PIC) transmitters using the prefixed optical phase switching concept for BPSK modulation format have been shown promising at 1.55 μm band. These devices could also be crucial for short reach connections and access networks. With this aim, we are studying basic quantum well designs for a laser and an electro-absorption modulator switch to be integrated by selective area growth into PICs at 1.3 μm. Photocurrent measurements and band offset modeling have been performed to determine the MQW stack well-fitted for this application. Broad area laser measurements have also been checked on these structures to verify the material lasing properties. A 6 nm thick well with low barrier seems to be the best trade-off between absorption and shift for 1.3 μm EAM and it also gives good lasing properties. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Fusion reactor pumped laser

International Nuclear Information System (INIS)

Jassby, D.L.

1988-01-01

A nuclear pumped laser is described comprising: a toroidal fusion reactor, the reactor generating energetic neutrons; an annular gas cell disposed around the outer periphery of the reactor, the cell including an annular reflecting mirror disposed at the bottom of the cell and an annular output window disposed at the top of the cell; a gas lasing medium disposed within the annular cell for generating output laser radiation; neutron reflector material means disposed around the annular cell for reflecting neutrons incident thereon back into the gas cell; neutron moderator material means disposed between the reactor and the gas cell and between the gas cell and the neutron reflector material for moderating the energy of energetic neutrons from the reactor; converting means for converting energy from the moderated neutrons to energy pumping means for pumping the gas lasing medium; and beam compactor means for receiving output laser radiation from the annular output window and generating a single output laser beam therefrom

Two-dimensional photonic crystal bandedge laser with hybrid perovskite thin film for optical gain

Energy Technology Data Exchange (ETDEWEB)

Cha, Hyungrae [Department of Biophysics and Chemical Biology, Seoul National University, Seoul 08826 (Korea, Republic of); Inter-University Semiconductor Research Center, Seoul National University, Seoul 08826 (Korea, Republic of); Bae, Seunghwan [Department of Materials Science and Engineering, Seoul National University, Seoul 08826 (Korea, Republic of); Lee, Myungjae [Inter-University Semiconductor Research Center, Seoul National University, Seoul 08826 (Korea, Republic of); Department of Physics and Astronomy, Seoul National University, Seoul 08826 (Korea, Republic of); Jeon, Heonsu, E-mail: hsjeon@snu.ac.kr [Department of Biophysics and Chemical Biology, Seoul National University, Seoul 08826 (Korea, Republic of); Inter-University Semiconductor Research Center, Seoul National University, Seoul 08826 (Korea, Republic of); Department of Physics and Astronomy, Seoul National University, Seoul 08826 (Korea, Republic of)

2016-05-02

We report optically pumped room temperature single mode laser that contains a thin film of hybrid perovskite, an emerging photonic material, as gain medium. Two-dimensional square lattice photonic crystal (PhC) backbone structure enables single mode laser operation via a photonic bandedge mode, while a thin film of methyl-ammonium lead iodide (CH{sub 3}NH{sub 3}PbI{sub 3}) spin-coated atop provides optical gain for lasing. Two kinds of bandedge modes, Γ and M, are employed, and both devices laser in single mode at similar laser thresholds of ∼200 μJ/cm{sup 2} in pulse energy density. Polarization dependence measurements reveal a clear difference between the two kinds of bandedge lasers: isotropic for the Γ-point laser and highly anisotropic for the M-point laser. These observations are consistent with expected modal properties, confirming that the lasing actions indeed originate from the corresponding PhC bandedge modes.

Investigation of a cooled electroionization CO laser. I - Lasing using pure carbon monoxide. II - Lasing using mixtures of CO with buffer gases

Energy Technology Data Exchange (ETDEWEB)

Basov, N G; Danilychev, V A; Ionin, A A; Kazakevich, V S; Kovsh, I B; Poletaev, N L

1979-06-01

An experimental study has been performed to determine the threshold, energy, temporal and spectral characteristics of a cooled electroionization pulsed laser using pure CO. It is shown that the efficiency of the laser using pure CO does not exceed 10%. A reduction of CO concentration in a mixture with a nitrogen buffer to 2.5% at the fixed excitation pulse duration of 100 microsec results in an increase of radiation pulse duration from 100 microsec (pure CO) to 3 ms. The present results are compared to the theoretical and experimental results of other studies.

Liberalism, vabaturumajandus ja rahvuslus / Eva Piirimäe

Index Scriptorium Estoniae

Piirimäe, Eva, 1974-

2006-01-01

Rahvuslus on liberaaldemokraatia ning vabaturumajanduse tingimustes osutunud vastupidavamaks kui arvati. On tõenäoline, et ka eesti rahvuslus ei lase end nii kergesti maha suruda ning on elujõuline tänu oma muutumisvõimele. Euroopa kosmopolitism, rahvusluse elujõud, Eesti Euroopas, rahvusluse ideoloogia poliitilistes tõmbetuultes

Electrospun Polymer Fiber Lasers for Applications in Vapor Sensing

DEFF Research Database (Denmark)

Krämmer, Sarah; Laye, Fabrice; Friedrich, Felix

2017-01-01

of the narrow lasing modes upon uptake of alcohol vapors (model vapors are methanol and ethanol) serves as sensor signal. Thus, the high sensitivity related to the spectral line shifts of cavity-based transducers can be combined with the fiber's large surface to volume ratio. The resulting optical sensors...

Direct laser writing for nanoporous liquid core laser sensors

DEFF Research Database (Denmark)

Grossmann, Tobias; Christiansen, Mads Brøkner; Peterson, Jeffrey

2012-01-01

We report the fabrication of nanoporous liquid core lasers via direct laser writing based on two-photon absorption in combination with thiolene-chemistry. As gain medium Rhodamine 6G was embedded in the nanoporous polybutadiene matrix. The lasing devices with thresholds of 19 µJ/mm2 were measured...

Beam monitor system for an x-ray free electron laser and compact laser

Directory of Open Access Journals (Sweden)

Y. Otake

2013-04-01

Full Text Available A beam-monitor system for XFEL/SPring 8, “SACLA,” has been constructed. In order to maintain a stable self-amplified spontaneous emission (SASE interaction, the straightness and overlap of the axes to within 3  μm between the electron beams and the radiated x rays for an undulator section of about 100 m length is necessary. This straightness means relative alignment to an experimental target sample. Furthermore, a temporal stability of 30 fs in order to maintain a constant peak beam current is also necessary to conduct stable SASE lasing. The monitor system was developed to satisfy these spatial and temporal stability and resolution criteria. The system comprises spatial monitors, such as cavity-type beam-position monitors and screen monitors, as well as temporal measurement instruments, such as current monitors, waveguide spectrometers, coherent synchrotron-radiation detectors, a streak camera, and an rf deflector. Commissioning of SACLA started from March 2011, and the monitors performed sufficient roles to tune the beams for lasing. The achieved overall performances of the system, including data acquisition, are: the beam position monitor has a spatial resolution of 600 nm in rms; the bunch-length monitors show ability to observe bunch lengths from 1 ns in an injector with velocity bunching to less than 30 fs after three-stage bunch compressors. The less than 3  μm spatial resolution of the screen monitor was also confirmed during practical beam operation. Owing to these fulfilled performances, such as the high spatial and temporal resolutions, stable lasing of SACLA has been achieved.

Perspectives of transurethral robotic laser resection of the prostate: vaporization and coagulation effects with the Nd:YAG laser

Science.gov (United States)

Ho, Gideon; Teo, Ming Y.; Kwoh, Chee K.; Ng, Wan S.; Cheng, Wai S.

2000-05-01

A longer operating time and steeper learning curve in mastering the techniques for transurethral laser resection of the prostate are the main problems faced by surgeons compared to standard transurethral resection of the prostate (TURP). However, these disadvantages can be solved with the introduction of a treatment modality designed and developed based on an integrated system of computer, robotics and laser technology. In vitro experiments were carried out to determine variables affecting the vaporization and coagulation lesions, in order to identify the parameters that could optimize this modality. Human cadaveric prostate and fresh chicken breast tissues were irradiated with different parameters using continuous wave Nd:YAG laser fiber in contact with the tissue. The effects of irrigant flowrate, fiber/tissue angle of inclination, number of passes, direction, speed and power of lase on the volume of tissue vaporized and coagulated, were assessed. A non-contact optical coordinate measuring machine was used to measure the depth and width of the vaporized and coagulated lesion. Results reveal that for each directional vaporization path (forward, clockwise and counter-clockwise), power and speed of lase are the most significant parameters influencing the volume of the vaporized and coagulated lesion. Optimized values of the power and speed of lase at 100 W and 1 - 3 mm/s respectively were obtained from the experiments when the tissues were irradiated in the forward, clockwise and counter-clockwise directions. It was concluded from our study to quantify tissue removal and damage, optimized values of irradiation power and speed could be obtained and implemented in the procedure of transurethral robotic laser resection of the prostate.

Theoretical evaluation of a continues-wave Ho3+:BaY2F8 laser with mid-infrared emission

Science.gov (United States)

Rong, Kepeng; Cai, He; An, Guofei; Han, Juhong; Yu, Hang; Wang, Shunyan; Yu, Qiang; Wu, Peng; Zhang, Wei; Wang, Hongyuan; Wang, You

2018-01-01

In this paper, we build a theoretical model to study a continues-wave (CW) Ho3+:BaY2F8 laser by considering both energy transfer up-conversion (ETU) and cross relaxation (CR) processes. The influences of the pump power, reflectance of an output coupler (OC), and crystal length on the output features are systematically analyzed for an end-pumped configuration, respectively. We also investigate how the processes of ETU and CR in the energy-level system affect the output of a Ho3+:BaY2F8 laser by use of the kinetic evaluation. The simulation results show that the optical-to-optical efficiency can be promoted by adjusting the parameters such as the reflectance of an output coupler, crystal length, and pump power. It has been theoretically demonstrated that the threshold of a Ho3+:BaY2F8 laser is very high for the lasing operation in a CW mode.

Keldysh meets Lindblad: Correlated Gain and Loss in Higher Order Perturbation Theory

Science.gov (United States)

Stace, Tom; Mueller, Clemens

Motivated by correlated decay processes driving gain, loss and lasing in driven artificial quantum systems, we develop a theoretical technique using Keldysh diagrammatic perturbation theory to derive a Lindblad master equation that goes beyond the usual second order perturbation theory. We demonstrate the method on the driven dissipative Rabi model, including terms up to fourth order in the interaction between the qubit and both the resonator and environment. This results in a large class of Lindblad dissipators and associated rates which go beyond the terms that have previously been proposed to describe similar systems. All of the additional terms contribute to the system behaviour at the same order of perturbation theory. We then apply these results to analyse the phonon-assisted steady-state gain of a microwave field driving a double quantum-dot in a resonator. We show that resonator gain and loss are substantially affected by dephasing- assisted dissipative processes in the quantum-dot system. These additional processes, which go beyond recently proposed polaronic theories, are in good quantitative agreement with experimental observations.

Laser printing of 3D metallic interconnects

Science.gov (United States)

Beniam, Iyoel; Mathews, Scott A.; Charipar, Nicholas A.; Auyeung, Raymond C. Y.; Piqué, Alberto

2016-04-01

The use of laser-induced forward transfer (LIFT) techniques for the printing of functional materials has been demonstrated for numerous applications. The printing gives rise to patterns, which can be used to fabricate planar interconnects. More recently, various groups have demonstrated electrical interconnects from laser-printed 3D structures. The laser printing of these interconnects takes place through aggregation of voxels of either molten metal or of pastes containing dispersed metallic particles. However, the generated 3D structures do not posses the same metallic conductivity as a bulk metal interconnect of the same cross-section and length as those formed by wire bonding or tab welding. An alternative is to laser transfer entire 3D structures using a technique known as lase-and-place. Lase-and-place is a LIFT process whereby whole components and parts can be transferred from a donor substrate onto a desired location with one single laser pulse. This paper will describe the use of LIFT to laser print freestanding, solid metal foils or beams precisely over the contact pads of discrete devices to interconnect them into fully functional circuits. Furthermore, this paper will also show how the same laser can be used to bend or fold the bulk metal foils prior to transfer, thus forming compliant 3D structures able to provide strain relief for the circuits under flexing or during motion from thermal mismatch. These interconnect "ridges" can span wide gaps (on the order of a millimeter) and accommodate height differences of tens of microns between adjacent devices. Examples of these laser printed 3D metallic bridges and their role in the development of next generation electronics by additive manufacturing will be presented.

Si-Based Germanium Tin Semiconductor Lasers for Optoelectronic Applications

Science.gov (United States)

Al-Kabi, Sattar H. Sweilim

Silicon-based materials and optoelectronic devices are of great interest as they could be monolithically integrated in the current Si complementary metal-oxide-semiconductor (CMOS) processes. The integration of optoelectronic components on the CMOS platform has long been limited due to the unavailability of Si-based laser sources. A Si-based monolithic laser is highly desirable for full integration of Si photonics chip. In this work, Si-based germanium-tin (GeSn) lasers have been demonstrated as direct bandgap group-IV laser sources. This opens a completely new avenue from the traditional III-V integration approach. In this work, the material and optical properties of GeSn alloys were comprehensively studied. The GeSn films were grown on Ge-buffered Si substrates in a reduced pressure chemical vapor deposition system with low-cost SnCl4 and GeH4 precursors. A systematic study was done for thin GeSn films (thickness 400 nm) with Sn composition 5 to 17.5%. The room temperature photoluminescence (PL) spectra were measured that showed a gradual shift of emission peaks towards longer wavelength as Sn composition increases. Strong PL intensity and low defect density indicated high material quality. Moreover, the PL study of n-doped samples showed bandgap narrowing compared to the unintentionally p-doped (boron) thin films with similar Sn compositions. Finally, optically pumped GeSn lasers on Si with broad wavelength coverage from 2 to 3 mum were demonstrated using high-quality GeSn films with Sn compositions up to 17.5%. The achieved maximum Sn composition of 17.5% broke the acknowledged Sn incorporation limit using similar deposition chemistry. The highest lasing temperature was measured at 180 K with an active layer thickness as thin as 270 nm. The unprecedented lasing performance is due to the achievement of high material quality and a robust fabrication process. The results reported in this work show a major advancement towards Si-based electrically pumped mid

Stimulated emission within the exciplex band by plasmonic-nanostructured polymeric heterojunctions

Science.gov (United States)

Zhang, Xinping; Li, Hongwei; Wang, Yimeng; Liu, Feifei

2015-03-01

Organic heterojunctions have been extensively employed in the design of light-emitting diodes, photovoltaic devices, and thin-film field-effect transistors, which can be achieved by constructing a bilayer or a multi-layered thin-film deposition, or by blending two or more organic semiconductors with different charge-transport performances. Charge transfer excited states or exciplex may form on the heterointerfaces. Efficient light-emitting diodes have been demonstrated using exciplex emission. However, lasing or stimulated emission processes have not been observed with exciplex formation at organic heterojunctions. In this work, we demonstrate strong coherent interaction between photons and exciplex formation in the blends of poly-9,9'-dioctylfluorene-co-bis-N,N'-(4-butylphenyl)-bis-N,N'-phenyl-l,4-phenylenediamine (PFB) and poly-9,9'-dioctylfluorene-co-benzothiadiazole (F8BT), leading to transient stimulated exciplex emission. The responsible mechanisms involve plasmonic local-field enhancement and plasmonic feedback in a three-dimensional gold-nanoparticle matrix.Organic heterojunctions have been extensively employed in the design of light-emitting diodes, photovoltaic devices, and thin-film field-effect transistors, which can be achieved by constructing a bilayer or a multi-layered thin-film deposition, or by blending two or more organic semiconductors with different charge-transport performances. Charge transfer excited states or exciplex may form on the heterointerfaces. Efficient light-emitting diodes have been demonstrated using exciplex emission. However, lasing or stimulated emission processes have not been observed with exciplex formation at organic heterojunctions. In this work, we demonstrate strong coherent interaction between photons and exciplex formation in the blends of poly-9,9'-dioctylfluorene-co-bis-N,N'-(4-butylphenyl)-bis-N,N'-phenyl-l,4-phenylenediamine (PFB) and poly-9,9'-dioctylfluorene-co-benzothiadiazole (F8BT), leading to transient

Hard X-ray bursts and DD microfusion neutrons from complex ...

Indian Academy of Sciences (India)

explosive destruction of micrograins is accompanied by X-ray radiation (during hydrody- ... makes it possible to produce lasing in hard X-rays due to the effects of multiple scattering ... portant, information on the X-ray random media, including some indirect diagnostics. In ... stages of ionization in the total flux of particles.

Phase locking and spectral linewidth of a two-mode terahertz quantum cascade laser

NARCIS (Netherlands)

Baryshev, A.; Hovenier, J.N.; Adam, A.J.L.; Kašalynas, I.; Gao, J.R.; Klaassen, T.O.; Williams, B.S.; Kumar, S.; Hu, Q.; Reno, J.L.

2006-01-01

We have studied the phase locking and spectral linewidth of an ? 2.7?THz quantum cascade laser by mixing its two lateral lasing modes. The beat signal at about 8?GHz is compared with a microwave reference by applying conventional phase lock loop circuitry with feedback to the laser bias current.

Topical Meeting on Laser and Optical Remote Sensing: Instrumentation and Techniques Technical Digest Held in North Falmoth, Massachusetts on September 28-October 1, 1987. Volume 18.

Science.gov (United States)

1988-08-01

5 National d’Astronomie et de Geophysique , France; Gerard Megie, CNRS Service d’Aeronomie, France. The LASE 11 8:30 AM-10:.1 AM (laser atmospheric...Institut National d’Astronomie et de Geophysique , 77, avenue Denfert-Rochereau, 75014, Paris, France d Centre National de al Recherche Scientifique

1.5 μm InAs/InGaAsP/InP quantum dot laser with improved temperature stability

DEFF Research Database (Denmark)

Zubov, F. I.; Gladii, S. P.; Shernyakov, Yu M.

2016-01-01

Temperature characteristics of InAs/InGaAsP quantum dot (QD) lasers synthesized on InP (001) substrate are presented. The lasers demonstrate high temperature stability: a threshold current characteristic temperature as high as 205 K in the temperature range between 20 to 50°C was measured. Lasing...

Submonolayer InGaAs/GaAs quantum-dot lasers with high modal gain and zero-linewidth enhancement factor

DEFF Research Database (Denmark)

Xu, Zhangcheng; Birkedal, Dan; Juhl, Michael

2004-01-01

.1 nm. When the injection current is about 0.98 times the threshold, the gain spectrum becomes symmetric with respect to the lasing wavelength, and zero-linewidth enhancement factor is observed. These properties are attributed to the high density and the high uniformity of SML QDs in our laser diode....

Kunstikonteiner on avatud kõigile headele ideedele / Tanel Saar, Sandra Jõgeva ; interv. R[eet] V[arblane

Index Scriptorium Estoniae

Saar, Tanel

2007-01-01

Polymeri kultuuritehases Tallinnas (Ülase 16 / Madara 22) tegutsevast Academia Non Grata filiaalist ja alternatiivgaleriist Nongrata Kunstikonteiner. Näitustest, tulevikuplaanidest. Avanäituseks oli "Uus laine. 21. sajandi kunst", juuni lõpuni on avatud rahvusvahelise performance'ifestivali "Diverse Universe III" avanäitus "Aderlassenplatz" ja "Uus laine. II valik: tegevuskunst"

Investigation of X-ray lasing in a capillary discharge

NARCIS (Netherlands)

Ellwi, S. S.; Juschkin, L.; Ferri, S.; Kunze, H. J.; E. Louis,

2001-01-01

Using a new technique of an induced MHD instability in a capillary made of polyacetal we observed an intense spike (signal) of the Balmer-a line of C VI at 18.22 nm during the second half cycle of the discharge. The spike is identified as Amplified Spontaneous Emission (ASE), and enhancements are

Asymmetric excitation of surface plasmons by dark mode coupling

KAUST Repository

Zhang, X.

2016-02-19

Control over surface plasmons (SPs) is essential in a variety of cutting-edge applications, such as highly integrated photonic signal processing systems, deep-subwavelength lasing, high-resolution imaging, and ultrasensitive biomedical detection. Recently, asymmetric excitation of SPs has attracted enormous interest. In free space, the analog of electromagnetically induced transparency (EIT) in metamaterials has been widely investigated to uniquely manipulate the electromagnetic waves. In the near field, we show that the dark mode coupling mechanism of the classical EIT effect enables an exotic and straightforward excitation of SPs in a metasurface system. This leads to not only resonant excitation of asymmetric SPs but also controllable exotic SP focusing by the use of the Huygens-Fresnel principle. Our experimental findings manifest the potential of developing plasmonic metadevices with unique functionalities.

Asymmetric excitation of surface plasmons by dark mode coupling

KAUST Repository

Zhang, X.; Xu, Q.; Li, Q.; Xu, Y.; Gu, J.; Tian, Z.; Ouyang, C.; Liu, Y.; Zhang, S.; Zhang, Xixiang; Han, J.; Zhang, W.

2016-01-01

Control over surface plasmons (SPs) is essential in a variety of cutting-edge applications, such as highly integrated photonic signal processing systems, deep-subwavelength lasing, high-resolution imaging, and ultrasensitive biomedical detection. Recently, asymmetric excitation of SPs has attracted enormous interest. In free space, the analog of electromagnetically induced transparency (EIT) in metamaterials has been widely investigated to uniquely manipulate the electromagnetic waves. In the near field, we show that the dark mode coupling mechanism of the classical EIT effect enables an exotic and straightforward excitation of SPs in a metasurface system. This leads to not only resonant excitation of asymmetric SPs but also controllable exotic SP focusing by the use of the Huygens-Fresnel principle. Our experimental findings manifest the potential of developing plasmonic metadevices with unique functionalities.

FEL radiation power available in electron storage rings

International Nuclear Information System (INIS)

Miyahara, Yoshikazu

1994-01-01

FEL radiation power available in electron storage rings was studied in the small signal regime in considering the increase of the energy spread of the electron beam caused by the FEL interaction and the decrease of the FEL gain with the increase of the energy spread in addition to the radiation damping and the quantum excitation. All these effects were considered separately, and combined with FEL power equations. The radiation power available was expressed explicitly with the parameters of the storage ring, the wiggler and the mirrors. The transient process of FEL lasing is simulated with the power equations. A rough estimation is made of the radiation power available by the FEL at different beam energies, and optimization of FEL parameters for a higher radiation power is discussed. ((orig.))

Phase locking and spectral linewidth of a two-mode terahertz quantum cascade laser

NARCIS (Netherlands)

Baryshev, A.; Hovenier, J. N.; Adam, A. J. L.; Kašalynas, I.; Gao, J. R.; Klaassen, T. O.; Williams, B. S.; Kumar, S.; Hu, Q.; Reno, J. L.

2006-01-01

We have studied the phase locking and spectral linewidth of an ˜2.7THz quantum cascade laser by mixing its two lateral lasing modes. The beat signal at about 8GHz is compared with a microwave reference by applying conventional phase lock loop circuitry with feedback to the laser bias current. Phase

First demonstration of InGaP/InAlGaP based orange laser emitting at 608 nm

KAUST Repository

Majid, Mohammed Abdul; Al-Jabr, Ahmad; Oubei, Hassan M.; Alias, Mohd Sharizal; Anjum, Dalaver H.; Ng, Tien Khee; Ooi, Boon S.

2015-01-01

The fabrication of orange-emitting semiconductor laser on interdiffused InGaP/InAlGaP structure is reported. The lasers lased at 22°C at a wavelength as short as 608 nm with threshold current density of 3.4 KAcm −2 and a maximum output power of ∼46

El Paradigma de las Membranas en Agujeros Negros

Directory of Open Access Journals (Sweden)

José Daniel Muñoz

1996-07-01

Full Text Available The membrane paradigm is a method in order to work matter fields near black holes, which allows to construct spatial images changing in time, without lasing the exactness of the general relativity. This paper describes membrane paradigm, and applies it to the electromagnetic field around a Schwarzchild's black holeo.

Mid-infrared studies of GaAs/AlGaAs quantum cascade structures

International Nuclear Information System (INIS)

Keightley, Peter Thomas

2001-01-01

This thesis describes an investigation of GaAs/AIGaAs Quantum Cascade (QC) structures. Mid-infrared spectroscopic techniques are employed to study several QC LED and laser structures, in order to investigate the fundamental principles underlying the operation of these state of the art devices. The results presented in this thesis include the demonstration of intersubband lasing in a GaAs/AIGaAs QC laser, which closely followed the first report of QC lasing using this materials system in 1998, and form a basis from which further research into QC lasers can be built upon. Initially, a spectroscopic investigation of several QC LEDs is presented, beginning with a comparison of the performance of two designs incorporating an active region based on a diagonal transition. These devices have single quantum well (SQW), or multi-quantum well (MQW) bridging regions and are investigated using intersubband electroluminescence (EL) spectroscopy. It is found that although growth and design are simplified by the use of a SQW bridging region, superior performance is obtained by the use of MQW bridging regions, intersubband EL and photocurrent (PC) spectroscopy are employed to study the operating characteristics of a QC LED incorporating a graded superlattice active region. EL is observed at 9 and 11μm arising from interminiband radiative transitions. Complementary intersubband and interband spectroscopic techniques have been employed to study the evolution of the electron distribution within a QC LED, with increasing bias. Below the device turn on, the transfer of electrons from the donors to the active region ground state is observed. As the bias is increased the redistribution of electrons through the bridging region is observed, in conjunction with an alignment of energy levels within the structure, close to the operating bias. Intersubband lasing has been demonstrated from a GaAs/AIGaAs QC laser at λ∼9μm. Reciprocal gain measurements have been performed to determine the

Parametric x-ray FEL operating with external Bragg reflectors

International Nuclear Information System (INIS)

Baryshevsky, V.G.; Batrakov, K.G.; Dubovskaya, I.Ya.

1995-01-01

In the crystal X-ray FELs using channeling and parametric quasi-Cherenkov mechanisms of spontaneous radiation were considered as versions of FEL allowing, in principle, to obtain coherent X-ray source. In this case a crystal is both radiator and resonator for X-rays emitted by a particle beam passing through crystal. However, it is well-known that a beam current density required for lasing is extremely high in X-ray spectral range for any radiation mechanisms and it is very important to find a way to lower its magnitude. The application of three-dimensional distributed feedback formed by dynamical diffraction of emitted photons permitted to reduce starting beam current density 10 2 -10 4 times up to 10 9 . One of ways to lower the starting current is the formation of multi-wave distributed feedback the another one is the application of external reflectors. The thing is that lasing regime was shown to be produced at frequencies in the vicinity of degeneration point for roots of dispersion equation describing radiation modes excited in an active medium (crystal plus particle beam). Unfortunately, in case of parametric quasi-Cherenkov FEL this region coincides with the region of strong self-absorption of radiation inside a crystal. That fact, obviously, increases the starting beam current. In this report we have shown that the application of external Bragg reflectors gives the possibility to lower radiation self-absorption inside a crystal by modifying radiation modes excited in the active medium under consideration. The corresponding dispersion equation and the expression for excited modes are derived. The generation equation determining starting conditions for lasing is obtained. Using these expressions we have shown that the application of external Bragg reflectors permits to reduce starting beam current density more than 10 times