Voluntary Service System (VSS)
Department of Veterans Affairs — Voluntary Service System (VSS) is a national-level application which replaced the site-based Voluntary Timekeeping System (VTK). VTK was used for many years at the...
Directory of Open Access Journals (Sweden)
Yunfen Shi
2018-01-01
Full Text Available Piggery wastewater is a kind of high concentration organic wastewater with high concentration of pollutants, large amount of emissions, and serious environmental pollution and is difficult to deal with. Piggery wastewater was treated with autothermal hyperthermia aerobic digestion process (ATAD and its biodegradation kinetics was studied. The ATAD system was automatically heated up and the reaction temperature rose from ambient temperature of 20°C to a maximum temperature of 64°C. Based on Arrhenius formula, the empirical model is obtained through dimensional analysis. The removal of volatile suspended solids (VSS was correlated with the initial VSS concentration, water inlet temperature, aeration rate, and agitation rate in the model. In the empirical model, the apparent activation energy was 2.827 kJ·mol−1. The exponentials for the initial VSS concentration, aeration rate, and stirring rate were 1.0587, −0.0976, and −0.1618, respectively. The correlation coefficient of the exponential factor was 0.9971. The VSS removal efficiency predicted by the model was validated with an actual test, showing a maximum relative deviation of 8.82%. Sludge systems show a lower diversity of microbial populations and Bacillus occupies a very important position in the reactor. The data obtained will be useful for optimizing piggery wastewater treatment process. The new model provided good theoretical guidance with good practicality.
RETRENCHMENT STRATEGY IN HUMAN RESOURCE MANAGEMENT: THE CASE OF VOLUNTARY SEPARATION SCHEME (VSS
Directory of Open Access Journals (Sweden)
T. Ramayah
2004-01-01
Full Text Available One of the major challenges of business leadership in this millennium is to manage continued improvement in a competitive position. In order to stay competitive, companies are trying to become more "mean and lean". To achieve this, many major corporations have adopted the "downsizing and rightsizing" strategy. Voluntary Separation Scheme (VSS has been a global phenomenon since the 1980's and is common particularly in larger companies. In this study, the reaction to the VSS program involving the employees of a government agency embracing privatisation was studied, specifically the influence of the basic needs and referent power on the choice of acceptance and non-acceptance of VSS. The second objective of this study was to evaluate the success or failure of the VSS from the workers perspective in particular, whether their decision met their needs. The results showed that basic needs had an influence on the acceptance and the non-acceptance of VSS, namely health needs, security needs and self-esteem needs. All the referent powers (subjective norms had an influence, but surprisingly close friends had the strongest influence. Differences were also found between the expectations and the perception of the workers who accepted or rejected the VSS. From the workers' perspective, it appeared that the VSS carried out in this organization was not a success.
Directory of Open Access Journals (Sweden)
Windarti Windarti
2016-06-01
Full Text Available Penelitian ini bertujuan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris menggunakan Vocabulary Self-Collection Strategy (VSS siswa kelas VII SMP Negeri 3 Kalasan. Metode penelitian yang digunakan yaitu penelitian tindakan kelas (PTK, yang terdiri dari dua siklus. Tiap siklus terdiri dari empat tahap, yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Subjek penelitian ini adalah 32 siswa kelas VII B SMP Negeri 3 Kalasan tahun ajaran 2013/2014. Teknik pengumpulan data yang digunakan yaitu observasi, tes, dan wawancara. Analisis data yang digunakan yaitu deskriptif kuantitatif dan deskriptif kualitatif. Hasil penelitian ini menunjukan bahwa penerapan strategi VSS dapat digunakan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris. Peningkatan hasil belajar siswa ditunjukkan dengan meningkatnya jumlah siswa yang lulus standar KKM pada siklus I dan II. Nilai rata-rata tes pada siklus I adalah 77,2. Nilai rata-rata tes pada siklus II adalah 82,4. Kesimpulan pada penelitian ini adalah bahwa penerapan strategi VSS dapat meningkatkan perolehan kosakata bahasa Inggris dalam pemahaman membaca siswa kelas VII SMP Negeri 3 Kalasan. Kata kunci: VSS, perolehan kosakata, pemahaman membaca bahasa Inggris. THE EFFORT TO IMPROVE VOCABULARY ACQUISITION IN ENGLISH READING COMPREHENSION USING VSS ON THE STUDENTS OF SMP Abstract This study aims to improve vocabulary acquisition in English reading comprehension using Vocabulary Self-Collection Strategy (VSS on the seventh grade students of SMP Negeri 3 Kalasan. This was an action reserch study consisting of two cycles. Each cycle consisted of four steps, namely planning, implementation, observation, and reflection. The research subjects were 32 seventh grade students of SMP 3 Kalasan in the academic year of 2013/2014. The data were collected through observation, tests, and interviews and analyzed by means of quantitative and qualitative descriptive
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure......We present a general treatment of all non-cryptographic (i.e., information-theoretically secure) linear veriable-secret-sharing (VSS) and distributed-commitment (DC) schemes, based on an underlying secret sharing scheme, pairwise checks between players, complaints, and accusations of the dealer...
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure...
International Nuclear Information System (INIS)
Huckaby, J.L.; Edwards, J.A.; Evans, J.C.
1996-08-01
This report discusses comparison tests for two methods of collecting vapor samples from the Hanford Site high-level radioactive waste tank headspaces. The two sampling methods compared are the truck-mounted vapor sampling system (VSS) and the cart-mounted in-situ vapor sampling (ISVS). Three tanks were sampled by both the VSS and ISVS methods from the same access risers within the same 8-hour period. These tanks have diverse headspace compositions and they represent the highest known level of several key vapor analytes
den Hollander, Richard J. M.; Bouma, Henri; van Rest, Jeroen H. C.; ten Hove, Johan-Martijn; ter Haar, Frank B.; Burghouts, Gertjan J.
2017-10-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS with analytics needs careful configuration and prompt maintenance to avoid false alarms. However, there is a trend from static VSS consisting of fixed CCTV cameras towards more dynamic VSS deployments over public/private multi-organization networks, consisting of a wider variety of visual sensors, including pan-tilt-zoom (PTZ) cameras, body-worn cameras and cameras on moving platforms. This trend will lead to more dynamic scenes and more frequent changes in the optical chain, creating structural problems for analytics. If these problems are not adequately addressed, analytics will not be able to continue to meet end users' developing needs. In this paper, we present a three-part solution for managing the performance of complex analytics deployments. The first part is a register containing meta data describing relevant properties of the optical chain, such as intrinsic and extrinsic calibration, and parameters of the scene such as lighting conditions or measures for scene complexity (e.g. number of people). A second part frequently assesses these parameters in the deployed VSS, stores changes in the register, and signals relevant changes in the setup to the VSS administrator. A third part uses the information in the register to dynamically configure analytics tasks based on VSS operator input. In order to support the feasibility of this solution, we give an overview of related state-of-the-art technologies for autocalibration (self-calibration), scene recognition and lighting estimation in relation to person detection. The presented solution allows for rapid and robust deployment of Video Content Analysis (VCA) tasks in large scale ad-hoc networks.
Hollander R.J.M. den; Bouma, H.; Rest, J.H.C. van; Hove, J.M. ten; Haar, F.B. ter; Burghouts, G.J.
2017-01-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS
Improved Fractional Order VSS Inc-Cond MPPT Algorithm for Photovoltaic Scheme
Directory of Open Access Journals (Sweden)
R. Arulmurugan
2014-01-01
Full Text Available Nowadays a hot topic among the research community is the harnessing energy from the free sunlight which is abundant and pollution-free. The availability of cheap solar photovoltaic (PV modules has to harvest solar energy with better efficiency. The nature of solar modules is nonlinear and therefore the proper impedance matching is essential. The proper impedance matching ensures the extraction of the maximum power from solar PV module. Maximum power point tracking (MPPT algorithm is acting as a significant part in solar power generating system because it varies in the output power from a PV generating set for various climatic conditions. This paper suggested a new improved work for MPPT of PV energy system by using the optimized novel improved fractional order variable step size (FOVSS incremental conductance (Inc-Cond algorithm. The new proposed controller combines the merits of both improved fractional order (FO and variable step size (VSS Inc-Cond which is well suitable for design control and execution. The suggested controller results in attaining the desired transient reaction under changing operating points. MATLAB simulation effort shows MPPT controller and a DC to DC Luo converter feeding a battery load is achieved. The laboratory experimental results demonstrate that the new proposed MPPT controller in the photovoltaic generating system is valid.
Gamma Knife radiosurgery for large vestibular schwannomas greater than 3 cm in diameter.
Huang, Cheng-Wei; Tu, Hsien-Tang; Chuang, Chun-Yi; Chang, Cheng-Siu; Chou, Hsi-Hsien; Lee, Ming-Tsung; Huang, Chuan-Fu
2018-05-01
OBJECTIVE Stereotactic radiosurgery (SRS) is an important alternative management option for patients with small- and medium-sized vestibular schwannomas (VSs). Its use in the treatment of large tumors, however, is still being debated. The authors reviewed their recent experience to assess the potential role of SRS in larger-sized VSs. METHODS Between 2000 and 2014, 35 patients with large VSs, defined as having both a single dimension > 3 cm and a volume > 10 cm 3 , underwent Gamma Knife radiosurgery (GKRS). Nine patients (25.7%) had previously undergone resection. The median total volume covered in this group of patients was 14.8 cm 3 (range 10.3-24.5 cm 3 ). The median tumor margin dose was 11 Gy (range 10-12 Gy). RESULTS The median follow-up duration was 48 months (range 6-156 months). All 35 patients had regular MRI follow-up examinations. Twenty tumors (57.1%) had a volume reduction of greater than 50%, 5 (14.3%) had a volume reduction of 15%-50%, 5 (14.3%) were stable in size (volume change 3 cm and a volume > 10 cm 3 and tolerable mass effect can be managed satisfactorily with GKRS. Tumor volume ≥ 15 cm 3 is a significant factor predicting poor tumor control following GKRS.
An improved AE detection method of rail defect based on multi-level ANC with VSS-LMS
Zhang, Xin; Cui, Yiming; Wang, Yan; Sun, Mingjian; Hu, Hengshan
2018-01-01
In order to ensure the safety and reliability of railway system, Acoustic Emission (AE) method is employed to investigate rail defect detection. However, little attention has been paid to the defect detection at high speed, especially for noise interference suppression. Based on AE technology, this paper presents an improved rail defect detection method by multi-level ANC with VSS-LMS. Multi-level noise cancellation based on SANC and ANC is utilized to eliminate complex noises at high speed, and tongue-shaped curve with index adjustment factor is proposed to enhance the performance of variable step-size algorithm. Defect signals and reference signals are acquired by the rail-wheel test rig. The features of noise signals and defect signals are analyzed for effective detection. The effectiveness of the proposed method is demonstrated by comparing with the previous study, and different filter lengths are investigated to obtain a better noise suppression performance. Meanwhile, the detection ability of the proposed method is verified at the top speed of the test rig. The results clearly illustrate that the proposed method is effective in detecting rail defects at high speed, especially for noise interference suppression.
Biasetti, Jacopo; Hussain, Fazle; Gasser, T Christian
2011-10-07
Abdominal aortic aneurysms (AAAs) are frequently characterized by the development of an intra-luminal thrombus (ILT), which is known to have multiple biochemical and biomechanical implications. Development of the ILT is not well understood, and shear-stress-triggered activation of platelets could be the first step in its evolution. Vortical structures (VSs) in the flow affect platelet dynamics, which motivated the present study of a possible correlation between VS and ILT formation in AAAs. VSs educed by the λ(2)-method using computational fluid dynamics simulations of the backward-facing step problem, normal aorta, fusiform AAA and saccular AAA were investigated. Patient-specific luminal geometries were reconstructed from computed tomography scans, and Newtonian and Carreau-Yasuda models were used to capture salient rheological features of blood flow. Particularly in complex flow domains, results depended on the constitutive model. VSs developed all along the normal aorta, showing that a clear correlation between VSs and high wall shear stress (WSS) existed, and that VSs started to break up during late systole. In contrast, in the fusiform AAA, large VSs developed at sites of tortuous geometry and high WSS, occupying the entire lumen, and lasting over the entire cardiac cycle. Downward motion of VSs in the AAA was in the range of a few centimetres per cardiac cycle, and with a VS burst at that location, the release (from VSs) of shear-stress-activated platelets and their deposition to the wall was within the lower part of the diseased artery, i.e. where the thickest ILT layer is typically observed. In the saccular AAA, only one VS was found near the healthy portion of the aorta, while in the aneurysmatic bulge, no VSs occurred. We present a fluid-dynamics-motivated mechanism for platelet activation, convection and deposition in AAAs that has the potential of improving our current understanding of the pathophysiology of fluid-driven ILT growth.
Large vestibular schwannomas and hydrocephalus: Lessons learnt from a single centre experience
Directory of Open Access Journals (Sweden)
Prakash Nair
2014-01-01
Full Text Available Aim: The aim of the following study is to analyze the outcome following surgery in 169 patients with large vestibular schwannoma (VS and to evaluate hydrocephalus as a prognostic factor in patients of the VSs. Subjects and Methods: Retrospective analysis of all cases of VSs admitted to our tertiary neurosurgical center from January 2005 to December 2010 was performed. Comparison of patients who underwent pre-operative cerebrospinal fluid (CSF diversion and those who underwent primary surgery was carried out for post-operative complications and delayed hydrocephalus. Results: A total of 169 patients of VS were seen. The mean age at presentation was 39.03 years (12-72 years. The most common symptom was hearing loss seen in 161 (95.2% cases. Giant VS was seen in 130 (75.5% and hydrocephalus was present in 110 (63.9%. Pre-operative CSF diversion was done in 23 (13.1% patients; 8 (4.6% patients developed gradually symptomatic hydrocephalus following surgery and underwent ventriculoperitoneal shunt. Total surgical excision was done in 92.9% patients and subtotal excision was done in 7% patients. Conclusions: Hydrocephalus occurs in longstanding untreated cases of VS. Hydrocephalus causes no statistically significant increase in post-operative complications like CSF leak and post-operative hematoma. Patients with hydrocephalus presenting with acute symptoms of raised intracranial pressure benefit from CSF diversion. In most patients, tumor resection will restore patency of the CSF pathway and CSF diversion can be avoided.
Seguino, Alessandro; Seguino, Ferruccio; Eleuteri, Antonio; Rhind, Susan M
2014-01-01
Veterinary surgeons working on farms and food-processing establishments play a fundamental role in safeguarding both public health and the welfare of animals under their care. An essential part of veterinary public health (VPH) undergraduate training in the UK involves students undertaking placements within abattoirs, a practice that remains vital to the educational experience of future veterinary professionals. However, several issues have adversely affected the ability of students to gain such extramural placements. For this reason, the Virtual Slaughterhouse Simulator (VSS) was developed to strengthen and enhance undergraduate VPH teaching at the Royal (Dick) School of Veterinary Studies, enabling students to explore a realistic abattoir work environment with embedded educational activities. The aim of this research project was to evaluate the VSS as a teaching and learning tool for training and educating veterinary students. Ninety-eight final-year veterinary students engaged with the prototype VSS, followed by assessment of their knowledge and behavior when faced with a "real-life" abattoir situation. Further evaluation of their experiences with the VSS was carried out using questionnaires and focus groups. The results of this investigation show that there is the potential for the VSS to enhance the student learning experience in basic abattoir procedures. This innovative tool provides a visually based learning resource that can support traditional lectures and practical classes and can also be used to stimulate interactive problem-solving activities embedded in the relevant context.
Desain dan Implementasi Aplikasi Video Surveillance System Berbasis Web-SIG
Directory of Open Access Journals (Sweden)
I M.O. Widyantara
2015-06-01
Full Text Available Video surveillance system (VSS is an monitoring system based-on IP-camera. VSS implemented in live streaming and serves to observe and monitor a site remotely. Typically, IP- camera in the VSS has a management software application. However, for ad hoc applications, where the user wants to manage VSS independently, application management software has become ineffective. In the IP-camera installation spread over a large area, an administrator would be difficult to describe the location of the IP-camera. In addition, monitoring an area of IP- Camera will also become more difficult. By looking at some of the flaws in VSS, this paper has proposed a VSS application for easy monitoring of each IP Camera. Applications that have been proposed to integrate the concept of web-based geographical information system with the Google Maps API (Web-GIS. VSS applications built with smart features include maps ip-camera, live streaming of events, information on the info window and marker cluster. Test results showed that the application is able to display all the features built well
Nickelson, Jen; Alfonso, Moya L; McDermott, Robert J; Bumpus, Elizabeth C; Bryant, Carol A; Baldwin, Julie A
2011-04-01
Creating community-based opportunities for youth to be physically active is challenging for many municipalities. A Lexington, Kentucky community coalition designed and piloted a physical activity program, 'VERB™ summer scorecard (VSS)', leveraging the brand equity of the national VERB™--It's What You Do! campaign. Key elements of VSS subsequently were adopted in Sarasota County, FL. This study identified characteristics of Sarasota's VSS participants and non-participants. Students in Grades 5-8 from six randomly selected public schools completed a survey assessing VSS participation, physical activity level, psychosocial variables, parental support for physical activity and demographics. Logistic regression showed that VSS participants were more likely to be from Grades 5 to 6 versus Grades 7 and 8 [odds ratio (OR) = 6.055] and perceive high versus low parental support for physical activity (OR = 4.627). Moreover, for each unit rise in self-efficacy, the odds of VSS participation rose by 1.839. Chi-squared automatic interaction detector (CHAID) analysis suggested an interaction effect between grade and school socioeconomic status (SES), with a large proportion of seventh and eighth graders from high SES schools being non-participants (76.6%). A VSS-style program can be expected to be more effective with tweens who are younger, in a middle SES school, having high self-efficacy and high parental support for physical activity.
Developing Large Web Applications
Loudon, Kyle
2010-01-01
How do you create a mission-critical site that provides exceptional performance while remaining flexible, adaptable, and reliable 24/7? Written by the manager of a UI group at Yahoo!, Developing Large Web Applications offers practical steps for building rock-solid applications that remain effective even as you add features, functions, and users. You'll learn how to develop large web applications with the extreme precision required for other types of software. Avoid common coding and maintenance headaches as small websites add more pages, more code, and more programmersGet comprehensive soluti
Balancing Public and Private Regulation
Directory of Open Access Journals (Sweden)
Martijn Scheltema
2016-01-01
Full Text Available Voluntary Sustainability Standards (VSS might develop into a viable alternative to public regulation. However, it turns on the (regulatory circumstances whether that holds true in practice. If public regulation on CSR topics is lacking, governments are unable to agree upon certain topics on a global level or diverging public regulation exists, VSS can be helpful to set global standards. Obviously, private standards will especially be helpful if they are commensurate with local public legislation (and e.g. treaties and/or are accepted by local governments. If one neglects this, numerous domestic structures might exist that frustrate VSS. Furthermore, governments have to remain vigilant as to whether these private regimes do not result in market disruption, consumer detriment or hamper trade. VSS might also compete with public arrangements which might limit the uptake of VSS. However, if public regulation exists VSS might be a viable alternative if compliance with not too compelling public norms by market participants is rather poor and the public policymaker is aiming to incentivize the better performing part of the market to embark on higher standards and thus only desires to regulate the less performing part of the market. However, of paramount importance is the effectiveness of VSS in order to be a viable alternative to public regulation. The effectiveness of VSS should be assessed using an integrated multi-disciplinary (comparative approach entailing legal, impact-assessment, legitimacy, governance and behavioural aspects. Only effective VSS in the aforementioned sense are a true alternative to public regulation.Beyond that, the legal perspective in connection with (the effectiveness of VSS is discussed, featuring FSC and UTZ Certified as an example. It is important from this perspective that VSS have a clear and sufficiently selective objective and sufficiently specific norms, are regularly evaluated, entail ‘conflict of law rules’ and
Why did humans develop a large brain?
Muscat Baron, Yves
2012-01-01
"Of all animals, man has the largest brain in proportion to his size"- Aristotle. Dr Yves Muscat Baron shares his theory on how humans evolved large brains. The theory outlines how gravity could have helped humans develop a large brain- the author has named the theory 'The Gravitational Vascular Theory'. http://www.um.edu.mt/think/why-did-humans-develop-a-large-brain/
Large shaft development test plan
International Nuclear Information System (INIS)
Krug, A.D.
1984-03-01
This test plan proposes the conduct of a large shaft development test at the Hanford site in support of the repository development program. The purpose and objective of the test plan is to obtain the information necessary to establish feasibility and to predict the performance of the drilling system used to drill large diameter shafts. The test plan is based upon drilling a 20 ft diameter shaft to a depth of 1,000 feet. The test plan specifies series of tests to evaluate the performance of the downhole assembly, the performance of the rig, and the ability of the system to cope with geologic hazards. The quality of the hole produced will also be determined. This test plan is considered to be preliminary in that it was prepared as input for the decision to determine if development testing is required in this area. Should the decision be made to proceed with development testing, this test plan shall be updated and revised. 6 refs., 2 figs., 3 tabs
Conduction-band valley spin splitting in single-layer H-T l2O
Ma, Yandong; Kou, Liangzhi; Du, Aijun; Huang, Baibiao; Dai, Ying; Heine, Thomas
2018-02-01
Despite numerous studies, coupled spin and valley physics is currently limited to two-dimensional (2D) transition-metal dichalcogenides (TMDCs). Here, we predict an exceptional 2D valleytronic material associated with the spin-valley coupling phenomena beyond 2D TMDCs—single-layer (SL) H-T l2O . It displays large valley spin splitting (VSS), significantly larger than that of 2D TMDCs, and a finite band gap, which are both critically attractive for the integration of valleytronics and spintronics. More importantly, in sharp contrast to all the experimentally confirmed 2D valleytronic materials, where the strong valence-band VSS (0.15-0.46 eV) supports the spin-valley coupling, the VSS in SL H-T l2O is pronounced in its conduction band (0.61 eV), but negligibly small in its valence band (21 meV), thus opening a way for manipulating the coupled spin and valley physics. Moreover, SL H-T l2O possesses extremely high carrier mobility, as large as 9.8 ×103c m2V-1s-1 .
Virtual substitution scan via single-step free energy perturbation.
Chiang, Ying-Chih; Wang, Yi
2016-02-05
With the rapid expansion of our computing power, molecular dynamics (MD) simulations ranging from hundreds of nanoseconds to microseconds or even milliseconds have become increasingly common. The majority of these long trajectories are obtained from plain (vanilla) MD simulations, where no enhanced sampling or free energy calculation method is employed. To promote the 'recycling' of these trajectories, we developed the Virtual Substitution Scan (VSS) toolkit as a plugin of the open-source visualization and analysis software VMD. Based on the single-step free energy perturbation (sFEP) method, VSS enables the user to post-process a vanilla MD trajectory for a fast free energy scan of substituting aryl hydrogens by small functional groups. Dihedrals of the functional groups are sampled explicitly in VSS, which improves the performance of the calculation and is found particularly important for certain groups. As a proof-of-concept demonstration, we employ VSS to compute the solvation free energy change upon substituting the hydrogen of a benzene molecule by 12 small functional groups frequently considered in lead optimization. Additionally, VSS is used to compute the relative binding free energy of four selected ligands of the T4 lysozyme. Overall, the computational cost of VSS is only a fraction of the corresponding multi-step FEP (mFEP) calculation, while its results agree reasonably well with those of mFEP, indicating that VSS offers a promising tool for rapid free energy scan of small functional group substitutions. This article is protected by copyright. All rights reserved. © 2016 Wiley Periodicals, Inc.
Benefits of transactive memory systems in large-scale development
Aivars, Sablis
2016-01-01
Context. Large-scale software development projects are those consisting of a large number of teams, maybe even spread across multiple locations, and working on large and complex software tasks. That means that neither a team member individually nor an entire team holds all the knowledge about the software being developed and teams have to communicate and coordinate their knowledge. Therefore, teams and team members in large-scale software development projects must acquire and manage expertise...
Disintegration impact on sludge digestion process.
Dauknys, Regimantas; Rimeika, Mindaugas; Jankeliūnaitė, Eglė; Mažeikienė, Aušra
2016-11-01
The anaerobic sludge digestion is a widely used method for sludge stabilization in wastewater treatment plant. This process can be improved by applying the sludge disintegration methods. As the sludge disintegration is not investigated enough, an analysis of how the application of thermal hydrolysis affects the sludge digestion process based on full-scale data was conducted. The results showed that the maximum volatile suspended solids (VSS) destruction reached the value of 65% independently on the application of thermal hydrolysis. The average VSS destruction increased by 14% when thermal hydrolysis was applied. In order to have the maximum VSS reduction and biogas production, it is recommended to keep the maximum defined VSS loading of 5.7 kg VSS/m(3)/d when the thermal hydrolysis is applied and to keep the VSS loading between 2.1-2.4 kg VSS/m(3)/d when the disintegration of sludge is not applied. The application of thermal hydrolysis leads to an approximately 2.5 times higher VSS loading maintenance comparing VSS loading without the disintegration; therefore, digesters with 1.8 times smaller volume is required.
Large Scale Survey Data in Career Development Research
Diemer, Matthew A.
2008-01-01
Large scale survey datasets have been underutilized but offer numerous advantages for career development scholars, as they contain numerous career development constructs with large and diverse samples that are followed longitudinally. Constructs such as work salience, vocational expectations, educational expectations, work satisfaction, and…
Freitas, Alex A; Limbu, Kriti; Ghafourian, Taravat
2015-01-01
Volume of distribution is an important pharmacokinetic property that indicates the extent of a drug's distribution in the body tissues. This paper addresses the problem of how to estimate the apparent volume of distribution at steady state (Vss) of chemical compounds in the human body using decision tree-based regression methods from the area of data mining (or machine learning). Hence, the pros and cons of several different types of decision tree-based regression methods have been discussed. The regression methods predict Vss using, as predictive features, both the compounds' molecular descriptors and the compounds' tissue:plasma partition coefficients (Kt:p) - often used in physiologically-based pharmacokinetics. Therefore, this work has assessed whether the data mining-based prediction of Vss can be made more accurate by using as input not only the compounds' molecular descriptors but also (a subset of) their predicted Kt:p values. Comparison of the models that used only molecular descriptors, in particular, the Bagging decision tree (mean fold error of 2.33), with those employing predicted Kt:p values in addition to the molecular descriptors, such as the Bagging decision tree using adipose Kt:p (mean fold error of 2.29), indicated that the use of predicted Kt:p values as descriptors may be beneficial for accurate prediction of Vss using decision trees if prior feature selection is applied. Decision tree based models presented in this work have an accuracy that is reasonable and similar to the accuracy of reported Vss inter-species extrapolations in the literature. The estimation of Vss for new compounds in drug discovery will benefit from methods that are able to integrate large and varied sources of data and flexible non-linear data mining methods such as decision trees, which can produce interpretable models. Graphical AbstractDecision trees for the prediction of tissue partition coefficient and volume of distribution of drugs.
On Converting Secret Sharing Scheme to Visual Secret Sharing Scheme
Directory of Open Access Journals (Sweden)
Wang Daoshun
2010-01-01
Full Text Available Abstract Traditional Secret Sharing (SS schemes reconstruct secret exactly the same as the original one but involve complex computation. Visual Secret Sharing (VSS schemes decode the secret without computation, but each share is m times as big as the original and the quality of the reconstructed secret image is reduced. Probabilistic visual secret sharing (Prob.VSS schemes for a binary image use only one subpixel to share the secret image; however the probability of white pixels in a white area is higher than that in a black area in the reconstructed secret image. SS schemes, VSS schemes, and Prob. VSS schemes have various construction methods and advantages. This paper first presents an approach to convert (transform a -SS scheme to a -VSS scheme for greyscale images. The generation of the shadow images (shares is based on Boolean XOR operation. The secret image can be reconstructed directly by performing Boolean OR operation, as in most conventional VSS schemes. Its pixel expansion is significantly smaller than that of VSS schemes. The quality of the reconstructed images, measured by average contrast, is the same as VSS schemes. Then a novel matrix-concatenation approach is used to extend the greyscale -SS scheme to a more general case of greyscale -VSS scheme.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS. PMID:27574507
Large shaft development test plan
International Nuclear Information System (INIS)
Krug, A.D.
1984-03-01
This test plan proposes the conduct of shaft liner tests as part of the large shaft development test proposed for the Hanford Site in support of the repository development program. The objectives of these tests are to develop techniques for measuring liner alignment (straightness), both construction assembly alignment and downhole cumulative alignment, and to assess the alignment information as a real time feedback to aid the installation procedure. The test plan is based upon installing a 16 foot ID shaft liner into a 20 foot diameter shaft to a depth of 1000 feet. This test plan is considered to be preliminary in that it was prepared as input for the decision to determine if development testing is required in this area. Should the decision be made to proceed with development testing, this test plan shall be updated and revised. 6 refs., 2 figs
Quality assurance in a large research and development laboratory
International Nuclear Information System (INIS)
Neill, F.H.
1980-01-01
Developing a quality assurance program for a large research and development laboratory provided a unique opportunity for innovative planning. The quality assurance program that emerged has been tailored to meet the requirements of several sponsoring organizations and contains the flexibility for experimental programs ranging from large engineering-scale development projects to bench-scale basic research programs
Directory of Open Access Journals (Sweden)
Mateusz Gola
2016-08-01
Full Text Available There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS for human sexuality studies, including emerging field of research on compulsive sexual behaviors. A central question in this field is whether behaviors such as extensive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned (cue and unconditioned (reward stimuli (related to reward anticipation vs reward consumption, respectively. Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as cues (conditioned stimuli or rewards (unconditioned stimuli. Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward (unconditioned stimuli, as evidenced by: 1. experience of pleasure while watching VSS, possibly accompanied by genital reaction 2. reward-related brain activity correlated with these pleasurable feelings in response to VSS, 3. a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money, and/or 4. conditioning for cues (CS predictive for. We hope that this perspective paper will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Sliding Modes after the First Decade of the 21st Century State of the Art
Moreno, Jaime; Iriarte, Rafael
2012-01-01
The book presents the newest results of the major world research groups working in the area of Variable Structure Systems and Sliding Mode Control (VSS/SMC). The research activity of these groups is coordinated by the IEEE Technical Committee on Variable Structure Systems (VSS) and Sliding Modes (SM). The presented results include the reports of the research groups collaborating in a framework of the Unión European Union – México project of Fondo de Cooperación Internacional en Ciencia y Tecnología (FONCICyT) 93302 titled "Automatization and Monitoring of Energy Production Processes via Sliding Mode Control". The book starts with the overview of the sliding mode control concepts and algorithms that were developed and discussed in the last two decades The research papers are combined in three sections: Part I: VSS and SM Algorithms and their Analysis Part II: SMC Design Part III: Applications of VSS and SMC The book will be of interests of engineers, researchers and graduate students working in the area ...
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R L; Fernandes, L; Sun, X [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1994-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R.L.; Fernandes, L.; Sun, X. [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1993-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
Large Instrument Development for Radio Astronomy
Fisher, J. Richard; Warnick, Karl F.; Jeffs, Brian D.; Norrod, Roger D.; Lockman, Felix J.; Cordes, James M.; Giovanelli, Riccardo
2009-03-01
This white paper offers cautionary observations about the planning and development of new, large radio astronomy instruments. Complexity is a strong cost driver so every effort should be made to assign differing science requirements to different instruments and probably different sites. The appeal of shared resources is generally not realized in practice and can often be counterproductive. Instrument optimization is much more difficult with longer lists of requirements, and the development process is longer and less efficient. More complex instruments are necessarily further behind the technology state of the art because of longer development times. Including technology R&D in the construction phase of projects is a growing trend that leads to higher risks, cost overruns, schedule delays, and project de-scoping. There are no technology breakthroughs just over the horizon that will suddenly bring down the cost of collecting area. Advances come largely through careful attention to detail in the adoption of new technology provided by industry and the commercial market. Radio astronomy instrumentation has a very bright future, but a vigorous long-term R&D program not tied directly to specific projects needs to be restored, fostered, and preserved.
Large superconducting coil fabrication development
International Nuclear Information System (INIS)
Brown, R.L.; Allred, E.L.; Anderson, W.C.; Burn, P.B.; Deaderick, R.I.; Henderson, G.M.; Marguerat, E.F.
1975-01-01
Toroidal fields for some fusion devices will be produced by an array of large superconducting coils. Their size, space limitation, and field requirements dictate that they be high performance coils. Once installed, accessibility for maintenance and repairs is severely restricted; therefore, good reliability is an obvious necessity. Sufficient coil fabrication will be undertaken to develop and test methods that are reliable, fast, and economical. Industrial participation will be encouraged from the outset to insure smooth transition from development phases to production phases. Initially, practice equipment for three meter bore circular coils will be developed. Oval shape coil forms will be included in the practice facility later. Equipment that is more automated will be developed with the expectation of winding faster and obtaining good coil quality. Alternate types of coil construction, methods of winding and insulating, will be investigated. Handling and assembly problems will be studied. All technology developed must be feasible for scaling up when much larger coils are needed. Experimental power reactors may need coils having six meter or larger bores
Energy Technology Data Exchange (ETDEWEB)
Keller, Eric J.; Collins, Jeremy D. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Crowley-Matoka, Megan [Northwestern University Feinberg School of Medicine, Center for Bioethics and Medical Humanities (United States); Chrisman, Howard B. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Milad, Magdy P. [Northwestern University Feinberg School of Medicine, Department of Obstetrics and Gynecology-Reproductive Endocrinology and Infertility (United States); Vogelzang, Robert L., E-mail: vogelzang@northwestern.edu [Northwestern University Feinberg School of Medicine, Department of Radiology (United States)
2017-06-15
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
International Nuclear Information System (INIS)
Keller, Eric J.; Collins, Jeremy D.; Crowley-Matoka, Megan; Chrisman, Howard B.; Milad, Magdy P.; Vogelzang, Robert L.
2017-01-01
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
State of the art of teledermatopathology.
Massone, Cesare; Brunasso, Alexandra M G; Campbell, Terri M; Soyer, H Peter
2008-10-01
Teledermatopathology may involve real-time transmission of images from distant locations to consulting pathologists by the remote manipulation of a robotic microscope. Alternatively, the static store-and-forward option involves the single-file transmission of subjectively preselected and captured areas of microscopic images by a referring physician. The recent introduction of virtual slide systems (VSS) involves the digitization of whole slides at high resolution thus enabling the user to view any part of the specimen at any magnification. Such technology has surmounted previous restrictions caused by the size of preselected areas and specimen sampling for telepathology. In terms of client access, these VSS may be stored on a virtual slide server, made available on the Web for remote consultation by pathologists via an integrated virtual slide client network. Despite store-and-forward teledermatopathology being the most frequently used and less expensive approach to teledermatopathology, VSS represents the future in this discipline. The recent pilot studies suggest that the use of remote expert consultants in diagnostic dermatopathology can be integrated into daily routine, teleconsultation, and teleteaching. The new technology enables rapid and reproducible diagnoses, but despite its usability, VSS is not completely feasible for teledermatopathology of inflammatory skin diseases as the performance seems to be influenced by the availability of complete clinical data. Improvements in the diagnostic facility will no doubt follow from further development of the VSS, the slide processor, and of course training in the use of virtual microscope. Undoubtedly, as technology becomes even more sophisticated in the future, VSS will overcome the present drawbacks and find its place in all facets of teledermatopathology.
Evaluation of flat sheet membrane bioreactor efficiency for municipal wastewater treatment
Directory of Open Access Journals (Sweden)
Somayeh Fazeli
2012-01-01
Conclusion: It is concluded that FS-MBR can be used in the large scale municipal wastewater treatment plants to improve effluent quality due to high removal of COD, BOD 5 , TSS and VSS to meet effluent discharge standards.
Large sample NAA facility and methodology development
International Nuclear Information System (INIS)
Roth, C.; Gugiu, D.; Barbos, D.; Datcu, A.; Aioanei, L.; Dobrea, D.; Taroiu, I. E.; Bucsa, A.; Ghinescu, A.
2013-01-01
A Large Sample Neutron Activation Analysis (LSNAA) facility has been developed at the TRIGA- Annular Core Pulsed Reactor (ACPR) operated by the Institute for Nuclear Research in Pitesti, Romania. The central irradiation cavity of the ACPR core can accommodate a large irradiation device. The ACPR neutron flux characteristics are well known and spectrum adjustment techniques have been successfully applied to enhance the thermal component of the neutron flux in the central irradiation cavity. An analysis methodology was developed by using the MCNP code in order to estimate counting efficiency and correction factors for the major perturbing phenomena. Test experiments, comparison with classical instrumental neutron activation analysis (INAA) methods and international inter-comparison exercise have been performed to validate the new methodology. (authors)
Bosman, Renske; Borg, Charmaine; Jong, de Peter J.; Georgiadis, Janniko
Samenvatting Achtergrond Aan de ene kant kunnen mensen visuele seksuele stimulatie (VSS) ervaren als plezierig, maar aan de andere kant kunnen mensen VSS ook ervaren als iets “viezigs” en negatief. Dit onderzoek richt zich op de vraag hoe het brein bij vrouwen reageert op VSS en hoe de
Extraretinal induced visual sensations during IMRT of the brain.
Wilhelm-Buchstab, Timo; Buchstab, Barbara Myrthe; Leitzen, Christina; Garbe, Stephan; Müdder, Thomas; Oberste-Beulmann, Susanne; Sprinkart, Alois Martin; Simon, Birgit; Nelles, Michael; Block, Wolfgang; Schoroth, Felix; Schild, Hans Heinz; Schüller, Heinrich
2015-01-01
We observed visual sensations (VSs) in patients undergoing intensity modulated radiotherapy (IMRT) of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin. Analyzed were ten consecutive patients (aged 41-71 years) with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy) with helical tomotherapy (TT). A megavolt-CT (MVCT) was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF) matrix. Distance to the orbital roof (OR) from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient) 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm). The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%). There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
Extraretinal induced visual sensations during IMRT of the brain.
Directory of Open Access Journals (Sweden)
Timo Wilhelm-Buchstab
Full Text Available We observed visual sensations (VSs in patients undergoing intensity modulated radiotherapy (IMRT of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin.Analyzed were ten consecutive patients (aged 41-71 years with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy with helical tomotherapy (TT. A megavolt-CT (MVCT was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF matrix. Distance to the orbital roof (OR from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm. The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%.There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
Future development of large steam turbines
International Nuclear Information System (INIS)
Chevance, A.
1975-01-01
An attempt is made to forecast the future of the large steam turbines till 1985. Three parameters affect the development of large turbines: 1) unit output; and a 2000 to 2500MW output may be scheduled; 2) steam quality: and two steam qualities may be considered: medium pressure saturated or slightly overheated steam (light water, heavy water); light enthalpie drop, high pressure steam, high temperature; high enthalpic drop; and 3) the quality of cooling supply. The largest range to be considered might be: open system cooling for sea-sites; humid tower cooling and dry tower cooling. Bi-fluid cooling cycles should be also mentioned. From the study of these influencing factors, it appears that the constructor, for an output of about 2500MW should have at his disposal the followings: two construction technologies for inlet parts and for high and intermediate pressure parts corresponding to both steam qualities; exhaust sections suitable for the different qualities of cooling supply. The two construction technologies with the two steam qualities already exist and involve no major developments. But, the exhaust section sets the question of rotational speed [fr
Developing Agent-Oriented Video Surveillance System through Agent-Oriented Methodology (AOM
Directory of Open Access Journals (Sweden)
Cheah Wai Shiang
2016-12-01
Full Text Available Agent-oriented methodology (AOM is a comprehensive and unified agent methodology for agent-oriented software development. Although AOM is claimed to be able to cope with a complex system development, it is still not yet determined up to what extent this may be true. Therefore, it is vital to conduct an investigation to validate this methodology. This paper presents the adoption of AOM in developing an agent-oriented video surveillance system (VSS. An intruder handling scenario is designed and implemented through AOM. AOM provides an alternative method to engineer a distributed security system in a systematic manner. It presents the security system at a holistic view; provides a better conceptualization of agent-oriented security system and supports rapid prototyping as well as simulation of video surveillance system.
Progress with enhancing veterinary surveillance in the United Kingdom.
Lysons, R E; Gibbens, J C; Smith, L H
2007-01-27
The UK has experienced various animal health events that have had national impact in recent years. In response, a ;Veterinary Surveillance Strategy' (VSS) was published in 2003, with the objective of enhancing and coordinating national veterinary surveillance practice in a way that would enable important animal health events to be detected and assessed more rapidly and reliably. The VSS adopts an integrated UK-wide approach, which includes widespread engagement with interested parties both within government and beyond. It proposes enhancing surveillance through improved collaboration; transparent and defensible prioritisation of government resources to surveillance; deriving better value from existing resources, and assuring quality of the surveillance reports and source data. This article describes progress with implementing the VSS, in particular the methodology for developing a functional network and creating an effective, quality-assured, information management system, RADAR.
Chen, Jiazhong; Lee, Yoomin; Oleszkiewicz, Jan A
2013-01-01
The applicability of four industrial waste streams from potato processing, canola processing and oil refining, biodiesel production (glycerol), and glycol as substitutes to methanol and ethanol in denitrification of anaerobically digested sludge dewatering liquor (centrate) was evaluated in bench-scale sequencing batch reactors. It was found that glycerol was the best substitute with the specific denitrification rate (SDNR) of 13 mg NO3-N/(g VSS x h) followed by potato processing wastewater at 12mg NO3-N/(g VSS x h). Both substrates produced faster SDNR than methanol's 10mg NO3-N/(g VSS x h); however, they were inferior to ethanol's 17 mg NO3-N/(g VSS x h). Glycol had SDNR of 8 mg NO3-N/(g VSS x h) and demonstrated a very fast acclimation rate, i.e. the response in increased denitrification rate was visible in three days following glycol addition. Canola processing and oil refining wastewater was considered an inappropriate carbon source due to a low SDNR of 5 mg NO3-N/(g VSS x h) and apparent inhibitory effect on nitrification.
Configuration management in large scale infrastructure development
Rijn, T.P.J. van; Belt, H. van de; Los, R.H.
2000-01-01
Large Scale Infrastructure (LSI) development projects such as the construction of roads, rail-ways and other civil engineering (water)works is tendered differently today than a decade ago. Traditional workflow requested quotes from construction companies for construction works where the works to be
Prause, Nicole; Steele, Vaughn R; Staley, Cameron; Sabatinelli, Dean; Hajcak, Greg
2015-07-01
"Excessive" viewing of visual sexual stimuli (VSS) is the most commonly reported hypersexual behavior problem and is especially amenable to laboratory study. A pattern of enhanced sexual cue responsiveness is expected in this sample if hypersexuality shares features of other addiction models. Participants (N=122) who either reported or denied problematic VSS use were presented with emotional, including explicit sexual, images while their evoked response potentials were recorded. An interaction of hypersexual problem group and the level of desire for sex with a partner predicted LPP amplitude. Specifically, those reporting problems regulating their VSS use who also reported higher sexual desire had lower LPP in response to VSS. This pattern appears different from substance addiction models. These are the first functional physiological data of persons reporting VSS regulation problems. Copyright © 2015 Elsevier B.V. All rights reserved.
Future development of large superconducting generators
International Nuclear Information System (INIS)
Singh, S.K.; Mole, C.J.
1989-01-01
Large superconducting generators are being developed worldwide. The use of superconductors to reduce the electrical power dissipation in power equipment has been a technological possibility ever since the discovery of superconductivity, even though their use in power equipment remained an impractical dream for a long time. However, scientific and technological progress in superconductivity and cryogenics has brought this dream much closer to reality. Results obtained so far establish the technical feasibility of these machines. Analytical developments have been providing a sound basis for the design of superconducting machines and results of these design studies have shown improvements in power density of up to a factor of 10 higher than the power density for conventional machines. This paper describes the recently completed USA programs, the current foreign and USA programs, and then proposes a USA development program to maintain leadership in the field
Testing, development and demonstration of large scale solar district heating systems
DEFF Research Database (Denmark)
Furbo, Simon; Fan, Jianhua; Perers, Bengt
2015-01-01
In 2013-2014 the project “Testing, development and demonstration of large scale solar district heating systems” was carried out within the Sino-Danish Renewable Energy Development Programme, the so called RED programme jointly developed by the Chinese and Danish governments. In the project Danish...... know how on solar heating plants and solar heating test technology have been transferred from Denmark to China, large solar heating systems have been promoted in China, test capabilities on solar collectors and large scale solar heating systems have been improved in China and Danish-Chinese cooperation...
[Reflection on developing bio-energy industry of large oil company].
Sun, Haiyang; Su, Haijia; Tan, Tianwei; Liu, Shumin; Wang, Hui
2013-03-01
China's energy supply becomes more serious nowadays and the development of bio-energy becomes a major trend. Large oil companies have superb technology, rich experience and outstanding talent, as well as better sales channels for energy products, which can make full use of their own advantages to achieve the efficient complementary of exist energy and bio-energy. Therefore, large oil companies have the advantages of developing bio-energy. Bio-energy development in China is in the initial stage. There exist some problems such as available land, raw material supply, conversion technologies and policy guarantee, which restrict bio-energy from industrialized development. According to the above key issues, this article proposes suggestions and methods, such as planting energy plant in the marginal barren land to guarantee the supply of bio-energy raw materials, cultivation of professional personnel, building market for bio-energy counting on large oil companies' rich experience and market resources about oil industry, etc, aimed to speed up the industrialized process of bio-energy development in China.
Calise, A. J.; Kadushin, I.; Kramer, F.
1981-01-01
The current status of research on the application of variable structure system (VSS) theory to design aircraft flight control systems is summarized. Two aircraft types are currently being investigated: the Augmentor Wing Jet STOL Research Aircraft (AWJSRA), and AV-8A Harrier. The AWJSRA design considers automatic control of longitudinal dynamics during the landing phase. The main task for the AWJSRA is to design an automatic landing system that captures and tracks a localizer beam. The control task for the AV-8A is to track velocity commands in a hovering flight configuration. Much effort was devoted to developing computer programs that are needed to carry out VSS design in a multivariable frame work, and in becoming familiar with the dynamics and control problems associated with the aircraft types under investigation. Numerous VSS design schemes were explored, particularly for the AWJSRA. The approaches that appear best suited for these aircraft types are presented. Examples are given of the numerical results currently being generated.
Assessment of small versus large hydro-power developments - a Norwegian case study
Energy Technology Data Exchange (ETDEWEB)
Bakken, Tor Haakon; Harby, Atle
2010-07-01
Full text: The era of new, large hydro-power development projects seems to be over in Norway. Partly as a response to this, a large number of applications for the development of smallscale hydro power projects up to 10 MW overflow the Water Resources and Energy Directorate, resulting in an extensive development of small tributaries and water courses in Norway. This study has developed a framework for the assessment and comparison of several small versus many large hydro-power projects based on a multi-criteria analysis (MCA) approach, and further tested this approach on planned or developed projects in the Helgeland region, Norway. Multi-criteria analysis is a decision-support tool aimed at providing a systematic approach for the comparison of various alternatives with often non-commensurable and conflicting attributes. At the same time, the technique enables complex problems and various alternatives to be assessed in a transparent and simple way. The MCA-software was in our case equipped with 2 overall criteria (objectives) with a number of sub criteria; Production with sub-criteria like volume of energy production, installed effect, storage capacity and economical profit; Environmental impacts with sub-criteria like fishing interests, biodiversity, protection of unexploited nature The data used in the case study is based on the planned development of Vefsna (large project) with the energy/effect production estimated and the environmental impacts identified as part of the feasibility studies (the project never reached the authorities' licensing system with a formal EIA). The small-scale hydro-power projects used for comparison are based on realized projects in the Helgeland region and a number of proposed projects, up scaled to the size of the proposed Vefsna-development. The results from the study indicate that a large number of small-scale hydro-power projects need to be implemented in order to balance the volume of produced electricity/effect from one
Development of concept and neutronic calculation method for large LMFBR core
International Nuclear Information System (INIS)
Shirakata, K.; Ishikawa, M.; Ikegami, T.; Sanda, T.; Kaneto, K.; Kawashima, M.; Kaise, Y.; Shirakawa, M.; Hibi, K.
1991-01-01
Presented in this paper is the state of the art of reactor physics R and Ds for the development of concept and neutronic calculation method for large Liquid Metal Fast Breeder Reactor (LMFBR) core. Physics characteristics of concepts for mixed oxide (MOX) fueled large FBR core were investigated by a series of benchmark critical experiments. Next, an adequacy and accuracy of the current neutronic calculation method was assessed by the experiments analyses, and then neutronic prediction accuracies by the method were evaluated for physics characteristics of the large core. Concerns on core development were discussed in terms of neutronics. (author)
Association between vestibular schwannomas and mobile phone use
Moon, In Seok; Kim, Bo Gyung; Kim, Jinna; Lee, Jong Dae; Lee, Won-Sang
2013-01-01
Vestibular schwannomas (VSs) grow in the region where the energy from mobile phone use is absorbed. We examined the associations of VSs with mobile phone use. This study included 119 patients who had undergone surgical tumor removal. We used two approaches in this investigation. First, a case–control study for the association of mobile phone use and incidence of VSs was conducted. Both cases and controls were investigated with questions based on INTERPHONE guidelines. Amount of mobile phone u...
Additively Manufactured Ceramic Rocket Engine Components
National Aeronautics and Space Administration — HRL Laboratories, LLC, with Vector Space Systems (VSS) as subcontractor, has a 24-month effort to develop additive manufacturing technology for reinforced ceramic...
The effects of fatigue on robotic surgical skill training in Urology residents.
Mark, James R; Kelly, Douglas C; Trabulsi, Edouard J; Shenot, Patrick J; Lallas, Costas D
2014-09-01
This study reports on the effect of fatigue on Urology residents using the daVinci surgical skills simulator (dVSS). Seven Urology residents performed a series of selected exercises on the dVSS while pre-call and post-call. Prior to dVSS performance a survey of subjective fatigue was taken and residents were tested with the Epworth Sleepiness Scale (ESS). Using the metrics available in the dVSS software, the performance of each resident was evaluated. The Urology residents slept an average of 4.07 h (range 2.5-6 h) while on call compared to an average of 5.43 h while not on call (range 3-7 h, p = 0.08). Post-call residents were significantly more likely to be identified as fatigued by the Epworth Sleepiness Score than pre-call residents (p = 0.01). Significant differences were observed in fatigued residents performing the exercises, Tubes and Match Board 2 (p = 0.05, 0.02). Additionally, there were significant differences in the total number of critical errors during the training session (9.29 vs. 3.14, p = 0.04). Fatigue in post-call Urology residents leads to poorer performance on the dVSS simulator. The dVSS may become a useful instrument in the education of fatigued residents and a tool to identify fatigue in trainees.
Developing A Large-Scale, Collaborative, Productive Geoscience Education Network
Manduca, C. A.; Bralower, T. J.; Egger, A. E.; Fox, S.; Ledley, T. S.; Macdonald, H.; Mcconnell, D. A.; Mogk, D. W.; Tewksbury, B. J.
2012-12-01
Over the past 15 years, the geoscience education community has grown substantially and developed broad and deep capacity for collaboration and dissemination of ideas. While this community is best viewed as emergent from complex interactions among changing educational needs and opportunities, we highlight the role of several large projects in the development of a network within this community. In the 1990s, three NSF projects came together to build a robust web infrastructure to support the production and dissemination of on-line resources: On The Cutting Edge (OTCE), Earth Exploration Toolbook, and Starting Point: Teaching Introductory Geoscience. Along with the contemporaneous Digital Library for Earth System Education, these projects engaged geoscience educators nationwide in exploring professional development experiences that produced lasting on-line resources, collaborative authoring of resources, and models for web-based support for geoscience teaching. As a result, a culture developed in the 2000s in which geoscience educators anticipated that resources for geoscience teaching would be shared broadly and that collaborative authoring would be productive and engaging. By this time, a diverse set of examples demonstrated the power of the web infrastructure in supporting collaboration, dissemination and professional development . Building on this foundation, more recent work has expanded both the size of the network and the scope of its work. Many large research projects initiated collaborations to disseminate resources supporting educational use of their data. Research results from the rapidly expanding geoscience education research community were integrated into the Pedagogies in Action website and OTCE. Projects engaged faculty across the nation in large-scale data collection and educational research. The Climate Literacy and Energy Awareness Network and OTCE engaged community members in reviewing the expanding body of on-line resources. Building Strong
Pro website development and operations streamlining DevOps for large-scale websites
Sacks, Matthew
2012-01-01
Pro Website Development and Operations gives you the experience you need to create and operate a large-scale production website. Large-scale websites have their own unique set of problems regarding their design-problems that can get worse when agile methodologies are adopted for rapid results. Managing large-scale websites, deploying applications, and ensuring they are performing well often requires a full scale team involving the development and operations sides of the company-two departments that don't always see eye to eye. When departments struggle with each other, it adds unnecessary comp
Guiquan, Xi; Lin, Cong; Xuehui, Jin
2018-05-01
As an important platform for scientific and technological development, large -scale scientific facilities are the cornerstone of technological innovation and a guarantee for economic and social development. Researching management of large-scale scientific facilities can play a key role in scientific research, sociology and key national strategy. This paper reviews the characteristics of large-scale scientific facilities, and summarizes development status of China's large-scale scientific facilities. At last, the construction, management, operation and evaluation of large-scale scientific facilities is analyzed from the perspective of sustainable development.
Development of high purity large forgings for nuclear power plants
International Nuclear Information System (INIS)
Tanaka, Yasuhiko; Sato, Ikuo
2011-01-01
The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.
Development of high purity large forgings for nuclear power plants
Tanaka, Yasuhiko; Sato, Ikuo
2011-10-01
The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.
Quantitative measurement of hypertrophic scar: interrater reliability and concurrent validity.
Nedelec, Bernadette; Correa, José A; Rachelska, Grazyna; Armour, Alexis; LaSalle, Léo
2008-01-01
Research into the pathophysiology and treatment of hypertrophic scar (HSc) remains limited by the heterogeneity of scar and the imprecision with which its severity is measured. The objective of this study was to test the interrater reliability and concurrent validity of the Cutometer measurement of elasticity, the Mexameter measurement of erythema and pigmentation, and total thickness measure of the DermaScan C relative to the modified Vancouver Scar Scale (mVSS) in patient-matched normal skin, normal scar, and HSc. Three independent investigators evaluated 128 sites (severe HSc, moderate or mild HSc, donor site, and normal skin) on 32 burn survivors using all of the above measurement tools. The intraclass correlation coefficient, which was used to measure interrater reliability, reflects the inherent amount of error in the measure and is considered acceptable when it is >0.75. Interrater reliability of the totals of the height, pliability, and vascularity subscales of the mVSS fell below the acceptable limit ( congruent with0.50). The individual subscales of the mVSS fell well below the acceptable level (0.89) for each study site with the exception of severe scar. Mexameter and DermaScan C reliability measurements were acceptable for all sites (>0.82). Concurrent validity correlations with the mVSS were significant except for the comparison of the mVSS pliability subscale and the Cutometer maximum deformation measure comparison in severe scar. In conclusion, the Mexameter and DermaScan C measurements of scar color and thickness of all sites, as well as the Cutometer measurement of elasticity in all but the most severe scars shows high interrater reliability. Their significant concurrent validity with the mVSS confirms that these tools are measuring the same traits as the mVSS, and in a more objective way.
Ghorbani, M; Eskicioglu, C
2011-12-01
Batch and semi-continuous flow aerobic digesters were used to stabilize thickened waste-activated sludge at different initial conditions and mean solids retention times. Under dynamic conditions, total suspended solids, volatile suspended solids (VSS) and total and particulate chemical oxygen demand (COD and PCOD) were monitored in the batch reactors and effluent from the semi-continuous flow reactors. Activated Sludge Model (ASM) no. 1 and ASM no. 3 were applied to measured data (calibration data set) to evaluate the consistency and performances of models at different flow regimes for digester COD and VSS modelling. The results indicated that both ASM1 and ASM3 predicted digester COD, VSS and PCOD concentrations well (R2, Ra2 > or = 0.93). Parameter estimation concluded that compared to ASM1, ASM3 parameters were more consistent across different batch and semi-continuous flow runs with different operating conditions. Model validation on a data set independent from the calibration data successfully predicted digester COD (R2 = 0.88) and VSS (R2 = 0.94) concentrations by ASM3, while ASM1 overestimated both reactor COD (R2 = 0.74) and VSS concentrations (R2 = 0.79) after 15 days of aerobic batch digestion.
Methods for the development of large computer codes under LTSS
International Nuclear Information System (INIS)
Sicilian, J.M.
1977-06-01
TRAC is a large computer code being developed by Group Q-6 for the analysis of the transient thermal hydraulic behavior of light-water nuclear reactors. A system designed to assist the development of TRAC is described. The system consists of a central HYDRA dataset, R6LIB, containing files used in the development of TRAC, and a file maintenance program, HORSE, which facilitates the use of this dataset
Human behaviour can trigger large carnivore attacks in developed countries.
Penteriani, Vincenzo; Delgado, María del Mar; Pinchera, Francesco; Naves, Javier; Fernández-Gil, Alberto; Kojola, Ilpo; Härkönen, Sauli; Norberg, Harri; Frank, Jens; Fedriani, José María; Sahlén, Veronica; Støen, Ole-Gunnar; Swenson, Jon E; Wabakken, Petter; Pellegrini, Mario; Herrero, Stephen; López-Bao, José Vicente
2016-02-03
The media and scientific literature are increasingly reporting an escalation of large carnivore attacks on humans in North America and Europe. Although rare compared to human fatalities by other wildlife, the media often overplay large carnivore attacks on humans, causing increased fear and negative attitudes towards coexisting with and conserving these species. Although large carnivore populations are generally increasing in developed countries, increased numbers are not solely responsible for the observed rise in the number of attacks by large carnivores. Here we show that an increasing number of people are involved in outdoor activities and, when doing so, some people engage in risk-enhancing behaviour that can increase the probability of a risky encounter and a potential attack. About half of the well-documented reported attacks have involved risk-enhancing human behaviours, the most common of which is leaving children unattended. Our study provides unique insight into the causes, and as a result the prevention, of large carnivore attacks on people. Prevention and information that can encourage appropriate human behaviour when sharing the landscape with large carnivores are of paramount importance to reduce both potentially fatal human-carnivore encounters and their consequences to large carnivores.
REQUIREMENTS FOR SYSTEMS DEVELOPMENT LIFE CYCLE MODELS FOR LARGE-SCALE DEFENSE SYSTEMS
Directory of Open Access Journals (Sweden)
Kadir Alpaslan DEMIR
2015-10-01
Full Text Available TLarge-scale defense system projects are strategic for maintaining and increasing the national defense capability. Therefore, governments spend billions of dollars in the acquisition and development of large-scale defense systems. The scale of defense systems is always increasing and the costs to build them are skyrocketing. Today, defense systems are software intensive and they are either a system of systems or a part of it. Historically, the project performances observed in the development of these systems have been signifi cantly poor when compared to other types of projects. It is obvious that the currently used systems development life cycle models are insuffi cient to address today’s challenges of building these systems. Using a systems development life cycle model that is specifi cally designed for largescale defense system developments and is effective in dealing with today’s and near-future challenges will help to improve project performances. The fi rst step in the development a large-scale defense systems development life cycle model is the identifi cation of requirements for such a model. This paper contributes to the body of literature in the fi eld by providing a set of requirements for system development life cycle models for large-scale defense systems. Furthermore, a research agenda is proposed.
Borg, Charmaine; de Jong, Peter J.; Georgiadis, Janniko R.
Lifetime experiences shape people's attitudes toward sexual stimuli. Visual sexual stimulation (VSS), for instance, may be perceived as pleasurable by some, but as disgusting or ambiguous by others. VSS depicting explicit penile-vaginal penetration (PEN) is relevant in this respect, because the act
Development of cryogenic installations for large liquid argon neutrino detectors
Adamowski, M; Geynisman, M; Hentschel, S; Montanari, D; Nessi, M; Norris, B
2015-01-01
A proposal for a very large liquid argon (68,000 kg) based neutrino detector is being studied. To validate the design principles and the detector technology, and to gain experience in the development of the cryostats and the cryogenic systems needed for such large experiments, several smaller scale installations will be developed and implemented, at Fermilab and CERN. The cryogenic systems for these installations will be developed, constructed, installed and commissioned by an international engineering team. These installations shall bring the required cooling power under specific conditions to the experiments for the initial cool-down and the long term operation, and shall also guarantee the correct distribution of the cooling power within the cryostats to ensure a homogeneous temperature distribution within the cryostat itself. The cryogenic systems shall also include gaseous and liquid phase argon purification devices to be used to reach and maintain the very stringent purity requirements needed for these...
International Nuclear Information System (INIS)
1994-01-01
In the last several years, the results of tokamak experiments were conspicuous, and the progress of plasma confinement performance, transport mechanism, divertors and impurities, helium transport and exhaust, electric current drive, magnetic field ripple effect and high speed particle transport and DT experiment are reported. The other confinement methods than tokamak, the related theories and reactor technology are described. The conceptual design of ITER was carried out by the cooperation of Japan, USA, EC and the former USSR. The projects of developing nuclear fusion in various countries, the design and the required research and development of ITER, the reconstruction and the required research and development of JT-60, JET and TFTR, the design and the required research and development of large helical device, the state of research and development of laser nuclear fusion and inversion magnetic field pinch nuclear fusion, the activities and roles of industrial circles in large nuclear fusion device technology, and the long term perspective of the technical development of nuclear fusion are described. (K.I.)
Trends in Large Proposal Development at Major Research Institutions
Mulfinger, Lorraine M.; Dressler, Kevin A.; James, L. Eric; Page, Niki; Serrano, Eduardo; Vazquez, Jorge
2016-01-01
Research administrator interest in large research proposal development and submission support is high, arguably in response to the bleak funding landscape for research and federal agency trends toward making more frequent larger awards. In response, a team from Penn State University and Huron Consulting Group initiated a baseline study to…
Development of superconducting poloidal field coils for medium and large size tokamaks
International Nuclear Information System (INIS)
Dittrich, H.-G.; Forster, S.; Hofmann, A.
1983-01-01
Large long pulse tokamak fusion experiments require the use of superconducting poloidal field (PF) coils. In the past not much attention has been paid to the development of such coils. Therefore a development programme has been initiated recently at KfK. In this report start with summarizing the relevant PF coil parameters of some medium and large size tokamaks presently under construction or design, respectively. The most important areas of research and development work are deduced from these parameters. Design considerations and first experimental results concerning low loss conductors, cooling concepts and structural components are given
Development of automated analytical systems for large throughput
International Nuclear Information System (INIS)
Ernst, P.C.; Hoffman, E.L.
1982-01-01
The need to be able to handle a large throughput of samples for neutron activation analysis has led to the development of automated counting and sample handling systems. These are coupled with available computer-assisted INAA techniques to perform a wide range of analytical services on a commercial basis. A fully automated delayed neutron counting system and a computer controlled pneumatic transfer for INAA use are described, as is a multi-detector gamma-spectroscopy system. (author)
Development of high performance core for large fast breeder reactors
International Nuclear Information System (INIS)
Inoue, Kotaro; Kawashima, Katsuyuki; Watari, Yoshio.
1982-01-01
Subsequently to the fast breeder prototype reactor ''Monju'', the construction of a demonstration reactor with 1000 MWe output is planned. This research aims at the establishment of the concept of a large core with excellent fuel breeding property and safety for a demonstration and commercial reactors. For the purpose, the optimum specification of fuel design as a large core was clarified, and the new construction of a core was examined, in which a disk-shaped blanket with thin peripheral edge is introduced at the center of a core. As the result, such prospect was obtained that the time for fuel doubling would be 1/2, and the energy generated in a core collapse accident would be about 1/5 as compared with a large core using the same fuel as ''Monju''. Generally, as a core is enlarged, the rate of breeding lowers. If a worst core collapse accident occurs, the scale of accident will be very large in the case of a ''Monju'' type large core. In an unhomogeneous core, an internal blanket is provided in the core for the purpose of improving the breeding property and safety. Hitachi Ltd. developed the concept of a large core unhomogeneous in axial direction and proposed it. The research on the fuel design for a large core, an unhomogeneous core and its core collapse accident is reported. (Kako, I.)
Hernandez, J E; Bachmann, R T; Edyvean, R G J
2006-01-01
The measurement of biomass concentration is important in biological wastewater treatment. This paper compares the accuracy and costs of the traditional volatile suspended solids (VSS) and the proposed suspended organic carbon (SOC) methods. VSS and SOC values of a dilution system were very well correlated (R(2)=0.9995). VSS and SOC of 16 samples were determined, the mean SOC/VSS ratio (0.52, n=16, sigma=0.01) was close to the theoretical value (0.53). For costing analysis, two hypothetical cases were analysed. In case A, it is assumed that 108 samples are analysed annually from two continuous reactors. Case B represents a batch experiment to be carried out in 24 incubated serum bottles. The savings, when using the SOC method, were 11,987 pounds for case A and 90 pounds for case B. This study suggests the use of SOC method as a time saving and lower cost biomass concentration measurement.
International Nuclear Information System (INIS)
Rawlings, G.W.
1985-01-01
The object of this research was to develop a large circular saw, capable of cutting away, by remote control, the inner radio-activated layer of reinforced concrete biological shields or pre-stressed concrete pressure vessel of gas-cooled reactors. Initial investigations and enquiries put to the existing saw industry established although there were blades in use approaching the size and type required, the development of large machines was restricted to the fixed-bed type because there was little demand for deep sawing in the construction or demolition industry. Preliminary work was carried out in 1981 to demonstrate the largest available wall saw at that time which showed that by changing the blade three times, a kerf 810 mm deep could be achieved. From this demonstration, the design and development of a 'free frame saw' and construction of a 660 mm blade as well as a 2500 mm blade, were performed. Initially, the 660 mm blade was used to cut the concrete and reinforcement, followed by the 2500 mm blade to produce a 1 m kerf. Subsequent development and testing demonstrated that the 2500 mm blade could be controlled to ''plunge cut'', that is to cut straight down in the reinforced concrete to a depth of 1 m in 7 minutes and would then advance at 160 mm/min; this is a work rate of 10 m 2 /hr. The final demonstration was to mount the saw on an extendible boom and remove a 1 m 3 block of reinforced concrete from the vertical face of a test wall
Indigenously developed large pumping speed cryoadsorption cryopump
International Nuclear Information System (INIS)
Gangradey, Ranjana; Mukherjee, Samiran Shanti; Agarwal, Jyoti
2015-01-01
Indigenous cryoadsorption cryopump with large pumping speeds for fusion reactor application has been developed at the Institute for Plasma Research (IPR). Towards its successful realization, technological bottlenecks were identified, studied and resolved. Hydroformed cryopanels were developed from concept leading to the design and product realization with successful technology transfer to the industry. This has led to the expertise for developing hydroformed panels for any desired shape, geometry and welding pattern. Activated sorbents were developed, characterized using an experimental set up which measures adsorption isotherms down to 4K for hydrogen and helium. Special techniques were evolved for coating sorbents on hydroformed cryopanels with suitable cryo-adhesives. Various arrangements of cryopanels at 4 K surrounded by 80 K shields and baffles (which are also hydroformed) were studied and optimized by transmission probability analysis using Monte Carlo techniques. CFD analysis was used to study the temperature distribution and flow analysis during the cryogen flow through the panels. Integration of the developed technologies to arrive at the final product was a challenging task and this was meticulously planned and executed. This resulted in a cryoadsorption cryopump offering pumping speeds as high as 50,000 to 70,000 1/s for helium and 1,50,000 1/s for hydrogen with a 3.2 m 2 of sorbent panel area. The first laboratory scale pump integrating the developed technologies was a Small Scale CryoPump (SSCP-01) with a pumping speed of 2,000 1/s for helium. Subsequently, Single Panel CryoPump (SPCP-01) with pumping speed 10,000 1/s for helium and a Multiple Panel CryoPump (MPCP-08) with a pumping speed of 70,000 1/s for helium and 1,50,000 1/s for hydrogen respectively were developed. This paper describes the efforts in realizing these products from laboratory to industrial scales. (author)
Development of large insulator rings for the TOKAMAK Fusion Test Reactor
International Nuclear Information System (INIS)
Brown, T.; Tobin, A.
1977-01-01
Research and development leading to the manufacture of large ceramic insulator rings for the TFTR (TOKAMAK Fusion Test Reactor). Material applictions, fabrication approach and testing activities are highlighted
Watanabe, Nobuyuki; Ishii, Takuya; Fujitsu, Kazuhiko; Kaku, Shogo; Ichikawa, Teruo; Miyahara, Kosuke; Okada, Tomu; Tanino, Shin; Uriu, Yasuhiro; Murayama, Yuichi
2018-05-18
OBJECTIVE The authors describe the usefulness and limitations of the cochlear nerve compound action potential (CNAP) mobile tracer (MCT) that they developed to aid in cochlear nerve mapping during vestibular schwannoma surgery (VSS) for hearing preservation. METHODS This MCT device requires no more than 2 seconds for stable placement on the nerve to obtain the CNAP and thus is able to trace the cochlear nerve instantaneously. Simultaneous bipolar and monopolar recording is possible. The authors present the outcomes of 18 consecutive patients who underwent preoperative useful hearing (defined as class I or II of the Gardner-Robertson classification system) and underwent hearing-preservation VSS with the use of the MCT. Mapping was considered successful when it was possible to detect and trace the cochlear nerve. RESULTS Mapping of the cochlear nerve was successful in 13 of 18 patients (72.2%), and useful hearing was preserved in 11 patients (61.1%). Among 8 patients with large tumors (Koos grade 3 or 4), the rate of successful mapping was 62.5% (5 patients). The rate of hearing preservation in patients with large tumors was 50% (4 patients). CONCLUSIONS In addition to microsurgical presumption of the arrangement of each nerve, frequent probing on and around an unidentified nerve and comparison of each waveform are advisable with the use of both more sensitive monopolar and more location-specific bipolar MCT. MCT proved to be useful in cochlear nerve mapping and may consequently be helpful in hearing preservation. The authors discuss some limitations and problems with this device.
Production from Activated Sludge Process of Sago Industry Wastewater Using Central Composite Design
Directory of Open Access Journals (Sweden)
B. Subha
2012-01-01
Full Text Available Sago industries effluent containing large amounts of organic content produced excess sludge which is a serious problem in wastewater treatment. In this study ozonation has been employed for the reduction of excess sludge production in activated sludge process. Central composite design is used to study the effect of ozone treatment for the reduction of excess sludge production in sago effluent and to optimise the variables such as pH, ozonation time, and retention time. ANOVA showed that the coefficient determination value (R2 of VSS and COD reduction were 0.9689 and 0.8838, respectively. VSS reduction (81% was achieved at acidic pH 6.9, 12 minutes ozonation, and retention time of 10 days. COD reduction (87% was achieved at acidic pH 6.7, 8 minutes of ozonation time, and retention time of 6 days. Low ozonation time and high retention time influence maximum sludge reduction, whereas low ozonation time with low retention time was effective for COD reduction.
Large Dam Development: From Trojan Horse to Pandora’s Box
Ahlers, R.; Zwarteveen, M.; Bakker, K.; Flyvbjerg, B.
This chapter argues that there are important distinctions between large dam development in the twentieth century and the twenty-first century by conceptually framing dams not as mere objects in space but also as agents in dynamic and contested spatial strategies. This is illustrated by two examples:
Development of large insulator rings for the Tokamak Fusion Test Reactor
International Nuclear Information System (INIS)
Brown, T.; Tobin, A.
1978-01-01
This paper discusses research and development leading to the manufacture of large ceramic insulator rings for the TFTR (TOKAMAK Fusion Test Reactor). Material applications, fabrication approach and testing activities are highlighted
Development and performance of a calibration system for a large calorimeter array
International Nuclear Information System (INIS)
Arenton, M.; Dawson, J.; Ditzler, W.R.
1982-01-01
Experiment 609 at Fermilab is a study of the properties of high-p/sub t/ collisions using a large segmented hadron calorimeter. The calibration and monitoring of such a large calorimeter array is a difficult undertaking. This paper describes the systems developed by E609 for automatic monitoring of the phototube gains and performance of the associated electronics
UASB reactor start up in real scale for malting effluent
International Nuclear Information System (INIS)
Lopez, I.; Passeggi, M.; Boix, C.; Barcia, R.; Borzacconi, L.; Liebermann, L.
2005-01-01
An Imhoff tank was reconstructed into a 250 m3 UASB reactor in order to treat a malting plant wastewater.The UASB was inoculated with sludge from an anaerobic lagoon used for slaughterhouse wastewater treatment.The fat present in the inoculated sludge did not affect the start up performance. After two month of operation the reactor achieved full load with COD removal higher than 80% and a biogas production of 300 m3/day. The mean diameter of granules was 0a.milimeters and the Specific Methanogenic Activity was 0.25 g COD/gVSS.d The banquet development throughout time (solids concentrations at different heights, granule size, methanogenic activity) was monitored. A yield coefficient of 0.09 gVSS/g COD rem was found
Directory of Open Access Journals (Sweden)
Delić Adisa
2016-12-01
Full Text Available Modern companies’ business environments have become increasingly complex, dynamic, and uncertain as a consequence of globalization and the rapid development of information communications technology. Companies are urged to increase their flexibility in order to keep their competitiveness in the global market. The affirmation of intrapreneurship becomes one of the basic ways for achieving higher adaptability and competitiveness of large companies in the modern business environment. In this context, the choice of an organizational solution that improves the development of entrepreneurial orientation and increases employee entrepreneurship and innovativeness becomes an important task for large companies. Research studies and business practices have indicated that various types of modern organizational forms enable the development of intrapreneurship. Therefore, the main aim of this paper is to identify dominant characteristics of organizational solutions and analyse their influence on the development of intrapreneurship in large companies in Bosnia and Herzegovina (BiH. The research results indicate that current organizational characteristics are not favourable for the development of intrapreneurship in large BiH companies and that improvement is necessary in order to create an enabling environment for intrapreneurship and innovativeness. Based on these findings, recommendations for appropriate organizational changes are presented that might result in a more intensive development of intrapreneurship in large BiH companies.
Development of very large helicon plasma source
International Nuclear Information System (INIS)
Shinohara, Shunjiro; Tanikawa, Takao
2004-01-01
We have developed a very large volume, high-density helicon plasma source, 75 cm in diameter and 486 cm in axial length; full width at half maximum of the plasma density is up to ∼42 cm with good plasma uniformity along the z axis. By the use of a spiral antenna located just outside the end of the vacuum chamber through a quartz-glass window, plasma can be initiated with a very low value of radio frequency (rf) power ( 12 cm -3 is successfully produced with less than several hundred Watt; achieving excellent discharge efficiency. It is possible to control the radial density profile in this device by changing the magnetic field configurations near the antenna and/or the antenna radiation-field patterns
The cognitive dynamics of computer science cost-effective large scale software development
De Gyurky, Szabolcs Michael; John Wiley & Sons
2006-01-01
This book has three major objectives: To propose an ontology for computer software; To provide a methodology for development of large software systems to cost and schedule that is based on the ontology; To offer an alternative vision regarding the development of truly autonomous systems.
PAVS: A New Privacy-Preserving Data Aggregation Scheme for Vehicle Sensing Systems.
Xu, Chang; Lu, Rongxing; Wang, Huaxiong; Zhu, Liehuang; Huang, Cheng
2017-03-03
Air pollution has become one of the most pressing environmental issues in recent years. According to a World Health Organization (WHO) report, air pollution has led to the deaths of millions of people worldwide. Accordingly, expensive and complex air-monitoring instruments have been exploited to measure air pollution. Comparatively, a vehicle sensing system (VSS), as it can be effectively used for many purposes and can bring huge financial benefits in reducing high maintenance and repair costs, has received considerable attention. However, the privacy issues of VSS including vehicles' location privacy have not been well addressed. Therefore, in this paper, we propose a new privacy-preserving data aggregation scheme, called PAVS, for VSS. Specifically, PAVS combines privacy-preserving classification and privacy-preserving statistics on both the mean E(·) and variance Var(·), which makes VSS more promising, as, with minimal privacy leakage, more vehicles are willing to participate in sensing. Detailed analysis shows that the proposed PAVS can achieve the properties of privacy preservation, data accuracy and scalability. In addition, the performance evaluations via extensive simulations also demonstrate its efficiency.
Large animal models for vaccine development and testing.
Gerdts, Volker; Wilson, Heather L; Meurens, Francois; van Drunen Littel-van den Hurk, Sylvia; Wilson, Don; Walker, Stewart; Wheler, Colette; Townsend, Hugh; Potter, Andrew A
2015-01-01
The development of human vaccines continues to rely on the use of animals for research. Regulatory authorities require novel vaccine candidates to undergo preclinical assessment in animal models before being permitted to enter the clinical phase in human subjects. Substantial progress has been made in recent years in reducing and replacing the number of animals used for preclinical vaccine research through the use of bioinformatics and computational biology to design new vaccine candidates. However, the ultimate goal of a new vaccine is to instruct the immune system to elicit an effective immune response against the pathogen of interest, and no alternatives to live animal use currently exist for evaluation of this response. Studies identifying the mechanisms of immune protection; determining the optimal route and formulation of vaccines; establishing the duration and onset of immunity, as well as the safety and efficacy of new vaccines, must be performed in a living system. Importantly, no single animal model provides all the information required for advancing a new vaccine through the preclinical stage, and research over the last two decades has highlighted that large animals more accurately predict vaccine outcome in humans than do other models. Here we review the advantages and disadvantages of large animal models for human vaccine development and demonstrate that much of the success in bringing a new vaccine to market depends on choosing the most appropriate animal model for preclinical testing. © The Author 2015. Published by Oxford University Press on behalf of the Institute for Laboratory Animal Research. All rights reserved. For permissions, please email: journals.permissions@oup.com.
A modified method to determine biomass concentration as COD in ...
African Journals Online (AJOL)
drinie
2002-10-04
Oct 4, 2002 ... A modification of the standard VSS technique was also proposed using two membranes in the filtration device; this technique allowed the biomass determination in 1 μm size bacteria cultures that cannot be detected by the standard VSS method because cells are not retained by the 1.5 μm diameter pore ...
PETA KENDALI X DENGAN UKURAN SAMPEL DAN INTERVAL PENGAMBILAN SAMPEL YANG BERVARIASI
Directory of Open Access Journals (Sweden)
Tanti Octavia
2000-01-01
Full Text Available Shewhart X chart is widely used in statistical process control for monitoring variable data and has shown good performance in detecting large mean shift but less sensitive in detecting moderate to small process shift. X chart with variable sample size and sampling interval (VSSI X chart is proposed to enhance the ability of detecting moderate to small process shift. The performance of VSSI X chart is compared with those of Shewhart X chart, VSS X chart (Variable Sample Size X chart and VSI X chart (Variable Sampling Interval X chart. Performance of these control charts is presented in the form of ATS (Average Time to Signal which is obtained from computer simulation and markov chain approach. The VSSI X chart shows better performance in detecting moderate mean shift. The simulation is then continued for VSSI X chart and VSS X chart with minimum sample size n 1=1 and n 1=2. Abstract in Bahasa Indonesia : Peta kendali X Shewhart telah umum digunakan dalam pengendalian proses statistis untuk data variabel dan terbukti berfungsi dengan baik untuk mendeteksi pergeseran rerata yang besar, namun kurang cepat dalam mendeteksi pergeseran rerata yang sedang hingga kecil. Untuk mengatasi kelemahan ini, diusulkan penggunaan peta kendali X dengan ukuran sampel dan interval pengambilan sampel yang bervariasi (peta kendali VSSI. Kinerja peta kendali X VSSI dibandingkan dengan kinerja peta kendali Shewhart, peta kendali X VSS (peta kendali X dengan ukuran sampel yang bervariasi, dan peta kendali X VSI (peta kendali X dengan interval waktu pengambilan sampel yang bervariasi. Kinerja peta kendali dinyatakan dalam nilai ATS (Average Time to Signal yang didapatkan dari hasil simulasi program komputer maupun perhitungan Rantai Markov. Peta kendali X VSSI terbukti mempunyai kinerja yang lebih baik dalam mendeteksi pergeseran rerata yang sedang. Selain itu juga disimulasikan penggunaan peta kendali X VSSI dan peta kendali X VSS dengan ukuran sampel minimum n1=1 dan n1
Large rotorcraft transmission technology development program
Mack, J. C.
1983-01-01
Testing of a U.S. Army XCH-62 HLH aft rotor transmission under NASA Contract NAS 3-22143 was successfully completed. This test establishes the feasibility of large, high power rotorcraft transmissions as well as demonstrating the resolution of deficiencies identified during the HLH advanced technology programs and reported by USAAMRDLTR-77-38. Over 100 hours of testing was conducted. At the 100% design power rating of 10,620 horsepower, the power transferred through a single spiral bevel gear mesh is more than twice that of current helicopter bevel gearing. In the original design of these gears, industry-wide design methods were employed and failures were experienced which identified problem areas unique to gear size. To remedy this technology shortfall, a program was developed to predict gear stresses using finite element analysis for complete and accurate representation of the gear tooth and supporting structure. To validate the finite element methodology gear strain data from the existing U.S. Army HLH aft transmission was acquired, and existing data from smaller gears were made available.
The development of asymmetric trust in cooperation between large firms and SMEs: Insights from China
Wang, H.; Peverelli, P.J.; Bossink, B.A.G.
2015-01-01
This paper describes how asymmetric trust develops and changes in time in cooperative relationships between large enterprises and SMEs in China. A model is developed on the basis of in-depth case studies of cooperation between six SMEs and five large firms in China. The data sources reveal how
Developing high coercivity in large diameter cobalt nanowire arrays
Montazer, A. H.; Ramazani, A.; Almasi Kashi, M.; Zavašnik, J.
2016-11-01
Regardless of the synthetic method, developing high magnetic coercivity in ferromagnetic nanowires (NWs) with large diameters has been a challenge over the past two decades. Here, we report on the synthesis of highly coercive cobalt NW arrays with diameters of 65 and 80 nm, which are embedded in porous anodic alumina templates with high-aspect-ratio pores. Using a modified electrochemical deposition method enabled us to reach room temperature coercivity and remanent ratio up to 3000 Oe and 0.70, respectively, for highly crystalline as-synthesized hcp cobalt NW arrays with a length of 8 μm. The first-order reversal curve (FORC) analysis showed the presence of both soft and hard magnetic phases along the length of the resulting NWs. To develop higher coercive fields, the length of the NWs was then gradually reduced in order from bottom to top, thereby reaching NW sections governed by the hard phase. Consequently, this resulted in record high coercivities of 4200 and 3850 Oe at NW diameters of 65 and 80 nm, respectively. In this case, the FORC diagrams confirmed a significant reduction in interactions between the magnetic phases of the remaining sections of NWs. At this stage, x-ray diffraction (XRD) and dark-field transmission electron microscopy analyses indicated the formation of highly crystalline bamboo-like sections along the [0 0 2] direction during a progressive pulse-controlled electrochemical growth of NW arrays under optimized parameters. Our results both provide new insights into the growth process, crystalline characteristics and magnetic phases along the length of large diameter NW arrays and, furthermore, develop the performance of pure 3d transition magnetic NWs.
Status of large scale wind turbine technology development abroad?
Institute of Scientific and Technical Information of China (English)
Ye LI; Lei DUAN
2016-01-01
To facilitate the large scale (multi-megawatt) wind turbine development in China, the foreign e?orts and achievements in the area are reviewed and summarized. Not only the popular horizontal axis wind turbines on-land but also the o?shore wind turbines, vertical axis wind turbines, airborne wind turbines, and shroud wind turbines are discussed. The purpose of this review is to provide a comprehensive comment and assessment about the basic work principle, economic aspects, and environmental impacts of turbines.
Development of large size NC trepanning and horning machine
International Nuclear Information System (INIS)
Wada, Yoshiei; Aono, Fumiaki; Siga, Toshihiko; Sudo, Eiichi; Takasa, Seiju; Fukuyama, Masaaki; Sibukawa, Koichi; Nakagawa, Hirokatu
2010-01-01
Due to the recent increase in world energy demand, construction of considerable number of nuclear and fossil power plant has been proceeded and is further planned. High generating capacity plant requires large forged components such as monoblock turbine rotor shafts and the dimensions of them tend to increase. Some of these components have center bore for material test, NDE and other use. In order to cope with the increase in production of these large forgings with center bores, a new trepanning machine, which exclusively bore a deep hole, was developed in JSW taking account of many accumulated experiences and know-how of experts. The machine is the world largest 400t trepanning and horning machine with numerical control and has many advantage in safety, the machining precision, machining efficiency, operability, labor-saving, and energy saving. Furthermore, transfer of the technical skill became easy through concentrated monitoring system based on numerically analysed experts' know-how. (author)
THE DEVELOPMENT OF SERVICES IN THE FIELD OF SOCIAL WORK WITH LARGE FAMILIES
Directory of Open Access Journals (Sweden)
Юлія Ібрагім
2015-09-01
Full Text Available The development of social services in the field of social work with large families is analyzed and their basic functions are defined in the article. The necessity of implementation of the system of guaranteed social and educational support to families depending on the type of large families, which would be provided by governmental and nongovernmental organizations, including public organizations are considered and analyzed. The statistical data on the number and proportion of large families in Ukraine in general and namely in Kharkiv region are provided. The principle of subsidiarity, which is the basis of the full development of the state and is based on the redistribution of responsibility for the formation of family welfare from the state to the family, and receipt of primary social and pedagogical support of public organizations in case you are unable to solve certain problems is disclosed. The article also presents practical experience in providing social and educational support by public organization Association of large families “AMMA”” in Kharkiv.
Combined thermo-chemo-sonic disintegration of waste activated sludge for biogas production.
Kavitha, S; Yukesh Kannah, R; Yeom, Ick Tae; Do, Khac-Uan; Banu, J Rajesh
2015-12-01
In the present study, there was an investigation about the impact of a new combined thermo-chemo-sonic disintegration of waste activated sludge (WAS) on biodegradability. The outcome of sludge disintegration reveals that maximum Suspended Solids (SS) reduction and Chemical Oxygen Demand (COD) solubilization effectuated at a specific energy input of 5290.5kJ/kgTS, and was found to be 20%, 16.4%, 15% and 27%, 22%, and 20%, respectively for the three alkalis (NaOH, KOH, and Ca(OH)2). The conversion coefficient of the Volatile Suspended Solids (VSS) to product Soluble COD (SCOD), calculated by nonlinear regression modeling, was found to be 0.5530gSCOD/gVSS, 0.4587gSCOD/gVSS, and 0.4195gSCOD/gVSS for NaOH, KOH, and Ca(OH)2, respectively. In the biodegradability studies, the parameter evaluation provides an estimate of parameter uncertainty and correlation, and elucidates that there is no significant difference in biodegradability (0.413gCOD/gCOD, 0.367gCOD/gCOD, and 0.342gCOD/gCOD) for three alkalis (NaOH, KOH, and Ca(OH)2). Copyright © 2015 Elsevier Ltd. All rights reserved.
Wang, Dongbo; Zhao, Jianwei; Zeng, Guangming; Chen, Yinguang; Bond, Philip L; Li, Xiaoming
2015-10-20
Recent studies demonstrate that, besides being used for production of biodegradable plastics, poly(hydroxyalkanoate) (PHA) that is accumulated in heterotrophic microorganisms during wastewater treatment has another novel application direction, i.e., being utilized for enhancing methane yield during the anaerobic digestion of waste-activated sludge (WAS). To date, however, the underlying mechanism of how PHA affects methane production remains largely unknown, and this limits optimization and application of the strategy. This study therefore aims to fill this knowledge gap. Experimental results showed that with the increase of sludge PHA levels from 21 to 184 mg/g of volatile suspended solids (VSS) the methane yield linearly increased from 168.0 to 246.1 mL/g of VSS (R(2) = 0.9834). Compared with protein and carbohydrate (the main components of a cell), PHA exhibited a higher biochemical methane potential on a unit VSS basis. It was also found that the increased PHA not only enhanced cell disruption of PHA cells but also benefited the soluble protein conversion of both PHA- and non-PHA cells. Moreover, the reactor fed with higher PHA sludge showed greater sludge hydrolysis and acidification than those fed with the lower PHA sludges. Further investigations using fluorescence in situ hybridization and enzyme analysis revealed that the increased PHA enhanced the abundance of methanogenic Archaea and increased the activities of protease, acetate kinase, and coenzyme F420, which were consistent with the observed methane yield. This work provides insights into PHA-involved WAS digestion systems and may have important implications for future operation of wastewater treatment plants.
Development of large-scale functional brain networks in children.
Directory of Open Access Journals (Sweden)
Kaustubh Supekar
2009-07-01
Full Text Available The ontogeny of large-scale functional organization of the human brain is not well understood. Here we use network analysis of intrinsic functional connectivity to characterize the organization of brain networks in 23 children (ages 7-9 y and 22 young-adults (ages 19-22 y. Comparison of network properties, including path-length, clustering-coefficient, hierarchy, and regional connectivity, revealed that although children and young-adults' brains have similar "small-world" organization at the global level, they differ significantly in hierarchical organization and interregional connectivity. We found that subcortical areas were more strongly connected with primary sensory, association, and paralimbic areas in children, whereas young-adults showed stronger cortico-cortical connectivity between paralimbic, limbic, and association areas. Further, combined analysis of functional connectivity with wiring distance measures derived from white-matter fiber tracking revealed that the development of large-scale brain networks is characterized by weakening of short-range functional connectivity and strengthening of long-range functional connectivity. Importantly, our findings show that the dynamic process of over-connectivity followed by pruning, which rewires connectivity at the neuronal level, also operates at the systems level, helping to reconfigure and rebalance subcortical and paralimbic connectivity in the developing brain. Our study demonstrates the usefulness of network analysis of brain connectivity to elucidate key principles underlying functional brain maturation, paving the way for novel studies of disrupted brain connectivity in neurodevelopmental disorders such as autism.
Development of large-scale functional brain networks in children.
Supekar, Kaustubh; Musen, Mark; Menon, Vinod
2009-07-01
The ontogeny of large-scale functional organization of the human brain is not well understood. Here we use network analysis of intrinsic functional connectivity to characterize the organization of brain networks in 23 children (ages 7-9 y) and 22 young-adults (ages 19-22 y). Comparison of network properties, including path-length, clustering-coefficient, hierarchy, and regional connectivity, revealed that although children and young-adults' brains have similar "small-world" organization at the global level, they differ significantly in hierarchical organization and interregional connectivity. We found that subcortical areas were more strongly connected with primary sensory, association, and paralimbic areas in children, whereas young-adults showed stronger cortico-cortical connectivity between paralimbic, limbic, and association areas. Further, combined analysis of functional connectivity with wiring distance measures derived from white-matter fiber tracking revealed that the development of large-scale brain networks is characterized by weakening of short-range functional connectivity and strengthening of long-range functional connectivity. Importantly, our findings show that the dynamic process of over-connectivity followed by pruning, which rewires connectivity at the neuronal level, also operates at the systems level, helping to reconfigure and rebalance subcortical and paralimbic connectivity in the developing brain. Our study demonstrates the usefulness of network analysis of brain connectivity to elucidate key principles underlying functional brain maturation, paving the way for novel studies of disrupted brain connectivity in neurodevelopmental disorders such as autism.
Policy Driven Development: Flexible Policy Insertion for Large Scale Systems.
Demchak, Barry; Krüger, Ingolf
2012-07-01
The success of a software system depends critically on how well it reflects and adapts to stakeholder requirements. Traditional development methods often frustrate stakeholders by creating long latencies between requirement articulation and system deployment, especially in large scale systems. One source of latency is the maintenance of policy decisions encoded directly into system workflows at development time, including those involving access control and feature set selection. We created the Policy Driven Development (PDD) methodology to address these development latencies by enabling the flexible injection of decision points into existing workflows at runtime , thus enabling policy composition that integrates requirements furnished by multiple, oblivious stakeholder groups. Using PDD, we designed and implemented a production cyberinfrastructure that demonstrates policy and workflow injection that quickly implements stakeholder requirements, including features not contemplated in the original system design. PDD provides a path to quickly and cost effectively evolve such applications over a long lifetime.
Can Large Scale Land Acquisition for Agro-Development in Indonesia be Managed Sustainably?
Obidzinski, K.; Takahashi, I.; Dermawan, A.; Komarudin, H.; Andrianto, A.
2013-01-01
This paper explores the impacts of large scale land acquisition for agro-development by analyzing the Merauke Integrated Food and Energy Estate (MIFEE) in Indonesia. It also examines the potential for MIFEE to meet sustainability requirements under RSPO, ISPO, and FSC. The plantation development
Development of large area resistive electrodes for ATLAS NSW Micromegas
Ochi, Atsuhiko
2018-02-01
Micromegas with resistive anodes will be used for the NSW upgrades of the ATLAS experiment at LHC. Resistive electrodes are used in MPGD devices to prevent sparks in high-rate operation. Large-area resistive electrodes for Micromegas have been developed using two different technologies: screen printing and carbon sputtering. The maximum resistive foil size is 45 × 220 cm with a printed pattern of 425-μm pitch strips. These technologies are also suitable for mass production. Prototypes of a production model series have been successfully produced. In this paper, we report the development, the production status, and the test results of resistive Micromegas.
Development of large area silicon semiconductor detectors for use in the current mode
Ouyang Xia Opin; Li Zhen Fu; Zhang Guo Guang; Zhang Qi; Zhang Xia; Song Xian Cai; Jia Huan Yi; Lei Jian Hua; Sun Yuan Cheng
2002-01-01
Large area silicon semiconductor detectors for use in the current mode, with their dimensions of phi 40, phi 50 and phi 60 mm, their depletion thickness of 200-300 mu m, have been developed. Their performance measurements have been made, which indicate that the developed detectors can satisfactorily meet the needs in expectation. Compared with the detectors commercially available on the market, authors' large PIN detectors can serve both as reliable and efficient high-resolution devices for nuclear counting experiments, as well as monitors of high-intensity radiation fields in the current mode under a bias of 100-1000 V, while the detectors commercially available are only for the counting use
International Nuclear Information System (INIS)
Cepeda, Mauricio; Finon, Dominique
2013-04-01
This paper deals with the practical problems related to long-term security of supply in electricity markets in the presence of large-scale wind power development. The success of renewable promotion schemes adds a new dimension to ensuring long-term security of supply. It necessitates designing second-best policies to prevent large-scale wind power development from distorting long-run equilibrium prices and investments in conventional generation and in particular in peaking units. We rely upon a long-term simulation model which simulates electricity market players' investment decisions in a market regime and incorporates large-scale wind power development either in the presence of either subsidised wind production or in market-driven development. We test the use of capacity mechanisms to compensate for the long-term effects of large-scale wind power development on the system reliability. The first finding is that capacity mechanisms can help to reduce the social cost of large scale wind power development in terms of decrease of loss of load probability. The second finding is that, in a market-based wind power deployment without subsidy, wind generators are penalized for insufficient contribution to the long term system's reliability. (authors)
Development of a New Delivery and Attachment System for Tagging Large Cetaceans
National Research Council Canada - National Science Library
Harvey, James
1997-01-01
.... We developed a new method of delivering tags for placement on large whales. Sea lions were trained to carry a harness and attached camera system along with carrying a suction-cup tag in a mouth piece...
Organics removal from landfill leachate and activated sludge production in SBR reactors
International Nuclear Information System (INIS)
Klimiuk, Ewa; Kulikowska, Dorota
2006-01-01
This study is aimed at estimating organic compounds removal and sludge production in SBR during treatment of landfill leachate. Four series were performed. At each series, experiments were carried out at the hydraulic retention time (HRT) of 12, 6, 3 and 2 d. The series varied in SBR filling strategies, duration of the mixing and aeration phases, and the sludge age. In series 1 and 2 (a short filling period, mixing and aeration phases in the operating cycle), the relationship between organics concentration (COD) in the leachate treated and HRT was pseudo-first-order kinetics. In series 3 (with mixing and aeration phases) and series 4 (only aeration phase) with leachate supplied by means of a peristaltic pump for 4 h of the cycle (filling during reaction period) - this relationship was zero-order kinetics. Activated sludge production expressed as the observed coefficient of biomass production (Y obs ) decreased correspondingly with increasing HRT. The smallest differences between reactors were observed in series 3 in which Y obs was almost stable (0.55-0.6 mg VSS/mg COD). The elimination of the mixing phase in the cycle (series 4) caused the Y obs to decrease significantly from 0.32 mg VSS/mg COD at HRT 2 d to 0.04 mg VSS/mg COD at HRT 12 d. The theoretical yield coefficient Y accounted for 0.534 mg VSS/mg COD (series 1) and 0.583 mg VSS/mg COD (series 2). In series 3 and 4, it was almost stable (0.628 mg VSS/mg COD and 0.616 mg VSS/mg COD, respectively). After the elimination of the mixing phase in the operating cycle, the specific biomass decay rate increased from 0.006 d -1 (series 3) to 0.032 d -1 (series 4). The operating conditions employing mixing/aeration or only aeration phases enable regulation of the sludge production. The SBRs operated under aerobic conditions are more favourable at a short hydraulic retention time. At long hydraulic retention time, it can lead to a decrease in biomass concentration in the SBR as a result of cell decay. On the contrary
Detector development for the High Luminosity Large Hadron Collider
AUTHOR|(INSPIRE)INSPIRE-00367854; Gößling, Claus
To maximise the discovery potential of the Large Hadron Collider, it will be upgraded to the High Luminosity Large Hadron Collider in 2024. New detector challenges arise from the higher instantaneous luminosity and the higher particle flux. The new ATLAS Inner Tracker will replace the current tracking detector to be able to cope with these challenges. Many pixel detector technologies exist for particle tracking, but their suitability for the ATLAS Inner Tracker needs to be studied. Active high-voltage CMOS sensors, which are produced in industrialised processes, offer a fast readout and radiation tolerance. In this thesis the HV2FEI4v2 sensor, which is capacitively coupled to the ATLAS Pixel FE-I4 readout chip, is characterised for the usage in the outer layers of the ATLAS Inner Tracker. Key quantities of this prototype module are studied, such as the hit efficiency and the subpixel encoding. The early HV2FEI4v2 prototype shows promising results as a starting point for further module developments. Active CMO...
Development of 1800 rpm, 43in. blade for large steam turbine
International Nuclear Information System (INIS)
Kuroda, Michio; Yamazaki, Yoshiaki; Namura, Kiyoshi; Taki, Takamitsu; Ninomiya, Satoshi.
1978-01-01
In the turbines for nuclear power generation, the inlet conditions of steam is low pressure and low temperature as compared with the turbines for thermal power generation, therefore generally the required steam flow rate is much more. It is the main problem to cope with this steam of large flow rate effectively with long final stage blades and to make a turbine compact. This newly developed blade aims at the turbines from 1100 to 1300 MW class for nuclear power generation and those of 1000 MW class for thermal power generation, and it is the first low revolution, long blade in Japan used for large capacity machines of 60 Hz. Hereinafter, the outline of various examinations carried out at the time of the tests on this blade and the features of this blade are described. There is large margin in the exhaust area with this blade, therefore the turbines with large power output and good performance can be produced. The loss of exhaust energy at turbine exit can be reduced, and thermal efficiency can be raised. Large capacity machines from 1100 to 1300 MW class can be manufactured with six-flow exhaust, tandem compound turbines. In order to confirm the reliability, the vibration characteristics of the blade were investigated in the test of this time, and also the overspeed test and endurance test were carried out. (Kako, I.)
Integration in New Product Development: Case Study in a Large Brazilian
Directory of Open Access Journals (Sweden)
Daniel Jugend
2012-02-01
Full Text Available Proficiency in management activities undertaken in product development processes is regarded as a key competitive advantage for companies, particularly for high-tech industrial firms, which benefit from the important competitiveness factor of launching products with a differentiated technological content. This paper’s objective was to identify, through case study, practices for integration between the roles of R & D with others involved in product development in a large Brazilian company of industrial automation. The results suggest some management practices to improve the integration in new products development, such as the use of employees from marketing with knowledge and experience previously gained from R & D activities and uses the heavyweight product manager to solve synchronization problems between product and technology development.
Directory of Open Access Journals (Sweden)
Святослав Аркадійович МУРАВЕЦЬКИЙ
2016-02-01
Full Text Available There have been discussed key points of operational activates in a large scale geographically spread software development projects. A look taken at required QA processes structure in such project. There have been given up to date methods of integration quality assurance processes into software development processes. There have been reviewed existing groups of software development methodologies. Such as sequential, agile and based on RPINCE2. There have been given a condensed overview of quality assurance processes in each group. There have been given a review of common challenges that sequential and agile models are having in case of large geographically spread hybrid software development project. Recommendations were given in order to tackle those challenges. The conclusions about the best methodology choice and appliance to the particular project have been made.
Definition of technology development missions for early space stations: Large space structures
Gates, R. M.; Reid, G.
1984-01-01
The objectives studied are the definition of the tested role of an early Space Station for the construction of large space structures. This is accomplished by defining the LSS technology development missions (TDMs) identified in phase 1. Design and operations trade studies are used to identify the best structural concepts and procedures for each TDMs. Details of the TDM designs are then developed along with their operational requirements. Space Station resources required for each mission, both human and physical, are identified. The costs and development schedules for the TDMs provide an indication of the programs needed to develop these missions.
Beuchelt, Tina
2017-01-01
European public procurement is becoming more sustainable. However, for goods with global supply chains, sustainable procurement faces several challenges. This paper highlights the sustainability challenges for biomass-based products, discusses the suitability of biomass-focused voluntary sustainability standards (VSS) to address them, and identifies experiences and knowledge gaps in the use of VSS in European public procurement. The paper is based on a comprehensive literature review and a ca...
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Hildebrandt, Dieter
2014-01-01
Modern 3D geovisualization systems (3DGeoVSs) are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI) to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable ...
DSMC simulation and experimental validation of shock interaction in hypersonic low density flow.
Xiao, Hong; Shang, Yuhe; Wu, Di
2014-01-01
Direct simulation Monte Carlo (DSMC) of shock interaction in hypersonic low density flow is developed. Three collision molecular models, including hard sphere (HS), variable hard sphere (VHS), and variable soft sphere (VSS), are employed in the DSMC study. The simulations of double-cone and Edney's type IV hypersonic shock interactions in low density flow are performed. Comparisons between DSMC and experimental data are conducted. Investigation of the double-cone hypersonic flow shows that three collision molecular models can predict the trend of pressure coefficient and the Stanton number. HS model shows the best agreement between DSMC simulation and experiment among three collision molecular models. Also, it shows that the agreement between DSMC and experiment is generally good for HS and VHS models in Edney's type IV shock interaction. However, it fails in the VSS model. Both double-cone and Edney's type IV shock interaction simulations show that the DSMC errors depend on the Knudsen number and the models employed for intermolecular interaction. With the increase in the Knudsen number, the DSMC error is decreased. The error is the smallest in HS compared with those in the VHS and VSS models. When the Knudsen number is in the level of 10(-4), the DSMC errors, for pressure coefficient, the Stanton number, and the scale of interaction region, are controlled within 10%.
International Nuclear Information System (INIS)
Cepeda, Mauricio; Finon, Dominique
2013-01-01
This paper deals with the practical problems related to long-term security of supply in electricity markets in the presence of large-scale wind power development. The success of recent renewable promotion schemes adds a new dimension to ensuring long-term security of supply: it necessitates designing second-best policies to prevent large-scale wind power development from distorting long-run equilibrium prices and investments in conventional generation and in particular in peaking units. We rely upon a long-term simulation model which simulates electricity market players' investment decisions in a market regime and incorporates large-scale wind power development in the presence of either subsidized or market driven development scenarios. We test the use of capacity mechanisms to compensate for long-term effects of large-scale wind power development on prices and reliability of supply. The first finding is that capacity mechanisms can help to reduce the social cost of large scale wind power development in terms of decrease of loss of load probability. The second finding is that, in a market-based wind power deployment without subsidy, wind generators are penalised for insufficient contribution to the long term system's reliability. - Highlights: • We model power market players’ investment decisions incorporating wind power. • We examine two market designs: an energy-only market and a capacity mechanism. • We test two types of wind power development paths: subsidised and market-driven. • Capacity mechanisms compensate for the externalities of wind power developments
Development of corotational formulated FEM for application to 30m class large deployable reflector
International Nuclear Information System (INIS)
Ozawa, Satoru; Fujiwara, Yuuichi; Tsujihata, Akio
2010-01-01
JAXA, Japan Aerospace Exploration Agency, is now developing a corotational formulated finite element analysis method and its software 'Origami/ETS' for the development of 30m class large deployable reflectors. For the reason that the deployable reflector is composed of beams, cables and mesh, this analysis method is generalized for finite elements with multiple nodes, which are commonly used in linear finite element analyses. The large displacement and rotation are taken into account by the corotational formulation. The tangent stiffness matrix for finite elements with multiple nodes is obtained as follows; the geometric stiffness matrix of two node elements is derived by taking variation of the element's corotational matrix from the virtual work of finite elements with large displacement; similarly the geometric stiffness matrix for three node elements is derived; as the extension of two and three node element theories, the geometric stiffness matrix for multiple node elements is derived; with the geometric stiffness matrix for multiple node elements, the tangent stiffness matrix is obtained. The analysis method is applied for the deployment analysis and static structural analysis of the 30m class large deployable reflector. In the deployment analysis, it is confirmed that this method stably analyzes the deployment motion from the deployment configuration to the stowed configuration of the reflector. In the static analysis, it is confirmed that the mesh structure is analyzed successfully. The 30m class large deployable reflector is now still being developed and is about to undergo several tests with its prototypes. This analysis method will be used in the tests and verifications of the reflector.
Environmental quality indexing of large industrial development alternatives using AHP
International Nuclear Information System (INIS)
Solnes, Julius
2003-01-01
Two industrial development alternatives have been proposed for the East Coast of Iceland in order to strengthen its socio-economic basis. The favoured option is to build a large aluminium smelter, which requires massive hydropower development in the nearby highlands. Another viable option is the construction of a 6-million-ton oil refinery, following the planned exploitation of the Timan Pechora oil reserves in the Russian Arctic. A third 'fictitious' alternative could be general development of existing regional industry and new knowledge-based industries, development of ecotourism, establishment of national parks, accompanied by infrastructure improvement (roads, tunnels, communications, schools, etc.). The three alternatives will have different environmental consequences. The controversial hydropower plant for the smelter requires a large water reservoir as well as considerable land disturbance in this unique mountain territory, considered to be the largest uninhabited wilderness in Western Europe. The aluminium smelter and the oil refinery will give rise to substantial increase of the greenhouse gas (GHG) emissions of the country (about 20%). Then there is potential environmental risk associated with the refinery regarding oil spills at sea, which could have disastrous impact on the fisheries industry. However, the oil refinery does not require any hydropower development, which is a positive factor. Finally, the third alternative could be defined as a ''green'' solution whereby the detrimental environmental consequences of the two industrial solutions are mostly avoided. In order to compare the three alternatives in an orderly manner, the analytic hierarchy process methodology of Saaty was applied to calculate the environmental quality index of each alternative, which is defined as a weighted sum of selected environmental and socio-economic factors. These factors are evaluated on a comparison basis, applying the AHP methodology, and the weights in the quality
Smith, P. J.; Thomson, L. W.; Wilson, R. D.
1986-01-01
NASA sponsored composites research and development programs were set in place to develop the critical engineering technologies in large transport aircraft structures. This NASA-Boeing program focused on the critical issues of damage tolerance and pressure containment generic to the fuselage structure of large pressurized aircraft. Skin-stringer and honeycomb sandwich composite fuselage shell designs were evaluated to resolve these issues. Analyses were developed to model the structural response of the fuselage shell designs, and a development test program evaluated the selected design configurations to appropriate load conditions.
Establishing the pig as a large animal model for vaccine development against human cancer
DEFF Research Database (Denmark)
Overgaard, Nana Haahr; Frøsig, Thomas Mørch; Welner, Simon
2015-01-01
Immunotherapy has increased overall survival of metastatic cancer patients, and cancer antigens are promising vaccine targets. To fulfill the promise, appropriate tailoring of the vaccine formulations to mount in vivo cytotoxic T cell (CTL) responses toward co-delivered cancer antigens is essential...... and the porcine immunome is closer related to the human counterpart, we here introduce pigs as a supplementary large animal model for human cancer vaccine development. IDO and RhoC, both important in human cancer development and progression, were used as vaccine targets and 12 pigs were immunized with overlapping......C-derived peptides across all groups with no adjuvant being superior. These findings support the further use of pigs as a large animal model for vaccine development against human cancer....
Development of large engineered cartilage constructs from a small population of cells.
Brenner, Jillian M; Kunz, Manuela; Tse, Man Yat; Winterborn, Andrew; Bardana, Davide D; Pang, Stephen C; Waldman, Stephen D
2013-01-01
Confronted with articular cartilage's limited capacity for self-repair, joint resurfacing techniques offer an attractive treatment for damaged or diseased tissue. Although tissue engineered cartilage constructs can be created, a substantial number of cells are required to generate sufficient quantities of tissue for the repair of large defects. As routine cell expansion methods tend to elicit negative effects on chondrocyte function, we have developed an approach to generate phenotypically stable, large-sized engineered constructs (≥3 cm(2) ) directly from a small amount of donor tissue or cells (as little as 20,000 cells to generate a 3 cm(2) tissue construct). Using rabbit donor tissue, the bioreactor-cultivated constructs were hyaline-like in appearance and possessed a biochemical composition similar to native articular cartilage. Longer bioreactor cultivation times resulted in increased matrix deposition and improved mechanical properties determined over a 4 week period. Additionally, as the anatomy of the joint will need to be taken in account to effectively resurface large affected areas, we have also explored the possibility of generating constructs matched to the shape and surface geometry of a defect site through the use of rapid-prototyped defect tissue culture molds. Similar hyaline-like tissue constructs were developed that also possessed a high degree of shape correlation to the original defect mold. Future studies will be aimed at determining the effectiveness of this approach to the repair of cartilage defects in an animal model and the creation of large-sized osteochondral constructs. Copyright © 2012 American Institute of Chemical Engineers (AIChE).
Gholikandi, Gagik Badalians; Kazemirad, Khashayar
2018-03-01
In this study, the performance of the electrochemical peroxidation (ECP) process for removing the volatile suspended solids (VSS) content of waste-activated sludge was evaluated. The Fe 2+ ions required by the process were obtained directly from iron electrodes in the system. The performance of the ECP process was investigated in various operational conditions employing a laboratory-scale pilot setup and optimized by response surface methodology (RSM). According to the results, the ECP process showed its best performance when the pH value, current density, H 2 O 2 concentration and the retention time were 3, 3.2 mA/cm 2 , 1,535 mg/L and 240 min, respectively. In these conditions, the introduced Fe 2+ concentration was approximately 500 (mg/L) and the VSS removal efficiency about 74%. Moreover, the results of the microbial characteristics of the raw and the stabilized sludge demonstrated that the ECP process is able to remove close to 99.9% of the coliforms in the raw sludge during the stabilization process. The energy consumption evaluation showed that the required energy of the ECP reactor (about 1.8-2.5 kWh (kg VSS removed) -1 ) is considerably lower than for aerobic digestion, the conventional waste-activated sludge stabilization method (about 2-3 kWh (kg VSS removed) -1 ). The RSM optimization process showed that the best operational conditions of the ECP process comply with the experimental results, and the actual and the predicted results are in good conformity with each other. This feature makes it possible to predict the introduced Fe 2+ concentrations into the system and the VSS removal efficiency of the process precisely.
Alignment of classification paradigms for communication abilities in children with cerebral palsy.
Hustad, Katherine C; Oakes, Ashley; McFadd, Emily; Allison, Kristen M
2016-06-01
We examined three communication ability classification paradigms for children with cerebral palsy (CP): the Communication Function Classification System (CFCS), the Viking Speech Scale (VSS), and the Speech Language Profile Groups (SLPG). Questions addressed interjudge reliability, whether the VSS and the CFCS captured impairments in speech and language, and whether there were differences in speech intelligibility among levels within each classification paradigm. Eighty children (42 males, 38 females) with a range of types and severity levels of CP participated (mean age 60mo, range 50-72mo [SD 5mo]). Two speech-language pathologists classified each child via parent-child interaction samples and previous experience with the children for the CFCS and VSS, and using quantitative speech and language assessment data for the SLPG. Intelligibility scores were obtained using standard clinical intelligibility measurement. Kappa values were 0.67 (95% confidence interval [CI] 0.55-0.79) for the CFCS, 0.82 (95% CI 0.72-0.92) for the VSS, and 0.95 (95% CI 0.72-0.92) for the SLPG. Descriptively, reliability within levels of each paradigm varied, with the lowest agreement occurring within the CFCS at levels II (42%), III (40%), and IV (61%). Neither the CFCS nor the VSS were sensitive to language impairments captured by the SLPG. Significant differences in speech intelligibility were found among levels for all classification paradigms. Multiple tools are necessary to understand speech, language, and communication profiles in children with CP. Characterization of abilities at all levels of the International Classification of Functioning, Disability and Health will advance our understanding of the ways that speech, language, and communication abilities present in children with CP. © 2015 Mac Keith Press.
Recent developments in large-scale ozone generation with dielectric barrier discharges
Lopez, Jose L.
2014-10-01
Large-scale ozone generation for industrial applications has been entirely based on the creation of microplasmas or microdischarges created using dielectric barrier discharge (DBD) reactors. Although versions of DBD generated ozone have been in continuous use for over a hundred years especially in water treatment, recent changes in environmental awareness and sustainability have lead to a surge of ozone generating facilities throughout the world. As a result of this enhanced global usage of this environmental cleaning application various new discoveries have emerged in the science and technology of ozone generation. This presentation will describe some of the most recent breakthrough developments in large-scale ozone generation while further addressing some of the current scientific and engineering challenges of this technology.
A Study on Developing and Refining a Large Citation Service System
Directory of Open Access Journals (Sweden)
Kwang-Young Kim
2013-06-01
Full Text Available Today, citation index information is used as an outcome scale of spreading technology and encouraging research. Article citation information is an important factor to determine the authority of the relevant author. Google Scholar uses the article citation information to organize academic article search results with a rank algorithm. For an accurate analysis of such important citation index information, large amounts of bibliographic data are required. Therefore, this study aims to build a fast and efficient system for large amounts of bibliographic data, and to design and develop a system for quickly analyzing cited information for that data. This study also aims to use and analyze citation data to be a basic element for providing various advanced services to the academic article search system.
Energy Technology Data Exchange (ETDEWEB)
Swaminathan-Gopalan, Krishnan; Stephani, Kelly A., E-mail: ksteph@illinois.edu [Department of Mechanical Science and Engineering, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)
2016-02-15
A systematic approach for calibrating the direct simulation Monte Carlo (DSMC) collision model parameters to achieve consistency in the transport processes is presented. The DSMC collision cross section model parameters are calibrated for high temperature atmospheric conditions by matching the collision integrals from DSMC against ab initio based collision integrals that are currently employed in the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA) and Data Parallel Line Relaxation (DPLR) high temperature computational fluid dynamics solvers. The DSMC parameter values are computed for the widely used Variable Hard Sphere (VHS) and the Variable Soft Sphere (VSS) models using the collision-specific pairing approach. The recommended best-fit VHS/VSS parameter values are provided over a temperature range of 1000-20 000 K for a thirteen-species ionized air mixture. Use of the VSS model is necessary to achieve consistency in transport processes of ionized gases. The agreement of the VSS model transport properties with the transport properties as determined by the ab initio collision integral fits was found to be within 6% in the entire temperature range, regardless of the composition of the mixture. The recommended model parameter values can be readily applied to any gas mixture involving binary collisional interactions between the chemical species presented for the specified temperature range.
Chatterjee, Pritha; Ghangrekar, M M; Rao, Surampalli
2018-02-01
A hybrid upflow anaerobic sludge blanket (UASB)-moving bed biofilm (MBB) and rope bed biofilm (RBB) reactor was designed for treatment of sewage. Possibility of enhancing granulation in an UASB reactor using moving media to improve sludge retention was explored while treating low-strength wastewater. The presence of moving media in the top portion of the UASB reactor allowed a high solid retention time even at very short hydraulic retention times and helped in maintaining selection pressure in the sludge bed to promote formation of different sized sludge granules with an average settling velocity of 67 m/h. These granules were also found to contain plenty of extracellular polymeric substance (EPS) such as 58 mg of polysaccharides (PS) per gram of volatile suspended solids (VSS) and protein (PN) content of 37 mg/g VSS. Enriched sludge of nitrogen-removing bacteria forming a porous biofilm on the media in RBB was also observed in a concentration of around 894 g/m 2 . The nitrogen removing sludge also had a high EPS content of around 22 mg PS/g VSS and 28 mg PN/g VSS. This hybrid UASB-MBB-RBB reactor with enhanced anaerobic granular sludge treating both carbonaceous and nitrogenous matter may be a sustainable solution for decentralized sewage treatment.
An improved VSS NLMS algorithm for active noise cancellation
Sun, Yunzhuo; Wang, Mingjiang; Han, Yufei; Zhang, Congyan
2017-08-01
In this paper, an improved variable step size NLMS algorithm is proposed. NLMS has fast convergence rate and low steady state error compared to other traditional adaptive filtering algorithm. But there is a contradiction between the convergence speed and steady state error that affect the performance of the NLMS algorithm. Now, we propose a new variable step size NLMS algorithm. It dynamically changes the step size according to current error and iteration times. The proposed algorithm has simple formulation and easily setting parameters, and effectively solves the contradiction in NLMS. The simulation results show that the proposed algorithm has a good tracking ability, fast convergence rate and low steady state error simultaneously.
DEFF Research Database (Denmark)
Dziembowski, Stefan
here and discuss other problems caused by the adaptiveness. All protocols in the thesis are formally specified and the proofs of their security are given. [1]Ronald Cramer, Ivan Damgård, Stefan Dziembowski, Martin Hirt, and Tal Rabin. Efficient multiparty computations with dishonest minority......In this thesis we study a problem of doing Verifiable Secret Sharing (VSS) and Multiparty Computations in a model where private channels between the players and a broadcast channel is available. The adversary is active, adaptive and has an unbounded computing power. The thesis is based on two...... to a polynomial time black-box reduction, the complexity of adaptively secure VSS is the same as that of ordinary secret sharing (SS), where security is only required against a passive, static adversary. Previously, such a connection was only known for linear secret sharing and VSS schemes. We then show...
1984-01-01
The large space structures technology development missions to be performed on an early manned space station was studied and defined and the resources needed and the design implications to an early space station to carry out these large space structures technology development missions were determined. Emphasis is being placed on more detail in mission designs and space station resource requirements.
Kruyt, Ivo J; Verheul, Jeroen B; Hanssens, Patrick E J; Kunst, Henricus P M
2018-01-01
OBJECTIVE Neurofibromatosis Type 2 (NF2) is a tumor syndrome characterized by an autosomal dominant pattern of inheritance. The hallmark of NF2 is the development of bilateral vestibular schwannomas (VSs), generally by 30 years of age. One of the first-line treatment options for small to medium-large VSs is radiosurgery. Although radiosurgery shows excellent results in sporadic VS, its use in NF2-related VS is still a topic of dispute. The aim of this study was to evaluate long-term tumor control, hearing preservation rates, and factors influencing outcome of optimally dosed, contemporary Gamma Knife radiosurgery (GKRS) for growing VSs in patients with NF2 and compare the findings to data obtained in patients with sporadic VS also treated by means of GKRS. METHODS The authors performed a retrospective analysis of 47 growing VSs in 34 NF2 patients who underwent GKRS treatment performed with either the Model C or Perfexion Leksell Gamma Knife, with a median margin dose of 11 Gy. Actuarial tumor control rates were estimated using the Kaplan-Meier method. For patient- and treatment-related factors, a Cox proportional hazards model was used to identify predictors of outcome. Trigeminal, facial, and vestibulocochlear nerve function were assessed before and after treatment. NF2-related VS patients were matched 1:1 with sporadic VS patients who were treated in the same institute, and the same indications for treatment, definitions, and dosimetry were used in order to compare outcomes. RESULTS Actuarial tumor control rates in NF2 patients after 1, 3, 5, and 8 years were 98%, 89%, 87%, and 87%, respectively. Phenotype and tumor volume had significant hazard rates of 0.086 and 22.99, respectively, showing that Feiling-Gardner phenotype and a tumor volume not exceeding 6 cm 3 both were associated with significantly better outcome. Actuarial rates of serviceable hearing preservation after 1, 3, 5, and 7 years were 95%, 82%, 59%, and 33%, respectively. None of the patients
Large-Scale Urban Decontamination; Developments, Historical Examples and Lessons Learned
Energy Technology Data Exchange (ETDEWEB)
Rick Demmer
2007-02-01
Recent terrorist threats and actual events have lead to a renewed interest in the technical field of large scale, urban environment decontamination. One of the driving forces for this interest is the real potential for the cleanup and removal of radioactive dispersal device (RDD or “dirty bomb”) residues. In response the U. S. Government has spent many millions of dollars investigating RDD contamination and novel decontamination methodologies. Interest in chemical and biological (CB) cleanup has also peaked with the threat of terrorist action like the anthrax attack at the Hart Senate Office Building and with catastrophic natural events such as Hurricane Katrina. The efficiency of cleanup response will be improved with these new developments and a better understanding of the “old reliable” methodologies. Perhaps the most interesting area of investigation for large area decontamination is that of the RDD. While primarily an economic and psychological weapon, the need to cleanup and return valuable or culturally significant resources to the public is nonetheless valid. Several private companies, universities and National Laboratories are currently developing novel RDD cleanup technologies. Because of its longstanding association with radioactive facilities, the U. S. Department of Energy National Laboratories are at the forefront in developing and testing new RDD decontamination methods. However, such cleanup technologies are likely to be fairly task specific; while many different contamination mechanisms, substrate and environmental conditions will make actual application more complicated. Some major efforts have also been made to model potential contamination, to evaluate both old and new decontamination techniques and to assess their readiness for use. Non-radioactive, CB threats each have unique decontamination challenges and recent events have provided some examples. The U. S. Environmental Protection Agency (EPA), as lead agency for these emergency
Development of a large scale bipolar NiH2 battery
Adler, E.; Perez, F.
1983-01-01
The bipolar battery concept, developed in cooperation with NASA, is described in the context of the advantages afforded by near-term IPV and CVP cell technology. The projected performance, development requirements, and a possible approach to bipolar battery design are outlined. Consideration is given to packaging electrodes within a common hydrophobic plastic frame, electrode technology that involves a photochemically etched 0.1 mm thick nickel substrate coated with a 10 mg/sq cm mixture of platinum powder and TFE30, and an electrode design that eliminates the screen and doubles the electrode thickness (from the currently used 0.8 mm) while retaining the active material loading of 1.6-1.8 gm/cu cm. Also covered are thermal management, and electrolyte and oxygen management. It is concluded that a high voltage, high capacity, bipolar NiH2 cell can be configured with proper development for use in large power systems, and that it can provide considerable weight savings.
Li-dong, Shen; An-hui, Hu; Ren-cun, Jin; Dong-qing, Cheng; Ping, Zheng; Xiang-yang, Xu; Bao-lan, Hu
2012-01-15
Three activated sludges from a landfill leachate treatment plant (S1), a municipal sewage treatment plant (S2) and a monosodium glutamate (MSG) wastewater treatment plant (S3) were used as inocula to enrich anaerobic ammonium oxidation (anammox) bacteria for the startup of MSG industrial wastewater treatment system. After 360 days of cultivation using MSG wastewater, obvious anammox activity was observed in all three cultures. The maximum specific anammox activities of cultures S1, S2 and S3 were 0.11 kg N kg(-1) VSS day(-1), 0.09 kg N kg(-1) VSS day(-1) and 0.16 kg N kg(-1) VSS day(-1), respectively. Brownish-red anammox granules having diameters in the range of 0.2-1.0mm were visible in cultures S1 and S2, and large red granules having diameters in the range of 0.5-2.5mm were formed in culture S3 after 420 days of cultivation. Phylogenetic analysis of 16S rRNA genes showed that Kuenenia organisms were the dominant anammox species in all three cultures. The copy numbers of 16S rRNA genes of anammox bacteria in cultures S1, S2 and S3 were 6.8 × 10(7) copies mL(-1), 9.4 × 10(7) copies mL(-1) and 7.5 × 10(8) copies mL(-1), respectively. The results of this study demonstrated that anammox cultivation from conventional activated sludges was highly possible using MSG wastewater. Thus the anammox process has possibility of applying to the nitrogen removal from MSG wastewater. Copyright © 2011 Elsevier B.V. All rights reserved.
Large-scale computation in solid state physics - Recent developments and prospects
International Nuclear Information System (INIS)
DeVreese, J.T.
1985-01-01
During the past few years an increasing interest in large-scale computation is developing. Several initiatives were taken to evaluate and exploit the potential of ''supercomputers'' like the CRAY-1 (or XMP) or the CYBER-205. In the U.S.A., there first appeared the Lax report in 1982 and subsequently (1984) the National Science Foundation in the U.S.A. announced a program to promote large-scale computation at the universities. Also, in Europe several CRAY- and CYBER-205 systems have been installed. Although the presently available mainframes are the result of a continuous growth in speed and memory, they might have induced a discontinuous transition in the evolution of the scientific method; between theory and experiment a third methodology, ''computational science'', has become or is becoming operational
Towards a Balanced Sustainability Vision for the Coffee Industry
Directory of Open Access Journals (Sweden)
Luis F. Samper
2017-04-01
Full Text Available As one of the world’s most traded agricultural commodities, coffee constitutes a significant part of the overall economy and a major source of foreign revenue for many developing countries. Coffee also touches a large portion of the world’s population in the South, where it is mainly produced, and in the North, where it is primarily consumed. As a product frequently purchased by a significant share of worldwide consumers on a daily basis in social occasions, the coffee industry has earned a high profile that also attracts the interest of non-governmental organizations, governments, multilateral organizations and development specialists and has been an early adopter of Voluntary Sustainability Standards (VSS. Responding to the trend of increased interest on sustainability, it is therefore not surprising that coffee continues to be at the forefront of sustainability initiatives that transcend into other agricultural industries. Based on literature and authors’ experiences, this article reflects on the VSS evolution and considers a sustainability model that specifically incorporates producers’ local realities and deals with the complex scenario of sustainability challenges in producing regions. Agreeing on a joint sustainability approach with farmers’ effective involvement is necessary so that the industry as a whole (up and downstream value chain actors can legitimately communicate its own sustainability priorities. This top-down/bottom-up approach could also lead to origin-based, actionable and focused sustainability key performance indicators, relevant for producers and consistent with the UN’s Sustainable Development Goals. The initiative also aims to provide a sustainability platform for single origin coffees and Geographical Indications (GIs in accordance with growers’ own realities and regions, providing the credibility that consumers now expect from sustainability initiatives, additional differentiation options for origin
Large-scale water projects in the developing world: Revisiting the past and looking to the future
Sivakumar, Bellie; Chen, Ji
2014-05-01
During the past half a century or so, the developing world has been witnessing a significant increase in freshwater demands due to a combination of factors, including population growth, increased food demand, improved living standards, and water quality degradation. Since there exists significant variability in rainfall and river flow in both space and time, large-scale storage and distribution of water has become a key means to meet these increasing demands. In this regard, large dams and water transfer schemes (including river-linking schemes and virtual water trades) have been playing a key role. While the benefits of such large-scale projects in supplying water for domestic, irrigation, industrial, hydropower, recreational, and other uses both in the countries of their development and in other countries are undeniable, concerns on their negative impacts, such as high initial costs and damages to our ecosystems (e.g. river environment and species) and socio-economic fabric (e.g. relocation and socio-economic changes of affected people) have also been increasing in recent years. These have led to serious debates on the role of large-scale water projects in the developing world and on their future, but the often one-sided nature of such debates have inevitably failed to yield fruitful outcomes thus far. The present study aims to offer a far more balanced perspective on this issue. First, it recognizes and emphasizes the need for still additional large-scale water structures in the developing world in the future, due to the continuing increase in water demands, inefficiency in water use (especially in the agricultural sector), and absence of equivalent and reliable alternatives. Next, it reviews a few important success and failure stories of large-scale water projects in the developing world (and in the developed world), in an effort to arrive at a balanced view on the future role of such projects. Then, it discusses some major challenges in future water planning
Development of a large peptoid-DOTA combinatorial library.
Singh, Jaspal; Lopes, Daniel; Gomika Udugamasooriya, D
2016-09-01
Conventional one-bead one-compound (OBOC) library synthesis is typically used to identify molecules with therapeutic value. The design and synthesis of OBOC libraries that contain molecules with imaging or even potentially therapeutic and diagnostic capacities (e.g. theranostic agents) has been overlooked. The development of a therapeutically active molecule with a built-in imaging component for a certain target is a daunting task, and structure-based rational design might not be the best approach. We hypothesize to develop a combinatorial library with potentially therapeutic and imaging components fused together in each molecule. Such molecules in the library can be used to screen, identify, and validate as direct theranostic candidates against targets of interest. As the first step in achieving that aim, we developed an on-bead library of 153,600 Peptoid-DOTA compounds in which the peptoids are the target-recognizing and potentially therapeutic components and the DOTA is the imaging component. We attached the DOTA scaffold to TentaGel beads using one of the four arms of DOTA, and we built a diversified 6-mer peptoid library on the remaining three arms. We evaluated both the synthesis and the mass spectrometric sequencing capacities of the test compounds and of the final library. The compounds displayed unique ionization patterns including direct breakages of the DOTA scaffold into two units, allowing clear decoding of the sequences. Our approach provides a facile synthesis method for the complete on-bead development of large peptidomimetic-DOTA libraries for screening against biological targets for the identification of potential theranostic agents in the future. © 2016 The Authors. Biopolymers Published by Wiley Periodicals, Inc. Biopolymers (Pept Sci) 106: 673-684, 2016. © 2016 The Authors. Biopolymers Published by Wiley Periodicals, Inc.
Development of large area resistive electrodes for ATLAS NSW MicroMEGAS
Ochi, Atsuhiko; The ATLAS collaboration
2015-01-01
MicroMegas with resistive anode will be used for the NSW upgrade of the ATLAS experiment at LHC. The resistive electrode is one of key technology for MPGDs to prevent sparks. Large area resistive electrodes for the MM have been developed using two different technology; screen printing and carbon sputtering. Maximum size of each resistive foil is 45cm x 220cm with printed pattern of 425 micron pitch strips. Those technologies are also suitable to mass production. The prototypes of series production model have been produced successfully. We will report the development and production status and test results of the resistive MicroMegas.
Advanced Mirror Technology Development for Very Large Space Telescopes
Stahl, H. P.
2014-01-01
Advanced Mirror Technology Development (AMTD) is a NASA Strategic Astrophysics Technology project to mature to TRL-6 the critical technologies needed to produce 4-m or larger flight-qualified UVOIR mirrors by 2018 so that a viable mission can be considered by the 2020 Decadal Review. The developed mirror technology must enable missions capable of both general astrophysics & ultra-high contrast observations of exoplanets. Just as JWST’s architecture was driven by launch vehicle, a future UVOIR mission’s architectures (monolithic, segmented or interferometric) will depend on capacities of future launch vehicles (and budget). Since we cannot predict the future, we must prepare for all potential futures. Therefore, to provide the science community with options, we are pursuing multiple technology paths. AMTD uses a science-driven systems engineering approach. We derived engineering specifications for potential future monolithic or segmented space telescopes based on science needs and implement constraints. And we are maturing six inter-linked critical technologies to enable potential future large aperture UVOIR space telescope: 1) Large-Aperture, Low Areal Density, High Stiffness Mirrors, 2) Support Systems, 3) Mid/High Spatial Frequency Figure Error, 4) Segment Edges, 5) Segment-to-Segment Gap Phasing, and 6) Integrated Model Validation Science Advisory Team and a Systems Engineering Team. We are maturing all six technologies simultaneously because all are required to make a primary mirror assembly (PMA); and, it is the PMA’s on-orbit performance which determines science return. PMA stiffness depends on substrate and support stiffness. Ability to cost-effectively eliminate mid/high spatial figure errors and polishing edges depends on substrate stiffness. On-orbit thermal and mechanical performance depends on substrate stiffness, the coefficient of thermal expansion (CTE) and thermal mass. And, segment-to-segment phasing depends on substrate & structure stiffness
Status and Future Developments in Large Accelerator Control Systems
International Nuclear Information System (INIS)
Karen S. White
2006-01-01
Over the years, accelerator control systems have evolved from small hardwired systems to complex computer controlled systems with many types of graphical user interfaces and electronic data processing. Today's control systems often include multiple software layers, hundreds of distributed processors, and hundreds of thousands of lines of code. While it is clear that the next generation of accelerators will require much bigger control systems, they will also need better systems. Advances in technology will be needed to ensure the network bandwidth and CPU power can provide reasonable update rates and support the requisite timing systems. Beyond the scaling problem, next generation systems face additional challenges due to growing cyber security threats and the likelihood that some degree of remote development and operation will be required. With a large number of components, the need for high reliability increases and commercial solutions can play a key role towards this goal. Future control systems will operate more complex machines and need to present a well integrated, interoperable set of tools with a high degree of automation. Consistency of data presentation and exception handling will contribute to efficient operations. From the development perspective, engineers will need to provide integrated data management in the beginning of the project and build adaptive software components around a central data repository. This will make the system maintainable and ensure consistency throughout the inevitable changes during the machine lifetime. Additionally, such a large project will require professional project management and disciplined use of well-defined engineering processes. Distributed project teams will make the use of standards, formal requirements and design and configuration control vital. Success in building the control system of the future may hinge on how well we integrate commercial components and learn from best practices used in other industries
Hasegawa, Toshinori; Kida, Yoshihisa; Kato, Takenori; Iizuka, Hiroshi; Kuramitsu, Shunichiro; Yamamoto, Takashi
2013-03-01
Object Little is known about long-term outcomes, including tumor control and adverse radiation effects, in patients harboring vestibular schwannomas (VSs) treated with stereotactic radiosurgery > 10 years previously. The aim of this study was to confirm whether Gamma Knife surgery (GKS) for VSs continues to be safe and effective > 10 years after treatment. Methods A total of 440 patients with VS (including neurofibromatosis Type 2) treated with GKS between May 1991 and December 2000 were evaluable. Of these, 347 patients (79%) underwent GKS as an initial treatment and 93 (21%) had undergone prior resection. Three hundred fifty-eight patients (81%) had a solid tumor and 82 (19%) had a cystic tumor. The median tumor volume was 2.8 cm(3) and the median marginal dose was 12.8 Gy. Results The median follow-up period was 12.5 years. The actuarial 5- and ≥ 10-year progression-free survival was 93% and 92%, respectively. No patient developed treatment failure > 10 years after treatment. According to multivariate analysis, significant factors related to worse progression-free survival included brainstem compression with a deviation of the fourth ventricle (p 13 Gy) and 100% in the low marginal dose group (≤ 13 Gy). Ten patients (2.3%) developed delayed cyst formation. One patient alone developed malignant transformation, indicating an incidence of 0.3%. Conclusions In this study GKS was a safe and effective treatment for the majority of patients followed > 10 years after treatment. Special attention should be paid to cyst formation and malignant transformation as late adverse radiation effects, although they appeared to be rare. However, it is necessary to collect further long-term follow-up data before making conclusions about the long-term safety and efficacy of GKS, especially for young patients with VSs.
Directory of Open Access Journals (Sweden)
Sokolova Svetlana
2017-01-01
Full Text Available Condition, pace and character of the development of the mechanical engineering complex is in many aspects a crucial factor for the social and economic situation of any country. The development of market relations, changes of the conditions of doing business encourage the enterprises to search new managerial methods and to improve the interaction forms. In this respect the display of the peculiarities of the interaction of large machine engineering enterprises and small business in this sphere and also the assessment of the relationship of their development is an important and crucial issue under modern conditions. The most widely spread forms of the cooperation of large scale mechanical engineering enterprises and small businesses of the industry are: outsourcing, franchising, leasing, subcontracting, venture financing, creation of regional forms of the cooperation of large and small firms. However cooperation processes of large scale and small entrepreneurship in Russia are not properly developed. The authors determine the factors hindering the growth of the machine building industry, suggest the recommendations for the development of the large scale enterprises and small business in the industry, substantiate the role of the government in this process. Besides the mechanism of the state support of the development of small business is described.
Development of an Evaluation Methodology for Loss of Large Area induced from extreme events
International Nuclear Information System (INIS)
Kim, Sok Chul; Park, Jong Seuk; Kim, Byung Soon; Jang, Dong Ju; Lee, Seung Woo
2015-01-01
USNRC announced several regulatory requirements and guidance documents regarding the event of loss of large area including 10CFR 50.54(hh), Regulatory Guide 1.214 and SRP 19.4. In Korea, consideration of loss of large area has been limitedly taken into account for newly constructing NPPs as voluntary based. In general, it is hardly possible to find available information on methodology and key assumptions for the assessment of LOLA due to 'need to know based approach'. Urgent needs exists for developing country specific regulatory requirements, guidance and evaluation methodology by themselves with the consideration of their own geographical and nuclear safety and security environments. Currently, Korea Hydro and Nuclear Power Company (KHNP) has developed an Extended Damage Mitigation Guideline (EDMG) for APR1400 under contract with foreign consulting company. The submittal guidance NEI 06-12 related to B.5.b Phase 2 and 3 focused on unit-wise mitigation strategy instead of site level mitigation or response strategy. Phase 1 mitigating strategy and guideline for LOLA (Loss of Large Area) provides emphasis on site level arrangement including cooperative networking outside organizations and agile command and control system. Korea Institute of Nuclear Safety has carried out a pilot in-house research project to develop the methodology and guideline for evaluation of LOLA since 2014. This paper introduces the summary of major results and outcomes of the aforementioned research project. After Fukushima Dai-Ichi accident, the awareness on countering the event of loss of large area induced from extreme man-made hazards or extreme beyond design basis external event. Urgent need exists to develop regulatory guidance for coping with this undesirable situation, which has been out of consideration at existing nuclear safety regulatory framework due to the expectation of rare possibility of occurrence
Status of the technology development of large scale HTS generators for wind turbine
Energy Technology Data Exchange (ETDEWEB)
Le, T. D.; Kim, J. H.; Kim, D. J.; Boo, C. J.; Kim, H. M. [Jeju National University, Jeju (Korea, Republic of)
2015-06-15
Large wind turbine generators with high temperature superconductors (HTS) are in incessant development because of their advantages such as weight and volume reduction and the increased efficiency compared with conventional technologies. In addition, nowadays the wind turbine market is growing in a function of time, increasing the capacity and energy production of the wind farms installed and increasing the electrical power for the electrical generators installed. As a consequence, it is raising the wind power energy contribution for the global electricity demand. In this study, a forecast of wind energy development will be firstly emphasized, then it continue presenting a recent status of the technology development of large scale HTSG for wind power followed by an explanation of HTS wire trend, cryogenics cooling systems concept, HTS magnets field coil stability and other technological parts for optimization of HTS generator design-operating temperature, design topology, field coil shape and level cost of energy, as well. Finally, the most relevant projects and designs of HTS generators specifically for offshore wind power systems are also mentioned in this study.
Status of the technology development of large scale HTS generators for wind turbine
International Nuclear Information System (INIS)
Le, T. D.; Kim, J. H.; Kim, D. J.; Boo, C. J.; Kim, H. M.
2015-01-01
Large wind turbine generators with high temperature superconductors (HTS) are in incessant development because of their advantages such as weight and volume reduction and the increased efficiency compared with conventional technologies. In addition, nowadays the wind turbine market is growing in a function of time, increasing the capacity and energy production of the wind farms installed and increasing the electrical power for the electrical generators installed. As a consequence, it is raising the wind power energy contribution for the global electricity demand. In this study, a forecast of wind energy development will be firstly emphasized, then it continue presenting a recent status of the technology development of large scale HTSG for wind power followed by an explanation of HTS wire trend, cryogenics cooling systems concept, HTS magnets field coil stability and other technological parts for optimization of HTS generator design-operating temperature, design topology, field coil shape and level cost of energy, as well. Finally, the most relevant projects and designs of HTS generators specifically for offshore wind power systems are also mentioned in this study
Zhu, Zhongyunshen; Song, Yuxin; Zhang, Zhenpu; Sun, Hao; Han, Yi; Li, Yaoyao; Zhang, Liyao; Xue, Zhongying; Di, Zengfeng; Wang, Shumin
2017-09-01
We demonstrate Au-assisted vapor-solid-solid (VSS) growth of Ge nanowires (NWs) by molecular beam epitaxy at the substrate temperature of ˜180 °C, which is compatible with the temperature window for Si-based integrated circuit. Low temperature grown Ge NWs hold a smaller size, similar uniformity, and better fit with Au tips in diameter, in contrast to Ge NWs grown at around or above the eutectic temperature of Au-Ge alloy in the vapor-liquid-solid (VLS) growth. Six ⟨110⟩ growth orientations were observed on Ge (110) by the VSS growth at ˜180 °C, differing from only one vertical growth direction of Ge NWs by the VLS growth at a high temperature. The evolution of NWs dimension and morphology from the VLS growth to the VSS growth is qualitatively explained by analyzing the mechanism of the two growth modes.
Berezhkovskiy, Leonid M
2013-02-01
The steady state, V(ss), terminal volume of distribution, V(β), and the terminal half-life, t(1/2), are commonly obtained from the drug plasma concentration-time profile, C(p)(t), following intravenous dosing. Unlike V(ss) that can be calculated based on the physicochemical properties of drugs considering the equilibrium partitioning between plasma and organ tissues, t(1/2) and V(β) cannot be calculated that way because they depend on the rates of drug transfer between blood and tissues. Considering the physiological pharmacokinetic model pertinent to the terminal phase of drug elimination, a novel equation that calculates t(1/2) (and consequently V(β)) was derived. It turns out that V(ss), the total body clearance, Cl, equilibrium blood-plasma concentration ratio, r; and the physiological parameters of the body such as cardiac output, and blood and tissue volumes are sufficient for determination of terminal kinetics. Calculation of t(1/2) by the obtained equation appears to be in good agreement with the experimentally observed vales of this parameter in pharmacokinetic studies in rat, monkey, dog, and human. The equation for the determination of the pre-exponent of the terminal phase of C(p)(t) is also found. The obtained equation allows to predict t(1/2) in human assuming that V(ss) and Cl were either obtained by allometric scaling or, respectively, calculated in silico or based on in vitro drug stability measurements. For compounds that have high clearance, the derived equation may be applied to calculate r just using the routine data on Cl, V(ss), and t(1/2), rather than doing the in vitro assay to measure this parameter. Copyright © 2012 Wiley Periodicals, Inc.
Limits to the development of feed-forward structures in large recurrent neuronal networks
Directory of Open Access Journals (Sweden)
Susanne Kunkel
2011-02-01
Full Text Available Spike-timing dependent plasticity (STDP has traditionally been of great interest to theoreticians, as it seems to provide an answer to the question of how the brain can develop functional structure in response to repeated stimuli. However, despite this high level of interest, convincing demonstrations of this capacity in large, initially random networks have not been forthcoming. Such demonstrations as there are typically rely on constraining the problem artificially. Techniques include employing additional pruning mechanisms or STDP rules that enhance symmetry breaking, simulating networks with low connectivity that magnify competition between synapses, or combinations of the above. In this paper we first review modeling choices that carry particularly high risks of producing non-generalizable results in the context of STDP in recurrent networks. We then develop a theory for the development of feed-forward structure in random networks and conclude that an unstable fixed point in the dynamics prevents the stable propagation of structure in recurrent networks with weight-dependent STDP. We demonstrate that the key predictions of the theory hold in large-scale simulations. The theory provides insight into the reasons why such development does not take place in unconstrained systems and enables us to identify candidate biologically motivated adaptations to the balanced random network model that might enable it.
Energy Technology Data Exchange (ETDEWEB)
Kim, Young-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Dong Gyu, E-mail: gknife@plaza.snu.ac.kr [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Han, Jung Ho [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Park, Jeong-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Chae-Yong [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Paek, Sun Ha; Jung, Hee-Won [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of)
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 {+-} 0.03 cm{sup 3} (range, 0.03-1.00 cm{sup 3}), and the mean marginal dose was 12.2 {+-} 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of {>=}20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average {>=}20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
Two separate thoroscopic segmentectomies with vessel sealing system.
Watanabe, Atsushi; Miyajima, Masahiro; Kawaharada, Nobuyoshi; Higami, Tetsuya
2012-04-01
Total thoracoscopic segmentectomy is an appealing concept in terms of providing a parenchyma-sparing treatment. We describe our technique of two seperate total thoracoscopic segmentectomies by using a vessel sealing system (VSS). A 76-year old female with four gradually enlarging ground glass lesions on the right segment 2 (10 and 3 mm) and segment 6 (8 and 3 mm) was admitted to our institute for surgical diagnosis and treatment. Preoperative three-dimensional computed tomography showed that the A2 is composed of descending A2 and ascending A2, branch of V6 coursed to V2 and B1a originated from B2 and B1b from B3. Two separate segmentectomies were subsequently scheduled. Pulmonary vessel division was performed with VSS after proximal ligation. Intersegmental division by VSS and electrocautery was performed with the use of inflation-deflation demarcation line and the pulmonary veins along the intersegmental plane (V2a and V2c for segment 2 and V6b and V6c for segment 6) as guides to confirm the intersegmental plane after pulmonary artery and bronchial divisions. The intraoperative frozen-section examinations revealed adenocarcinoma in situ. Two separate segmentectomies were successfully completed, with a total operative time of 240 min and blood loss of 30 ml. VSS is a very useful and safe device for intersegmental division and pulmonary vessel division.
Andreeva, J.; Dzhunov, I.; Karavakis, E.; Kokoszkiewicz, L.; Nowotka, M.; Saiz, P.; Tuckett, D.
2012-12-01
Improvements in web browser performance and web standards compliance, as well as the availability of comprehensive JavaScript libraries, provides an opportunity to develop functionally rich yet intuitive web applications that allow users to access, render and analyse data in novel ways. However, the development of such large-scale JavaScript web applications presents new challenges, in particular with regard to code sustainability and team-based work. We present an approach that meets the challenges of large-scale JavaScript web application design and development, including client-side model-view-controller architecture, design patterns, and JavaScript libraries. Furthermore, we show how the approach leads naturally to the encapsulation of the data source as a web API, allowing applications to be easily ported to new data sources. The Experiment Dashboard framework is used for the development of applications for monitoring the distributed computing activities of virtual organisations on the Worldwide LHC Computing Grid. We demonstrate the benefits of the approach for large-scale JavaScript web applications in this context by examining the design of several Experiment Dashboard applications for data processing, data transfer and site status monitoring, and by showing how they have been ported for different virtual organisations and technologies.
International Nuclear Information System (INIS)
Andreeva, J; Dzhunov, I; Karavakis, E; Kokoszkiewicz, L; Nowotka, M; Saiz, P; Tuckett, D
2012-01-01
Improvements in web browser performance and web standards compliance, as well as the availability of comprehensive JavaScript libraries, provides an opportunity to develop functionally rich yet intuitive web applications that allow users to access, render and analyse data in novel ways. However, the development of such large-scale JavaScript web applications presents new challenges, in particular with regard to code sustainability and team-based work. We present an approach that meets the challenges of large-scale JavaScript web application design and development, including client-side model-view-controller architecture, design patterns, and JavaScript libraries. Furthermore, we show how the approach leads naturally to the encapsulation of the data source as a web API, allowing applications to be easily ported to new data sources. The Experiment Dashboard framework is used for the development of applications for monitoring the distributed computing activities of virtual organisations on the Worldwide LHC Computing Grid. We demonstrate the benefits of the approach for large-scale JavaScript web applications in this context by examining the design of several Experiment Dashboard applications for data processing, data transfer and site status monitoring, and by showing how they have been ported for different virtual organisations and technologies.
Coexistence and conflict: IWRM and large-scale water infrastructure development in Piura, Peru
Directory of Open Access Journals (Sweden)
Megan Mills-Novoa
2017-06-01
Full Text Available Despite the emphasis of Integrated Water Resources Management (IWRM on 'soft' demand-side management, large-scale water infrastructure is increasingly being constructed in basins managed under an IWRM framework. While there has been substantial research on IWRM, few scholars have unpacked how IWRM and large-scale water infrastructure development coexist and conflict. Piura, Peru is an important site for understanding how IWRM and capital-intensive, concrete-heavy water infrastructure development articulate in practice. After 70 years of proposals and planning, the Regional Government of Piura began construction of the mega-irrigation project, Proyecto Especial de Irrigación e Hidroeléctrico del Alto Piura (PEIHAP in 2013. PEIHAP, which will irrigate an additional 19,000 hectares (ha, is being realised in the wake of major reforms in the ChiraPiura River Basin, a pilot basin for the IWRM-inspired 2009 Water Resources Law. We first map the historical trajectory of PEIHAP as it mirrors the shifting political priorities of the Peruvian state. We then draw on interviews with the newly formed River Basin Council, regional government, PEIHAP, and civil society actors to understand why and how these differing water management paradigms coexist. We find that while the 2009 Water Resources Law labels large-scale irrigation infrastructure as an 'exceptional measure', this development continues to eclipse IWRM provisions of the new law. This uneasy coexistence reflects the parallel desires of the state to imbue water policy reform with international credibility via IWRM while also furthering economic development goals via largescale water infrastructure. While the participatory mechanisms and expertise of IWRM-inspired river basin councils have not been brought to bear on the approval and construction of PEIHAP, these institutions will play a crucial role in managing the myriad resource and social conflicts that are likely to result.
Zhang, Pengsong; Jiang, Shanping; Yang, Linhua; Zhang, Bolun
2018-01-01
In order to meet the requirement of high precision thermal distortion measurement foraΦ4.2m deployable mesh antenna of satellite in vacuum and cryogenic environment, based on Digital Close-range Photogrammetry and Space Environment Test Technology of Spacecraft, a large scale antenna distortion measurement system under vacuum and cryogenic environment is developed in this paper. The antenna Distortion measurement system (ADMS) is the first domestic independently developed thermal distortion measurement system for large antenna, which has successfully solved non-contact high precision distortion measurement problem in large spacecraft structure under vacuum and cryogenic environment. The measurement accuracy of ADMS is better than 50 μm/5m, which has reached international advanced level. The experimental results show that the measurement system has great advantages in large structural measurement of spacecrafts, and also has broad application prospects in space or other related fields.
Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry
Khlevnoy, Boris; Grigoryeva, Irina; Anhalt, Klaus; Waehmer, Martin; Ivashin, Evgeniy; Otryaskin, Denis; Solodilov, Maxim; Sapritsky, Victor
2018-04-01
Large-area high-temperature fixed-point (HTFP) blackbodies with working temperatures of approximately 2748 K and 3021 K, based on an Re-C eutectic and a WC-C peritectic respectively, have been developed and investigated. The blackbodies have an emissivity of 0.9997, show high-quality phase-transition plateaus and have high repeatability of the melting temperatures, but demonstrate temperature differences (from 0.2 K to 0.6 K) compared with small-cell blackbodies of the same HTFP. We associate these temperature differences with the temperature drop effect, which may differ from cell to cell. The large radiating cavity diameter of 14 mm allows developed HTFP blackbodies to be used for photometric and radiometric applications in irradiance mode with uncertainties as small as 0.12% (k = 1) in the visible. A photometer and an irradiance-mode filter radiometer (visible range), previously calibrated at VNIIOFI, were used to measure illuminance and irradiance of the HTFP blackbodies equipped with a precise outer aperture. The values measured by the detectors agreed with those based on the blackbody calculation to within 0.2%. The large-area HTFP blackbodies will be used in a joint PTB-VNIIOFI experiment on measuring thermodynamic temperature.
International Nuclear Information System (INIS)
Green, M.A.
1977-05-01
The development of a unique type of large superconducting solenoid magnet, characterized by very high current density windings and a two-phase helium tubular cooling system is described. The development of the magnet's conceptual design and the construction of two test solenoids are described. The successful test of the superconducting coil and its tubular cooling refrigeration system is presented. The safety, environmental and economic impacts of the test program on future developments in high energy physics are shown. Large solid angle particle detectors for colliding beam physics will analyze both charged and neutral particles. In many cases, these detectors will require neutral particles, such as gamma rays, to pass through the magnet coil with minimum interaction. The magnet coils must be as thin as possible. The use of superconducting windings allows one to minimize radiation thickness, while at the same time maximizing charged particle momentum resolution and saving substantial quantities of electrical energy. The results of the experimental measurements show that large high current density solenoid magnets can be made to operate at high stored energies. The superconducting magnet development described has a positive safety and environmental impact. The use of large high current density thin superconducting solenoids has been proposed in two high energy physics experiments to be conducted at the Stanford Linear Accelerator Center and Cornell University as a result of the successful experiments described
Directory of Open Access Journals (Sweden)
Xinying Wang,
2012-01-01
Full Text Available Cassava residue from breweries is being generated in large amounts in Guangxi Province of China, and this has potential to cause serious environmental problems if disposed of improperly. Two-stage anaerobic fermentation is a promising method for the treatment of such residue. In this study, the effect of feed to microbes ratio (F/M ratio on the anaerobic acidogenic fermentation of cassava residue was studied to determine the optimal F/M ratio and to maximize the performance in a subsequent methanogenic stage. The experiments were carried out at the F/M ratios of 0.2, 0.61, 1.02, 2.05, 3.07, and 4.09 g cassava-TS/g sludge-VSS in six laboratory-scale, completely stirred, tank reactors (CSTR at mesophilic temperature (35°C. An F/M ratio of 1.02 g cassava-TS/g sludge-VSS resulted in the highest solid removal efficiency and VFA/COD ratio, while starch removal efficiency was still near 100 percent, and acidification was relatively high. As a further benefit, the VFA distribution was more suitable for the subsequent methanogenic fermentation stage.
Development of the simulation package 'ELSES' for extra-large-scale electronic structure calculation
International Nuclear Information System (INIS)
Hoshi, T; Fujiwara, T
2009-01-01
An early-stage version of the simulation package 'ELSES' (extra-large-scale electronic structure calculation) is developed for simulating the electronic structure and dynamics of large systems, particularly nanometer-scale and ten-nanometer-scale systems (see www.elses.jp). Input and output files are written in the extensible markup language (XML) style for general users. Related pre-/post-simulation tools are also available. A practical workflow and an example are described. A test calculation for the GaAs bulk system is shown, to demonstrate that the present code can handle systems with more than one atom species. Several future aspects are also discussed.
DESIGN AND DEVELOPMENT OF A LARGE SIZE NON-TRACKING SOLAR COOKER
Directory of Open Access Journals (Sweden)
N. M. NAHAR
2009-09-01
Full Text Available A large size novel non-tracking solar cooker has been designed, developed and tested. The cooker has been designed in such a way that the width to length ratio for reflector and glass window is about 4 so that maximum radiation falls on the glass window. This has helped in eliminating azimuthal tracking that is required in simple hot box solar cooker towards the Sun every hour because the width to length ratio of reflector is 1. It has been found that stagnation temperatures were 118.5oC and 108oC in large size non-tracking solar cooker and hot box solar cooker respectively. It takes about 2 h for soft food and 3 h for hard food. The cooker is capable of cooking 4.0 kg of food at a time. The efficiency of the large size non-tracking solar cooker has been found to be 27.5%. The cooker saves 5175 MJ of energy per year. The cost of the cooker is Rs. 10000.00 (1.0 US$ = Rs. 50.50. The payback period has been calculated by considering 10% annual interest, 5% maintenance cost and 5% inflation in fuel prices and maintenance cost. The payback period is least, i.e. 1.58 yr., with respect to electricity and maximum, i.e. 4.89 yr., with respect to kerosene. The payback periods are in increasing order with respect to fuel: electricity, coal, firewood, liquid petroleum gas, and kerosene. The shorter payback periods suggests that the use of large size non-tracking solar cooker is economical.
Hollow-fiber membrane bioreactor for the treatment of high-strength landfill leachate
Rizkallah, Marwan
2013-07-15
Performance assessment of membrane bioreactor (MBR) technology for the treatability of high-strength landfill leachate is relatively limited or lacking. This study examines the feasibility of treating high-strength landfill leachate using a hollow-fiber MBR. For this purpose, a laboratory-scale MBR was constructed and operated to treat leachate with a chemical oxygen demand (COD) of 9000-11,000 mg/l, a 5-day biochemical oxygen demand (BOD5) of 4000-6,000 mg/l, volatile suspended solids (VSS) of 300-500 mg/l, total nitrogen (TN) of 2000-6000 mg/l, and an ammonia-nitrogen (NH3-N) of 1800-4000 mg/l. VSS was used with the BOD and COD data to simulate the biological activity in the activated sludge. Removal efficiencies > 95-99% for BOD5, VSS, TN and NH3-N were attained. The coupled experimental and simulation results contribute in filling a gap in managing high-strength landfill leachate and providing guidelines for corresponding MBR application. © The Author(s) 2013.
Bolcar, Matthew R.; Balasubramanian, Kunjithapatham; Clampin, Mark; Crooke, Julie; Feinberg, Lee; Postman, Marc; Quijada, Manuel; Rauscher, Bernard; Redding, David; Rioux, Norman; Shaklan, Stuart; Stahl, H. Philip; Stahle, Carl; Thronson, Harley
2015-09-01
The Advanced Technology Large Aperture Space Telescope (ATLAST) team has identified five key technologies to enable candidate architectures for the future large-aperture ultraviolet/optical/infrared (LUVOIR) space observatory envisioned by the NASA Astrophysics 30-year roadmap, Enduring Quests, Daring Visions. The science goals of ATLAST address a broad range of astrophysical questions from early galaxy and star formation to the processes that contributed to the formation of life on Earth, combining general astrophysics with direct-imaging and spectroscopy of habitable exoplanets. The key technologies are: internal coronagraphs, starshades (or external occulters), ultra-stable large-aperture telescopes, detectors, and mirror coatings. Selected technology performance goals include: 1x10-10 raw contrast at an inner working angle of 35 milli-arcseconds, wavefront error stability on the order of 10 pm RMS per wavefront control step, autonomous on-board sensing and control, and zero-read-noise single-photon detectors spanning the exoplanet science bandpass between 400 nm and 1.8 μm. Development of these technologies will provide significant advances over current and planned observatories in terms of sensitivity, angular resolution, stability, and high-contrast imaging. The science goals of ATLAST are presented and flowed down to top-level telescope and instrument performance requirements in the context of a reference architecture: a 10-meter-class, segmented aperture telescope operating at room temperature (~290 K) at the sun-Earth Lagrange-2 point. For each technology area, we define best estimates of required capabilities, current state-of-the-art performance, and current Technology Readiness Level (TRL) - thus identifying the current technology gap. We report on current, planned, or recommended efforts to develop each technology to TRL 5.
Klewicki, J C; Chini, G P; Gibson, J F
2017-03-13
Recent and on-going advances in mathematical methods and analysis techniques, coupled with the experimental and computational capacity to capture detailed flow structure at increasingly large Reynolds numbers, afford an unprecedented opportunity to develop realistic models of high Reynolds number turbulent wall-flow dynamics. A distinctive attribute of this new generation of models is their grounding in the Navier-Stokes equations. By adhering to this challenging constraint, high-fidelity models ultimately can be developed that not only predict flow properties at high Reynolds numbers, but that possess a mathematical structure that faithfully captures the underlying flow physics. These first-principles models are needed, for example, to reliably manipulate flow behaviours at extreme Reynolds numbers. This theme issue of Philosophical Transactions of the Royal Society A provides a selection of contributions from the community of researchers who are working towards the development of such models. Broadly speaking, the research topics represented herein report on dynamical structure, mechanisms and transport; scale interactions and self-similarity; model reductions that restrict nonlinear interactions; and modern asymptotic theories. In this prospectus, the challenges associated with modelling turbulent wall-flows at large Reynolds numbers are briefly outlined, and the connections between the contributing papers are highlighted.This article is part of the themed issue 'Toward the development of high-fidelity models of wall turbulence at large Reynolds number'. © 2017 The Author(s).
Klewicki, J. C.; Chini, G. P.; Gibson, J. F.
2017-01-01
Recent and on-going advances in mathematical methods and analysis techniques, coupled with the experimental and computational capacity to capture detailed flow structure at increasingly large Reynolds numbers, afford an unprecedented opportunity to develop realistic models of high Reynolds number turbulent wall-flow dynamics. A distinctive attribute of this new generation of models is their grounding in the Navier–Stokes equations. By adhering to this challenging constraint, high-fidelity models ultimately can be developed that not only predict flow properties at high Reynolds numbers, but that possess a mathematical structure that faithfully captures the underlying flow physics. These first-principles models are needed, for example, to reliably manipulate flow behaviours at extreme Reynolds numbers. This theme issue of Philosophical Transactions of the Royal Society A provides a selection of contributions from the community of researchers who are working towards the development of such models. Broadly speaking, the research topics represented herein report on dynamical structure, mechanisms and transport; scale interactions and self-similarity; model reductions that restrict nonlinear interactions; and modern asymptotic theories. In this prospectus, the challenges associated with modelling turbulent wall-flows at large Reynolds numbers are briefly outlined, and the connections between the contributing papers are highlighted. This article is part of the themed issue ‘Toward the development of high-fidelity models of wall turbulence at large Reynolds number’. PMID:28167585
Eliciting the Intension of Drug Value Sets – Principles and Quality Assurance Applications
Bahr, Nathan J.; Nelson, Scott D.; Winnenburg, Rainer; Bodenreider, Olivier
2018-01-01
Value sets (VSs) used in electronic clinical quality measures are lists of codes from standard terminologies (“extensional” VSs), whose purpose (“intension”) is not always explicitly stated. We elicited the intension for the 09/01/2014 release of extensional medication value sets by comparison to drug classes from the October 2014 release of RxClass. Value sets matched drug classes if they shared common ingredients, as evidenced by Jaccard similarity score. We elicited the intension of 80 extensional value sets. The average Jaccard similarity was 0.65 for single classes and 0.80 for combination classes, with 34% (27/80) of the value sets having high similarity scores. Manual review by a pharmacist indicated 51% (41/80) of the drug classes selected as the best mapping for a value set matched the intension reflected in that value set name. This approach has the potential for facilitating the development and maintenance of medication value sets. PMID:29295218
Andreeva, J; Karavakis, E; Kokoszkiewicz, L; Nowotka, M; Saiz, P; Tuckett, D
2012-01-01
Improvements in web browser performance and web standards compliance, as well as the availability of comprehensive JavaScript libraries, provides an opportunity to develop functionally rich yet intuitive web applications that allow users to access, render and analyse data in novel ways. However, the development of such large-scale JavaScript web applications presents new challenges, in particular with regard to code sustainability and team-based work. We present an approach that meets the challenges of large-scale JavaScript web application design and development, including client-side model-view-controller architecture, design patterns, and JavaScript libraries. Furthermore, we show how the approach leads naturally to the encapsulation of the data source as a web API, allowing applications to be easily ported to new data sources. The Experiment Dashboard framework is used for the development of applications for monitoring the distributed computing activities of virtual organisations on the Worldwide LHC Comp...
CERN. Geneva
2012-01-01
Improvements in web browser performance and web standards compliance, as well as the availability of comprehensive JavaScript libraries, provides an opportunity to develop functionally rich yet intuitive web applications that allow users to access, render and analyse data in novel ways. However, the development of such large-scale JavaScript web applications presents new challenges, in particular with regard to code sustainability and team-based work. We present an approach that meets the challenges of large-scale JavaScript web application design and development, including client-side model-view-controller architecture, design patterns, and JavaScript libraries. Furthermore, we show how the approach leads naturally to the encapsulation of the data source as a web API, allowing applications to be easily ported to new data sources. The Experiment Dashboard framework is used for the development of applications for monitoring the distributed computing activities of virtual organisations on the Worldwide LHC Co...
Development of a large aperture Nb3Sn racetrack quadrupole magnet
International Nuclear Information System (INIS)
Ferracin, Paolo; Bartlett, Scott E.; Caspi, Shlomo; Dietderich, Daniel R.; Gourlay, Steven A.; Hannaford, Charles R.; Hafalia, AurelioR.; Lietzke, Alan F.; Mattafirri, Sara; McInturff, Alfred D.; Nyman, Mark; Sabbi, Gianluca
2005-01-01
The U.S. LHC Accelerator Research Program (LARP), a collaboration between BNL, FNAL, LBNL, and SLAC, has among its major objectives the development of advanced magnet technology for an LHC luminosity upgrade. The LBNL Superconducting Magnet Group supports this program with a broad effort involving design studies, Nb 3 Sn conductor development, mechanical models, and basic prototypes. This paper describes the development of a large aperture Nb 3 Sn racetrack quadrupole magnet using four racetrack coils from the LBNL Subscale Magnet (SM) Program. The magnet provides a gradient of 95 T/m in a 110 mm bore, with a peak field in the conductor of 11.2 T. The coils are prestressed by a mechanical structure based on a pre-tensioned aluminum shell, and axially supported with aluminum rods. The mechanical behavior has been monitored with strain gauges and the magnetic field has been measured. Results of the test are reported and analyzed
Developing eThread Pipeline Using SAGA-Pilot Abstraction for Large-Scale Structural Bioinformatics
Directory of Open Access Journals (Sweden)
Anjani Ragothaman
2014-01-01
Full Text Available While most of computational annotation approaches are sequence-based, threading methods are becoming increasingly attractive because of predicted structural information that could uncover the underlying function. However, threading tools are generally compute-intensive and the number of protein sequences from even small genomes such as prokaryotes is large typically containing many thousands, prohibiting their application as a genome-wide structural systems biology tool. To leverage its utility, we have developed a pipeline for eThread—a meta-threading protein structure modeling tool, that can use computational resources efficiently and effectively. We employ a pilot-based approach that supports seamless data and task-level parallelism and manages large variation in workload and computational requirements. Our scalable pipeline is deployed on Amazon EC2 and can efficiently select resources based upon task requirements. We present runtime analysis to characterize computational complexity of eThread and EC2 infrastructure. Based on results, we suggest a pathway to an optimized solution with respect to metrics such as time-to-solution or cost-to-solution. Our eThread pipeline can scale to support a large number of sequences and is expected to be a viable solution for genome-scale structural bioinformatics and structure-based annotation, particularly, amenable for small genomes such as prokaryotes. The developed pipeline is easily extensible to other types of distributed cyberinfrastructure.
DEFF Research Database (Denmark)
Andersen, Astrid Oberborbeck; Bruun, Thilde Bech; Egay, Kelvin
2016-01-01
the narratives that suggest that large-scale land development projects ‘bring development to the people’, utilising ‘idle lands’ and ‘creating employment’ to lift them out of poverty, we argue that political and economic processes related to cultivation of oil palm intersect with local community differences...
Piuz, F; Braem, A; Van beelen, J B; Lion, G; Gandi, A
2002-01-01
%RD26 %title\\\\ \\\\During the past two years, RD26 groups have focused their activities on the production of CsI-RICH prototypes of large area, up to a square meter, to demonstrate their application in High Energy experiments. Many large CsI-photocathodes (up to 40) were produced following the processing techniques furthermore developped in the collaboration. Taking the Quantum Efficiency (QE) measured at 180 nm as a comparative figure of merit of a CsI-PC. Figure 1 shows the increase of the performance while improvements were successively implemented in the PC processing sequence. Most efficient were the use of substrates made of nickel, the heat treatment and handling of the PCs under inert gas. Actually, three large systems based on CsI-RICH have got approval in the following HEP experiments: HADES at GSI, COMPASS/NA58 at CERN and HMPID/ALICE at LHC implying up to 14 square metres of CsI-PC. In addition, several CsI-RICH detectors have been successfully operated in the Threshold Imaging Detector at NA44 and ...
Directory of Open Access Journals (Sweden)
Gusakova Elena
2018-01-01
Full Text Available Conceptual planning and implementation of large-scale real estate development projects is one of the most difficult tasks in the organization of construction. In the Russian practice, a large experience of development, complex reorganization and redevelopment of large development areas is accumulated. The methodological basis for solving similar problems is the organizational and technological genesis, which considers the development of the project during the full life cycle. An analysis of this experience allows us to talk about the formation of new and effective approaches and methods within the organizational and technological genesis. Among them, the most significant and universal approaches should be highlighted: The concept of real estate development, which explains the reasons and objective needs for project transformations during its life cycle, as well as to increase the adaptive capabilities of design decisions and the project's suitability for the most likely future changes; Development project of joint action, which is based on the balance of interests of project participants; Master planning of the life cycle stages of the project and subprojects, based on the rethinking of the theory and methods of the construction organization, and allowing rationally localized construction sites and related subprojects, while retaining the remaining development and development area beyond of the negative effect of construction for comfortable living and work.
Microbial Methane Fermentation Kinetics for Toxicant Exposure.
1981-08-31
Algorithms of k and K s.*.*....*.............. . .... 241 Inhibition Coefficient Model .. .... ...... .... 252 Activity Model...enrichment culture was developed with sludge from an anaerobic digester. This system, a 400-liter, complete-mix ( CSTR ) reac- tor operated at a 50-day...reasonably constant. However, in a real CSTR , longer SRTs result in lower VSS levels. This is an area worthy of further study. Effect of Temperature
Development of a Methodology for Predicting Forest Area for Large-Area Resource Monitoring
William H. Cooke
2001-01-01
The U.S. Department of Agriculture, Forest Service, Southcm Research Station, appointed a remote-sensing team to develop an image-processing methodology for mapping forest lands over large geographic areds. The team has presented a repeatable methodology, which is based on regression modeling of Advanced Very High Resolution Radiometer (AVHRR) and Landsat Thematic...
Why droplet dimension can be larger than, equal to, or smaller than the nanowire dimension
Mohammad, S. Noor
2009-11-01
Droplets play central roles in the nanowire (NW) growth by vapor phase mechanisms. These mechanisms include vapor-liquid-solid (VLS), vapor-solid-solid or vapor-solid (VSS), vapor-quasisolid-solid or vapor-quasiliquid-solid (VQS), oxide-assisted growth (OAG), and self-catalytic growth (SCG) mechanisms. Fundamentals of the shape, size, characteristics, and dynamics of droplets and the impacts of them on the NW growth, have been studied. The influence of growth techniques, growth parameters (e.g., growth temperature, partial pressure, gas flow rates, etc.), thermodynamic conditions, surface and interface energy, molar volume, chemical potentials, etc. have been considered on the shapes and sizes of droplets. A model has been presented to explain why droplets can be larger than, equal to, or smaller than the associated NWs. Various growth techniques have been analyzed to understand defects created in NWs. Photoluminescence characteristics have been presented to quantify the roles of droplets in the creation of NW defects. The study highlights the importance of the purity of the droplet material. It attests to the superiority of the SCG mechanism, and clarifies the differences between the VSS, VQS, VLS, and SCG mechanisms. It explains why droplets produced by some mechanisms are visible but droplets produced by some other mechanisms are not visible. It elucidates the formation mechanisms of very large and very small droplets, and discusses the ground rules for droplets creating necked NWs. It puts forth reasons to demonstrate that very large droplets may not behave as droplets.
Choi, Ja Young; Park, Jieun; Choi, Yoon Seong; Goh, Yu Ra; Park, Eun Sook
2018-07-01
The aim of the present study was to investigate communication function using classification systems and its association with other functional profiles, including gross motor function, manual ability, intellectual functioning, and brain magnetic resonance imaging (MRI) characteristics in children with cerebral palsy (CP). This study recruited 117 individuals with CP aged from 4 to 16 years. The Communication Function Classification System (CFCS), Viking Speech Scale (VSS), Speech Language Profile Groups (SLPG), Gross Motor Function Classification System (GMFCS), Manual Ability Classification System (MACS), and intellectual functioning were assessed in the children along with brain MRI categorization. Very strong relationships were noted among the VSS, CFCS, and SLPG, although these three communication systems provide complementary information, especially for children with mid-range communication impairment. These three communication classification systems were strongly related with the MACS, but moderately related with the GMFCS. Multiple logistic regression analysis indicated that manual ability and intellectual functioning were significantly related with VSS and CFCS function, whereas only intellectual functioning was significantly related with SLPG functioning in children with CP. Communication function in children with a periventricular white matter lesion (PVWL) varied widely. In the cases with a PVWL, poor functioning was more common on the SLPG, compared to the VSS and CFCS. Very strong relationships were noted among three communication classification systems that are closely related with intellectual ability. Compared to gross motor function, manual ability seemed more closely related with communication function in these children. © Copyright: Yonsei University College of Medicine 2018.
Sewage sludge solubilization by high-pressure homogenization.
Zhang, Yuxuan; Zhang, Panyue; Guo, Jianbin; Ma, Weifang; Fang, Wei; Ma, Boqiang; Xu, Xiangzhe
2013-01-01
The behavior of sludge solubilization using high-pressure homogenization (HPH) treatment was examined by investigating the sludge solid reduction and organics solubilization. The sludge volatile suspended solids (VSS) decreased from 10.58 to 6.67 g/L for the sludge sample with a total solids content (TS) of 1.49% after HPH treatment at a homogenization pressure of 80 MPa with four homogenization cycles; total suspended solids (TSS) correspondingly decreased from 14.26 to 9.91 g/L. About 86.15% of the TSS reduction was attributed to the VSS reduction. The increase of homogenization pressure from 20 to 80 MPa or homogenization cycle number from 1 to 4 was favorable to the sludge organics solubilization, and the protein and polysaccharide solubilization linearly increased with the soluble chemical oxygen demand (SCOD) solubilization. More proteins were solubilized than polysaccharides. The linear relationship between SCOD solubilization and VSS reduction had no significant change under different homogenization pressures, homogenization cycles and sludge solid contents. The SCOD of 1.65 g/L was solubilized for the VSS reduction of 1.00 g/L for the three experimental sludge samples with a TS of 1.00, 1.49 and 2.48% under all HPH operating conditions. The energy efficiency results showed that the HPH treatment at a homogenization pressure of 30 MPa with a single homogenization cycle for the sludge sample with a TS of 2.48% was the most energy efficient.
Soares, Ana; Kampas, Pantelis; Maillard, Sarah; Wood, Elizabeth; Brigg, Jon; Tillotson, Martin; Parsons, Simon A; Cartmell, Elise
2010-03-15
There is a need to investigate processes that enable sludge re-use while enhancing sewage treatment efficiency. Mechanically disintegrated thickened surplus activated sludge (SAS) and fermented primary sludge were compared for their capacity to produce a carbon source suitable for BNR by completing nutrient removal predictive tests. Mechanically disintegration of SAS using a deflaker enhanced volatile fatty acids (VFAs) content from 92 to 374 mg l(-1) (4.1-fold increase). In comparison, primary sludge fermentation increased the VFAs content from 3.5 g l(-1) to a final concentration of 8.7 g l(-1) (2.5-fold increase). The carbon source obtained from disintegration and fermentation treatments improved phosphate (PO(4)-P) release and denitrification by up to 0.04 mg NO(3)-Ng(-1)VSS min(-1) and 0.031 mg PO(4)-Pg(-1)VSS min(-1), respectively, in comparison to acetate (0.023 mg NO(3)-Ng(-1)VSS min(-1)and 0.010 mg PO(4)-Pg(-1)VSS min(-1)). Overall, both types of sludge were suitable for BNR but disintegrated SAS displayed lower carbon to nutrient ratios of 8 for SCOD:PO(4)-P and 9 for SCOD:NO(3)-N. On the other hand, SAS increased the concentration of PO(4)-P in the settled sewage by a further 0.97 g PO(4)-P kg(-1)SCOD indicating its potential negative impact towards nutrient recycling in the BNR process. (c) 2009 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Kanlayanee Meesap
2012-01-01
Full Text Available The anaerobic hybrid reactor consisting of sludge and packed zones was operated with organic pollutant loading rates from 6.2 to 8.2 g COD/L day, composed mainly of suspended solids (SS and oil and grease (O&G concentrations between 5.2 to 10.2 and 0.9 to 1.9 g/L, respectively. The overall process performance in terms of chemical oxygen demands (COD, SS, and O&G removals was 73, 63, and 56%, respectively. When the organic pollutant concentrations were increased, the resultant methane potentials were higher, and the methane yield increased to 0.30 L CH4/g CODremoved. It was observed these effects on the microbial population and activity in the sludge and packed zones. The eubacterial population and activity in the sludge zone increased to 6.4 × 109 copies rDNA/g VSS and 1.65 g COD/g VSS day, respectively, whereas those in the packed zone were lower. The predominant hydrolytic and fermentative bacteria were Pseudomonas, Clostridium, and Bacteroidetes. In addition, the archaeal population and activity in the packed zone were increased from to 9.1 × 107 copies rDNA/g VSS and 0.34 g COD-CH4/g VSS day, respectively, whereas those in the sludge zone were not much changed. The most represented species of methanogens were the acetoclastic Methanosaeta, the hydrogenotrophic Methanobacterium sp., and the hydrogenotrophic Methanomicrobiaceae.
International Nuclear Information System (INIS)
Kim, Young-Hoon; Kim, Dong Gyu; Han, Jung Ho; Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo; Park, Jeong-Hoon; Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee; Kim, Chae-Yong; Paek, Sun Ha; Jung, Hee-Won
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 ± 0.03 cm 3 (range, 0.03-1.00 cm 3 ), and the mean marginal dose was 12.2 ± 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of ≥20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average ≥20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
Bolcar, Matthew R.
2017-09-01
The Large Ultraviolet / Optical / Infrared (LUVOIR) Surveyor is one of four large mission concept studies being developed by NASA for consideration in the 2020 Astrophysics Decadal Survey. LUVOIR will support a broad range of science objectives, including the direct imaging and spectral characterization of habitable exoplanets around sun-like stars, the study of galaxy formation and evolution, the epoch of reionization, star and planet formation, and the remote sensing of Solar System bodies. The LUVOIR Science and Technology Definition Team (STDT) has tasked a Technology Working Group (TWG), with more than 60 members from NASA centers, academia, industry, and international partners, with identifying technologies that enable or enhance the LUVOIR science mission. The TWG has identified such technologies in the areas of Coronagraphy, Ultra-Stable Opto-mechanical Systems, Detectors, Coatings, Starshades, and Instrument Components, and has completed a detailed assessment of the state-of-the-art. We present here a summary of this technology assessment effort, as well as the current progress in defining a technology development plan to mature these technologies to the required technology readiness level (TRL).
International Nuclear Information System (INIS)
B Bello; M Junker
2006-01-01
Hydrogen production by water electrolysis represents nearly 4 % of the world hydrogen production. Future development of hydrogen vehicles will require large quantities of hydrogen. Installation of large scale hydrogen production plants will be needed. In this context, development of low cost large scale electrolysers that could use 'clean power' seems necessary. ALPHEA HYDROGEN, an European network and center of expertise on hydrogen and fuel cells, has performed for its members a study in 2005 to evaluate the potential of large scale electrolysers to produce hydrogen in the future. The different electrolysis technologies were compared. Then, a state of art of the electrolysis modules currently available was made. A review of the large scale electrolysis plants that have been installed in the world was also realized. The main projects related to large scale electrolysis were also listed. Economy of large scale electrolysers has been discussed. The influence of energy prices on the hydrogen production cost by large scale electrolysis was evaluated. (authors)
Energy Technology Data Exchange (ETDEWEB)
NONE
1981-03-01
A survey is conducted over the subject matter by holding interviews with people, employed with the entrusted businesses participating in the large-scale industrial technology development system, who are engaged in the development of industrial technologies, and with people of experience or academic background involved in the project enhancement effort. Needs of improvement are pointed out that the competition principle based for example on parallel development be introduced; that research-on-research be practiced for effective task institution; midway evaluation be substantiated since prior evaluation is difficult; efforts be made to organize new industries utilizing the fruits of large-scale industrial technology for the creation of markets, not to induce economic conflicts; that transfer of technologies be enhanced from the private sector to public sector. Studies are made about the review of research conducting systems; utilization of the power of private sector research and development efforts; enlightening about industrial proprietorship; and the diffusion of large-scale project systems. In this connection, problems are pointed out, requests are submitted, and remedial measures and suggestions are presented. (NEDO)
Lin, Wen; Hong, Jin-Liern; Shen, Guoxiang; Wu, Rachel T.; Wu, Yuwen; Huang, Mou-Tuan; Newmark, Harold L.; Huang, Qingrong; Khor, Tin Oo; Heimbach, Tycho; Kong, Ah-Ng
2010-01-01
The pharmacokinetic disposition of a dietary cancer chemopreventive compound dibenzoylmethane (DBM) was studied in male Sprague-Dawley rats after intravenous (i.v.) and oral (p.o.) administrations. Following a single i.v. bolus dose, the mean plasma clearance (CL) of DBM was low as compared to the hepatic blood flow. DBM displayed a high volume of distribution (Vss). The elimination terminal t1/2 was long. The mean CL, Vss and AUC0-∞/dose were similar between the i.v. 10 and 10 mg/kg doses. A...
A Modular Approach To Developing A Large Deployable Reflector
Pittman, R.; Leidich, C.; Mascy, F.; Swenson, B.
1984-01-01
NASA is currently studying the feasibility of developing a Large Deployable Reflector (LDR) astronomical facility to perform astrophysical studies of the infrared and submillimeter portion of the spectrum in the mid 1990's. The LDR concept was recommended by the Astronomy Survey Committee of the National Academy of Sciences as one of two space based projects to be started this decade. The current baseline calls for a 20 m (65.6 ft) aperture telescope diffraction limited at 30 μm and automatically deployed from a single Shuttle launch. The volume, performance, and single launch constraints place great demands on the technology and place LDR beyond the state-of-the-art in certain areas such as lightweight reflector segments. The advent of the Shuttle is opening up many new options and capabilities for producing large space systems. Until now, LDR has always been conceived as an integrated system, deployed autonomously in a single launch. This paper will look at a combination of automatic deployment and on-orbit assembly that may reduce the technological complexity and cost of the LDR system. Many technological tools are now in use or under study that will greatly enhance our capabilities to do assembly in space. Two Shuttle volume budget scenarios will be examined to assess the potential of these tools to reduce the LDR system complexity. Further study will be required to reach the full optimal combination of deployment and assembly, since in most cases the capabilities of these new tools have not been demonstrated. In order to take maximum advantage of these concepts, the design of LDR must be flexible and allow one subsystem to be modified without adversely affecting the entire system. One method of achieving this flexibility is to use a modular design approach in which the major subsystems are physically separated during launch and assembled on orbit. A modular design approach facilitates this flexibility but requires that the subsystems be interfaced in a simple
Development of superconducting links for the Large Hadron Collider machine
Ballarino, Amalia
2014-04-01
In the framework of the upgrade of the Large Hadron Collider (LHC) machine, new superconducting lines are being developed for the feeding of the LHC magnets. The proposed electrical layout envisages the location of the power converters in surface buildings, and the transfer of the current from the surface to the LHC tunnel, where the magnets are located, via superconducting links containing tens of cables feeding different circuits and transferring altogether more than 150 kA. Depending on the location, the links will have a length ranging from 300 m to 500 m, and they will span a vertical distance of about 80 m. An overview of the R&D program that has been launched by CERN is presented, with special attention to the development of novel types of cables made from MgB2 and high temperature superconductors (Bi-2223 and REBCO) and to the results of the tests performed on prototype links. Plans for future activities are presented, together with a timeline for potential future integration in the LHC machine.
Development of superconducting links for the Large Hadron Collider machine
Ballarino, A
2014-01-01
In the framework of the upgrade of the Large Hadron Collider (LHC) machine, new superconducting lines are being developed for the feeding of the LHC magnets. The proposed electrical layout envisages the location of the power converters in surface buildings, and the transfer of the current from the surface to the LHC tunnel, where the magnets are located, via superconducting links containing tens of cables feeding different circuits and transferring altogether more than 150 kA. Depending on the location, the links will have a length ranging from 300 m to 500 m, and they will span a vertical distance of about 80 m. An overview of the R&D program that has been launched by CERN is presented, with special attention to the development of novel types of cables made from MgB 2 and high temperature superconductors (Bi-2223 and REBCO) and to the results of the tests performed on prototype links. Plans for future activities are presented, together with a timeline for potential future integration in the LHC machine.
Development and tests of large nuclear turbo-generator welded rotors
International Nuclear Information System (INIS)
Colombie, H.; Thiery, M.; Rotzinger, R.; Pelissou, C.; Tabacco, C.; Fernagut, V.
2015-01-01
Turbo-generators require large forgings for the rotor and it is a worldwide practice to manufacture turbo-generator rotor bodies as single piece forgings. Rotors for nuclear applications (4-pole rotors design, 1500/1800 rpm) require forgings of up to 2.0 m diameter and ultra large ingots with weight more than 500 tons. Nowadays only few forge masters can deliver such forgings in the world. Based on the large welding experience Alstom has gained over decades on steam and gas turbines and Alstom's multi piece shrunk turbo-generator rotors, it was suggested to manufacture 4-pole turbo-generator rotors by welding the shaft from aligned cylindrical forgings. Compared to turbine welded rotors, the shaft of a turbo-generator rotor presents differences linked to dimensions/weight, weld depth and electrical application. The manufacture of a 2 disc model allowed to prove through electrical and mechanical analysis the reliability of the concept as well as the reliability of the manufacturing processes through material tests, micro sections, electrical component tests, weld geometry, welding processes (TIG,SAW,...), weld inspection (Ultrasonic testing, radiographic inspection,...) weld heat treatments and machining. Then a full rotor able to replace a single forging rotor was manufactured in order to validate and prove to potential customers the validity of the welded rotor technology. During the first order from EDF of a welded 900 MW spare rotor, the procedure for the Non Destructive Test on a slotted rotor was developed upon EDF request in order to compare future Non Destructive Testing with the finger print of the new rotor. This complete rotor was delivered to EDF in January 2013. This rotor is in operation in a nuclear unit since November 2013. (authors)
Energy Technology Data Exchange (ETDEWEB)
White, M.J.; Iskander, M.F. [Univ. of Utah, Salt Lake City, UT (United States). Electrical Engineering Dept.; Kimrey, H.D. [Oak Ridge National Lab., TN (United States)
1996-12-31
The Finite-Difference Time-Domain (FDTD) code available at the University of Utah has been used to simulate sintering of ceramics in single and multimode cavities, and many useful results have been reported in literature. More detailed and accurate results, specifically around and including the ceramic sample, are often desired to help evaluate the adequacy of the heating procedure. In electrically large multimode cavities, however, computer memory requirements limit the number of the mathematical cells, and the desired resolution is impractical to achieve due to limited computer resources. Therefore, an FDTD algorithm which incorporates multiple-grid regions with variable-grid sizes is required to adequately perform the desired simulations. In this paper the authors describe the development of a three-dimensional multi-grid FDTD code to help focus a large number of cells around the desired region. Test geometries were solved using a uniform-grid and the developed multi-grid code to help validate the results from the developed code. Results from these comparisons, as well as the results of comparisons between the developed FDTD code and other available variable-grid codes are presented. In addition, results from the simulation of realistic microwave sintering experiments showed improved resolution in critical sites inside the three-dimensional sintering cavity. With the validation of the FDTD code, simulations were performed for electrically large, multimode, microwave sintering cavities to fully demonstrate the advantages of the developed multi-grid FDTD code.
International Nuclear Information System (INIS)
Theenhaus, R.
1978-01-01
The twelve large-scale research centres of the Federal Republic of Germany with their 16,000 employees represent a considerable scientific and technical potential. Cooperation with industry with regard to large-scale projects has already become very close and the know-how flow as well as the contributions to innovation connected therewith are largely established. The first successful steps to utilizing the results of basic research, of spin off and those within the frame of research and development as well as the fulfilling of services are encouraging. However, there is a number of detail problems which can only be solved between all parties concerned, in particular between industry and all large-scale research centres. (orig./RW) [de
Development of digital gamma-activation autoradiography for analysis of samples of large area
International Nuclear Information System (INIS)
Kolotov, V.P.; Grozdov, D.S.; Dogadkin, N.N.; Korobkov, V.I.
2011-01-01
Gamma-activation autoradiography is a prospective method for screening detection of inclusions of precious metals in geochemical samples. Its characteristics allow analysis of thin sections of large size (tens of cm2), that favourably distinguishes it among the other methods for local analysis. At the same time, the activating field of the accelerator bremsstrahlung, displays a sharp intensity decrease relative to the distance along the axis. A method for activation dose ''equalization'' during irradiation of the large size thin sections has been developed. The method is based on the usage of a hardware-software system. This includes a device for moving the sample during the irradiation, a program for computer modelling of the acquired activating dose for the chosen kinematics of the sample movement and a program for pixel-by pixel correction of the autoradiographic images. For detection of inclusions of precious metals, a method for analysis of the acquired dose dynamics during sample decay has been developed. The method is based on the software processing pixel by pixel a time-series of coaxial autoradiographic images and generation of the secondary meta-images allowing interpretation regarding the presence of interesting inclusions based on half-lives. The method is tested for analysis of copper-nickel polymetallic ores. The developed solutions considerably expand the possible applications of digital gamma-activation autoradiography. (orig.)
Development of digital gamma-activation autoradiography for analysis of samples of large area
Energy Technology Data Exchange (ETDEWEB)
Kolotov, V.P.; Grozdov, D.S.; Dogadkin, N.N.; Korobkov, V.I. [Russian Academy of Sciences, Moscow (Russian Federation). Vernadsky Inst. of Geochemistry and Analytical Chemistry
2011-07-01
Gamma-activation autoradiography is a prospective method for screening detection of inclusions of precious metals in geochemical samples. Its characteristics allow analysis of thin sections of large size (tens of cm2), that favourably distinguishes it among the other methods for local analysis. At the same time, the activating field of the accelerator bremsstrahlung, displays a sharp intensity decrease relative to the distance along the axis. A method for activation dose ''equalization'' during irradiation of the large size thin sections has been developed. The method is based on the usage of a hardware-software system. This includes a device for moving the sample during the irradiation, a program for computer modelling of the acquired activating dose for the chosen kinematics of the sample movement and a program for pixel-by pixel correction of the autoradiographic images. For detection of inclusions of precious metals, a method for analysis of the acquired dose dynamics during sample decay has been developed. The method is based on the software processing pixel by pixel a time-series of coaxial autoradiographic images and generation of the secondary meta-images allowing interpretation regarding the presence of interesting inclusions based on half-lives. The method is tested for analysis of copper-nickel polymetallic ores. The developed solutions considerably expand the possible applications of digital gamma-activation autoradiography. (orig.)
Development of polymers for large scale roll-to-roll processing of polymer solar cells
DEFF Research Database (Denmark)
Carlé, Jon Eggert
Development of polymers for large scale roll-to-roll processing of polymer solar cells Conjugated polymers potential to both absorb light and transport current as well as the perspective of low cost and large scale production has made these kinds of material attractive in solar cell research....... The research field of polymer solar cells (PSCs) is rapidly progressing along three lines: Improvement of efficiency and stability together with the introduction of large scale production methods. All three lines are explored in this work. The thesis describes low band gap polymers and why these are needed....... Polymer of this type display broader absorption resulting in better overlap with the solar spectrum and potentially higher current density. Synthesis, characterization and device performance of three series of polymers illustrating how the absorption spectrum of polymers can be manipulated synthetically...
Godvin Sharmila, V; Kavitha, S; Rajashankar, K; Yeom, Ick Tae; Rajesh Banu, J
2015-12-01
This investigation explores the influence of titanium dioxide (TiO2) in deflocculating (removal of extracellular polymeric substance - EPS) the sludge and subsequent biomass disintegration by bacterial pretreatment. The EPS removed at an optimized TiO2 dosage of 0.03g/g of SS of TiO2 and a solar radiation exposure time of 15min to enhance the subsequent bacterial disintegration. The outcomes of the bacterial pretreatment reveal SS reduction and COD solubilization for the deflocculated (EPS removed and bacterially pretreated) sludge was observed to be 22.8% and 22.9% which was comparatively greater than flocculated (raw sludge inoculated with bacteria) and control (raw) sludge. The higher methane production potential of about 0.43(gCOD/gVSS) was obtained in deflocculated sludge than the flocculated (0.20gCOD/gVSS) and control (0.073gCOD/gVSS). Economic assessment of this study provides a net profit of about 131.9USD/Ton in deflocculated sludge. Copyright © 2015 Elsevier Ltd. All rights reserved.
Han, Yuanyuan; Jin, Xibiao; Wang, Yuan; Liu, Yongdi; Chen, Xiurong
2014-02-01
Inhibition of nitrification by four typical pollutants (acrylonitrile, acrylic acid, acetonitrile and cyanide) in acrylonitrile wastewater was investigated. The inhibitory effect of cyanide on nitrification was strongest, with a 50% inhibitory concentration of 0.218 mg·gVSS-1 being observed in a municipal activated sludge system. However, the performance of nitrification was recovered when cyanide was completely degraded. The nitrification, which had been inhibited by 4.17 mg·gVSS-1 of free cyanide for 24 h, was recovered to greater than 95% of that without cyanide after 10 days of recovery. To overcome cyanide inhibition, cyanide-degrading bacteria were cultivated in a batch reactor by increasing the influent cyanide concentration in a stepwise manner, which resulted in an increase in the average cyanide degradation rate from 0.14 to 1.01 mg CN-·gVSS-1·h-1 over 20 days. The cultured cyanide-degrading bacteria were shaped like short rods, and the dominant cyanide-degrading bacteria strain was identified as Pseudomonas fluorescens NCIMB by PCR.
Tank 241-BY-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-108 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-108 using the vapor sampling system (VSS) on october 27, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 25.7 C. Air from the Tank BY-108 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 1, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Tank 241-BY-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-105 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-105 using the vapor sampling system (VSS) on July 7, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 26 C. Air from the Tank BY-105 headspace was withdrawn via a heated sampling probe mounted in riser 10A, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 65 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, Pacific Northwest Laboratories, and Oregon Graduate Institute of Science and Technology through a contract with Sandia National Laboratories. The 46 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 10 trip blanks provided by the laboratories
Tank 241-BY-110 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Low mass large aperture vacuum window development at CEBAF
International Nuclear Information System (INIS)
Keppel, C.
1995-01-01
Large aperture low mass vacuum windows are being developed for the HMS (High Momentum Spectrometer) and SOS (Short Orbit Spectrometer) spectrometers in Hall C at CEBAF. Because multiple scattering degrades the performance of a spectrometer it is important that the volume be evacuated and that the entrance and exit windows be as low mass as possible. The material used for such windows must be thin and light enough so as to have minimum effect of the beam, and at the same time, be thick and strong enough to operate reliably and safely. To achieve these goals, composite vacuum windows have been constructed of a thin sheet of Mylar with a reinforcing fabric. Reinforcing fabrics such as Kevlar and Spectra are available with tensile strengths significantly greater than that of Mylar. A thin layer of Myler remains necessary since the fabrics cannot achieve any sort of vacuum seal. The design, fabrication, testing, and operating experience with such composite windows for the Hall C spectrometers will be discussed
Development of a transverse mixing model for large scale impulsion phenomenon in tight lattice
International Nuclear Information System (INIS)
Liu, Xiaojing; Ren, Shuo; Cheng, Xu
2017-01-01
Highlights: • Experiment data of Krauss is used to validate the feasibility of CFD simulation method. • CFD simulation is performed to simulate the large scale impulsion phenomenon for tight-lattice bundle. • A mixing model to simulate the large scale impulsion phenomenon is proposed based on CFD result fitting. • The new developed mixing model has been added in the subchannel code. - Abstract: Tight-lattice is widely adopted in the innovative reactor fuel bundles design since it can increase the conversion ratio and improve the heat transfer between fuel bundles and coolant. It has been noticed that a large scale impulsion of cross-velocity exists in the gap region, which plays an important role on the transverse mixing flow and heat transfer. Although many experiments and numerical simulation have been carried out to study the impulsion of velocity, a model to describe the wave length, amplitude and frequency of mixing coefficient is still missing. This research work takes advantage of the CFD method to simulate the experiment of Krauss and to compare experiment data and simulation result in order to demonstrate the feasibility of simulation method and turbulence model. Then, based on this verified method and model, several simulations are performed with different Reynolds number and different Pitch-to-Diameter ratio. By fitting the CFD results achieved, a mixing model to simulate the large scale impulsion phenomenon is proposed and adopted in the current subchannel code. The new mixing model is applied to some fuel assembly analysis by subchannel calculation, it can be noticed that the new developed mixing model can reduce the hot channel factor and contribute to a uniform distribution of outlet temperature.
Development of large-capacity refrigeration at 1.8 K for the Large Hadron Collider at CERN
Lebrun, P; Claudet, G
1996-01-01
CERN, the European Laboratory for Particle Physics, is working towards the construction of the Large Hadron Collider (LHC), a high-energy, high-luminosity particle accelerator and collider [1] of 26.7 km circumference, due to start producing frontier physics, by bringing into collision intense proton and ion beams with centre-of-mass energies in the TeV-per-constituent range, at the beginning of the next century. The key technology for achieving this ambitious scientific goal at economically acceptable cost is the use of high-field superconducting magnets using Nb-Ti conductor operating in superfluid helium [2]. To maintain the some 25 km of bending and focusing magnets at their operating temperature of 1.9 K, the LHC cryogenic system will have to produce an unprecedented total refrigeration capacity of about 20 kW at 1.8 K, in eight cryogenic plants distributed around the machine circumference [3]. This has requested the undertaking of an industrial development programme, in the form of a collaboration betwe...
Manufacturing development of the Westinghouse Nb3Sn coil for the Large Coil Test Program
International Nuclear Information System (INIS)
Young, J.L.; Vota, T.L.; Singh, S.K.
1983-01-01
The Westinghouse Nb 3 Sn Magnet for the Oak Ridge National Laboratory Large Coil Program (LCP) is currently well into the manufacturing phase. This paper identifies the manufacturing processes and development tasks for his unique, advanced coil
Directory of Open Access Journals (Sweden)
Xinhua Ma
2016-03-01
Full Text Available The Lower Cambrian Longwangmiao Fm gas reservoir in Moxi block of the Anyue Gas field, Sichuan Basin, is the largest single-sandbody integrated carbonate gas reservoir proved so far in China. Notwithstanding this reservoir's advantages like large-scale reserves and high single-well productivity, there are multiple complicated factors restricting its efficient development, such as a median content of hydrogen sulfide, low porosity and strong heterogeneity of fracture–cave formation, various modes of gas–water occurrences, and close relation between overpressure and stress sensitivity. Up till now, since only a few Cambrian large-scale carbonate gas reservoirs have ever been developed in the world, there still exists some blind spots especially about its exploration and production rules. Besides, as for large-scale sulfur gas reservoirs, the exploration and construction is costly, and production test in the early evaluation stage is severely limited, all of which will bring about great challenges in productivity construction and high potential risks. In this regard, combining with Chinese strategic demand of strengthening clean energy supply security, the PetroChina Southwest Oil & Gas Field Company has carried out researches and field tests for the purpose of providing high-production wells, optimizing development design, rapidly constructing high-quality productivity and upgrading HSE security in the Longwangmiao Fm gas reservoir in Moxi block. Through the innovations of technology and management mode within 3 years, this gas reservoir has been built into a modern large-scale gas field with high quality, high efficiency and high benefit, and its annual capacity is now up to over 100 × 108 m3, with a desirable production capacity and development indexes gained as originally anticipated. It has become a new model of large-scale gas reservoirs with efficient development, providing a reference for other types of gas reservoirs in China.
Lee, Sohee; Kim, Ha Yan; Lee, Cho Rok; Park, Seulkee; Son, Haiyoung; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Chung, Woong Youn; Park, Cheong Soo
2014-07-01
Body image is associated with self-esteem and identity and has a close relationship with quality of life (QoL). We compared the impact of surgical scars on the patient's perception of body image between conventional open thyroidectomy (OT) and robotic thyroidectomy (RT) in female papillary thyroid carcinoma patients. From October 2009 to December 2010, we enrolled prospectively 116 papillary thyroid carcinoma patients who underwent total thyroidectomy at the Yonsei University Health System (Seoul, Korea). Of these 116 patients, 56 had OT and 60 RT. Their scars were assessed using the Vancouver Scar Scale (VSS), and psychometric properties were evaluated using the Body Image Scale (BIS) questionnaire postoperatively. Both groups were compared using cross-sectional and time-series methods. Mean age was significantly younger in the RT group. Regarding scar quality, the OT group showed superiority in scar pigmentation and the total VSS score during the early postoperative period, but the VSS score improved over time and was similar between both groups at 9 months. The RT group had better scores regarding most of the BIS items, a trend that remained relatively constant over time. In patients with noticeable scars (VSS ≥ 2) at 9 months, the RT group had better BIS scores regarding almost all items, including "self-conscious," "physical attractiveness," "feeling of less feminine," "sexual attractiveness," "dissatisfaction with body, scar and appearance when dressed," and "avoidance of people due to appearance." RT provides a better self-body image and improves QoL compared with conventional OT by avoiding a noticeable cervical scar. Copyright © 2014 Mosby, Inc. All rights reserved.
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Directory of Open Access Journals (Sweden)
Dieter Hildebrandt
2014-12-01
Full Text Available Modern 3D geovisualization systems (3DGeoVSs are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable manner, while exploiting images as efficient, decoupled and interoperable representations. The software architecture of a 3DGeoVS and its underlying visualization model have strong effects on the system’s quality attributes and support various system life cycle activities. This article contributes a software reference architecture (SRA for 3DGeoVSs based on SSI that can be used to design, describe and analyze concrete software architectures with the intended primary benefit of an increase in effectiveness and efficiency in such activities. The SRA integrates existing, proven technology and novel contributions in a unique manner. As the foundation for the SRA, we propose the generalized visualization pipeline model that generalizes and overcomes expressiveness limitations of the prevalent visualization pipeline model. To facilitate exploiting image-based representations (IReps, the SRA integrates approaches for the representation, provisioning and styling of and interaction with IReps. Five applications of the SRA provide proofs of concept for the general applicability and utility of the SRA. A qualitative evaluation indicates the overall suitability of the SRA, its applications and the general approach of building 3DGeoVSs based on SSI.
Colombi, Davide; Dinkel, Julien; Weinheimer, Oliver; Obermayer, Berenike; Buzan, Teodora; Nabers, Diana; Bauer, Claudia; Oltmanns, Ute; Palmowski, Karin; Herth, Felix; Kauczor, Hans Ulrich; Sverzellati, Nicola
2015-01-01
Objectives To describe changes over time in extent of idiopathic pulmonary fibrosis (IPF) at multidetector computed tomography (MDCT) assessed by semi-quantitative visual scores (VSs) and fully automatic histogram-based quantitative evaluation and to test the relationship between these two methods of quantification. Methods Forty IPF patients (median age: 70 y, interquartile: 62-75 years; M:F, 33:7) that underwent 2 MDCT at different time points with a median interval of 13 months (interquartile: 10-17 months) were retrospectively evaluated. In-house software YACTA quantified automatically lung density histogram (10th-90th percentile in 5th percentile steps). Longitudinal changes in VSs and in the percentiles of attenuation histogram were obtained in 20 untreated patients and 20 patients treated with pirfenidone. Pearson correlation analysis was used to test the relationship between VSs and selected percentiles. Results In follow-up MDCT, visual overall extent of parenchymal abnormalities (OE) increased in median by 5 %/year (interquartile: 0 %/y; +11 %/y). Substantial difference was found between treated and untreated patients in HU changes of the 40th and of the 80th percentiles of density histogram. Correlation analysis between VSs and selected percentiles showed higher correlation between the changes (Δ) in OE and Δ 40th percentile (r=0.69; phistogram analysis at one year follow-up of IPF patients, whether treated or untreated: Δ 40th percentile might reflect the change in overall extent of lung abnormalities, notably of ground-glass pattern; furthermore Δ 80th percentile might reveal the course of reticular opacities. PMID:26110421
Ye, Min; Nagar, Swati; Korzekwa, Ken
2015-01-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data was often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding, and blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for terminal elimination half-life (t1/2, 100% of drugs), peak plasma concentration (Cmax, 100%), area under the plasma concentration-time curve (AUC0–t, 95.4%), clearance (CLh, 95.4%), mean retention time (MRT, 95.4%), and steady state volume (Vss, 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. PMID:26531057
Gas Electron Multipliers: Development of large area GEMs and spherical GEMs
Duarte Pinto, Serge; Brock, Ian
2011-01-01
Gaseous radiation detectors have been a crucial part of high-energy physics instrumentation since the 1960s, when the first multiwire proportional counters were built. In the 1990s the first micropattern gas detectors (MPGDs) saw the light; with sub-millimeter feature sizes these novel detectors were faster and more accurate than their predecessors. The gas electron multiplier (GEM) is one of the most successful of these technologies. It is a charge multiplication structure made from a copper clad polymer foil, pierced with a regular and dense pattern of holes. I will describe the properties and the application of GEMs and GEM detectors, and the research and development I have done on this technology. Two of the main objectives were the development of large area GEMs (~m^2) for particle physics experiments and GEMs with a spherical shape for x-ray or neutron diffraction detectors. Both have been realized, and the new techniques involved are finding their way to applications in research and industry.
Gas electron multipliers. Development of large area GEMS and spherical GEMS
Energy Technology Data Exchange (ETDEWEB)
Pinto, Serge Duarte
2011-08-15
Gaseous radiation detectors have been a crucial part of high-energy physics instrumentation since the 1960s, when the first multiwire proportional counters were built. In the 1990s the first micropattern gas detectors (MPGDS) saw the light; with sub-millimeter feature sizes these novel detectors were faster and more accurate than their predecessors. The gas electron multiplier (GEM) is one of the most successful of these technologies. It is a charge multiplication structure made from a copper clad polymer foil, pierced with a regular and dense pattern of holes. I describe the properties and the application of GEMs and GEM. detectors, and the research and development I have done on this technology. Two of the main objectives were the development of large area GEMs ({proportional_to}m{sup 2}) for particle physics experiments and GEMs with a spherical shape for X-ray or neutron diffraction detectors. Both have been realized, and the new techniques involved are finding their way to applications in research and industry. (orig.)
Gas electron multipliers: Development of large area GEMS and spherical GEMS
International Nuclear Information System (INIS)
Pinto, Serge Duarte
2011-08-01
Gaseous radiation detectors have been a crucial part of high-energy physics instrumentation since the 1960s, when the first multiwire proportional counters were built. In the 1990s the first micropattern gas detectors (MPGDS) saw the light; with sub-millimeter feature sizes these novel detectors were faster and more accurate than their predecessors. The gas electron multiplier (GEM) is one of the most successful of these technologies. It is a charge multiplication structure made from a copper clad polymer foil, pierced with a regular and dense pattern of holes. I describe the properties and the application of GEMs and GEM. detectors, and the research and development I have done on this technology. Two of the main objectives were the development of large area GEMs (∝m 2 ) for particle physics experiments and GEMs with a spherical shape for X-ray or neutron diffraction detectors. Both have been realized, and the new techniques involved are finding their way to applications in research and industry. (orig.)
Bekele, M.S.
2016-01-01
This study examined impacts of large-scale farming in Ethiopia on local economic development, household food security, incomes, employment, and the environment. The study adopted a mixed research approach in which both qualitative and quantitative data were generated from secondary and primary
Development of Large Sample Neutron Activation Technique for New Applications in Thailand
International Nuclear Information System (INIS)
Laoharojanaphand, S.; Tippayakul, C.; Wonglee, S.; Channuie, J.
2018-01-01
The development of the Large Sample Neutron Activation Analysis (LSNAA) in Thailand is presented in this paper. The technique had been firstly developed with rice sample as the test subject. The Thai Research Reactor-1/Modification 1 (TRR-1/M1) was used as the neutron source. The first step was to select and characterize an appropriate irradiation facility for the research. An out-core irradiation facility (A4 position) was first attempted. The results performed with the A4 facility were then used as guides for the subsequent experiments with the thermal column facility. The characterization of the thermal column was performed with Cu-wire to determine spatial distribution without and with rice sample. The flux depression without rice sample was observed to be less than 30% while the flux depression with rice sample increased to within 60%. The flux monitors internal to the rice sample were used to determine average flux over the rice sample. The gamma selfshielding effect during gamma measurement was corrected using the Monte Carlo simulation. The ratio between the efficiencies of the volume source and the point source for each energy point was calculated by the MCNPX code. The research team adopted the k0-NAA methodology to calculate the element concentration in the research. The k0-NAA program which developed by IAEA was set up to simulate the conditions of the irradiation and measurement facilities used in this research. The element concentrations in the bulk rice sample were then calculated taking into account the flux depression and gamma efficiency corrections. At the moment, the results still show large discrepancies with the reference values. However, more research on the validation will be performed to identify sources of errors. Moreover, this LS-NAA technique was introduced for the activation analysis of the IAEA archaeological mock-up. The results are provided in this report. (author)
Early development of Ensatina eschscholtzii: an amphibian with a large, yolky egg
Directory of Open Access Journals (Sweden)
Collazo Andres
2010-08-01
Full Text Available Abstract Background Comparative analyses between amphibians, concentrating on the cellular mechanisms of morphogenesis, reveal a large variability in the early developmental processes that were thought to be conserved during evolution. Increased egg size is one factor that could have a strong effect on early developmental processes such as cleavage pattern and gastrulation. Salamanders of the family Plethodontidae are particularly appropriate for such comparative studies because the species have eggs of varying size, including very large yolky eggs. Results In this paper, we describe for the first time the early development (from fertilization through neurulation of the plethodontid salamander Ensatina eschscholtzii. This species has one of the largest eggs known for an amphibian, with a mean ± SD diameter of 6 ± 0.43 mm (range 5.3-6.9; n = 17 eggs. Cleavage is meroblastic until approximately the 16-cell stage (fourth or fifth cleavage. At the beginning of gastrulation, the blastocoel roof is one cell thick, and the dorsal lip of the blastopore forms below the equator of the embryo. The ventral lip of the blastopore forms closer to the vegetal pole, and relatively little involution occurs during gastrulation. Cell migration is visible through the transparent blastocoel roof of the gastrula. At the end of gastrulation, a small archenteron spreading dorsally from the blastopore represents the relatively small and superficial area of the egg where early embryonic axis formation occurs. The resulting pattern is similar to the embryonic disk described for one species of anuran. Conclusions Comparisons with the early development of other species of amphibians suggest that an evolutionary increase in egg size can result in predictable changes in the patterns and rate of early development, but mainly within an evolutionary lineage.
Lutwack, R.
1974-01-01
A technical assessment of a program to develop photovoltaic power system technology for large-scale national energy applications was made by analyzing and judging the alternative candidate photovoltaic systems and development tasks. A program plan was constructed based on achieving the 10 year objective of a program to establish the practicability of large-scale terrestrial power installations using photovoltaic conversion arrays costing less than $0.50/peak W. Guidelines for the tasks of a 5 year program were derived from a set of 5 year objectives deduced from the 10 year objective. This report indicates the need for an early emphasis on the development of the single-crystal Si photovoltaic system for commercial utilization; a production goal of 5 x 10 to the 8th power peak W/year of $0.50 cells was projected for the year 1985. The developments of other photovoltaic conversion systems were assigned to longer range development roles. The status of the technology developments and the applicability of solar arrays in particular power installations, ranging from houses to central power plants, was scheduled to be verified in a series of demonstration projects. The budget recommended for the first 5 year phase of the program is $268.5M.
Development and evaluation of fully automated demand response in large facilities
Energy Technology Data Exchange (ETDEWEB)
Piette, Mary Ann; Sezgen, Osman; Watson, David S.; Motegi, Naoya; Shockman, Christine; ten Hope, Laurie
2004-03-30
This report describes the results of a research project to develop and evaluate the performance of new Automated Demand Response (Auto-DR) hardware and software technology in large facilities. Demand Response (DR) is a set of activities to reduce or shift electricity use to improve electric grid reliability, manage electricity costs, and ensure that customers receive signals that encourage load reduction during times when the electric grid is near its capacity. The two main drivers for widespread demand responsiveness are the prevention of future electricity crises and the reduction of electricity prices. Additional goals for price responsiveness include equity through cost of service pricing, and customer control of electricity usage and bills. The technology developed and evaluated in this report could be used to support numerous forms of DR programs and tariffs. For the purpose of this report, we have defined three levels of Demand Response automation. Manual Demand Response involves manually turning off lights or equipment; this can be a labor-intensive approach. Semi-Automated Response involves the use of building energy management control systems for load shedding, where a preprogrammed load shedding strategy is initiated by facilities staff. Fully-Automated Demand Response is initiated at a building or facility through receipt of an external communications signal--facility staff set up a pre-programmed load shedding strategy which is automatically initiated by the system without the need for human intervention. We have defined this approach to be Auto-DR. An important concept in Auto-DR is that a facility manager is able to ''opt out'' or ''override'' an individual DR event if it occurs at a time when the reduction in end-use services is not desirable. This project sought to improve the feasibility and nature of Auto-DR strategies in large facilities. The research focused on technology development, testing
Varadhan, S R S
2016-01-01
The theory of large deviations deals with rates at which probabilities of certain events decay as a natural parameter in the problem varies. This book, which is based on a graduate course on large deviations at the Courant Institute, focuses on three concrete sets of examples: (i) diffusions with small noise and the exit problem, (ii) large time behavior of Markov processes and their connection to the Feynman-Kac formula and the related large deviation behavior of the number of distinct sites visited by a random walk, and (iii) interacting particle systems, their scaling limits, and large deviations from their expected limits. For the most part the examples are worked out in detail, and in the process the subject of large deviations is developed. The book will give the reader a flavor of how large deviation theory can help in problems that are not posed directly in terms of large deviations. The reader is assumed to have some familiarity with probability, Markov processes, and interacting particle systems.
Boulade, Olivier; Moreau, Vincent; Mulet, Patrick; Gravrand, Olivier; Cervera, Cyril; Zanatta, Jean-Paul; Castelein, Pierre; Guellec, Fabrice; Fièque, Bruno; Chorier, Philippe; Roumegoux, Julien
2016-07-01
CEA and SOFRADIR have been manufacturing and characterizing near infrared detectors in the frame of ESA's near infrared large format sensor array roadmap to develop a 2Kx2K large format low flux low noise device for space applications such as astrophysics. These detectors use HgCdTe as the absorbing material and p/n diode technology. The technological developments (photovoltaic technology, readout circuit, ...) are shared between CEA/LETI and SOFRADIR, both in Grenoble, while most of the performances are evaluated at CEA/IRFU in Saclay where a dedicated test facility has been developed, in particular to measure very low dark currents. The paper will present the current status of these developments at the end of ESA's NIRLFSA phase 2. The performances of the latest batch of devices meet or are very close to all the requirements (quantum efficiency, dark current, cross talk, readout noise, ...) even though a glow induced by the ROIC prevents the accurate measurement of the dark current. The current devices are fairly small, 640x512 15μm pixels, and the next phase of activity will target the development of a full size 2Kx2K detector. From the design and development, to the manufacturing and finally the testing, that type of detector requests a high level of mastering. An appropriate manufacturing and process chain compatible with such a size is needed at industrial level and results obtained with CEA technology coupled with Sofradir industrial experience and work on large dimension detector allow French actors to be confident to address this type of future missions.
Li, Wei; Yu, Najiaowa; Liu, Qian; Li, Yiran; Ren, Nanqi; Xing, Defeng
2018-09-01
Sludge disintegration by ultrasound is a promising sludge treatment method. In order to enhance the efficiency of the sludge reduction and hydrolysis, potassium ferrate (K 2 FeO 4 ) (PF) was used. A novel method was developed to improve the sludge disintegration-sludge pretreatment by using PF in combination with an ultrasonic treatment (PF + ULT). After a short-term PF + ULT treatment, 17.23% of the volatile suspended solids (VSS) were reduced after a 900-min reaction time, which is 61.3% higher than the VSS reduction for the raw sludge. The supernatant soluble chemical oxygen demand (SCOD), total nitrogen (TN), volatile fatty acids (VFAs), soluble protein and polysaccharides increased by 522.5%, 1029.4%, 878.4%, 2996.6% and 801.9%, respectively. The constituent parts of the dissolved organic matter of the sludge products were released efficiently, which demonstrated the positive effect caused by the PF + ULT. The enhanced sludge disintegration process further alleviates environmental risk and offers a more efficient and convenient method for utilizing sludge. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Tsubaki, Junichiro
2012-01-01
The new filtration and condensation techniques that decontaminate effectively the large quantity of contaminated soils, was developed. The facility treating the soils of 5 tons per day is being developed. (M.H.)
International Nuclear Information System (INIS)
Pellarin, D.J.; Bickford, D.F.
1985-01-01
This report describes the test equipment and methods, and documents the results of the first large-scale MCC-1 experiments in the Large Scale Leach Test Facility (LSLTF). Two experiments were performed using 1-ft-long samples sectioned from the middle of canister MS-11. The leachant used in the experiments was ultrapure deionized water - an aggressive and well characterized leachant providing high sensitivity for liquid sample analyses. All the original test plan objectives have been successfully met. Equipment and procedures have been developed for large-sample-size leach testing. The statistical reliability of the method has been determined, and ''bench mark'' data developed to relate small scale leach testing to full size waste forms. The facility is unique, and provides sampling reliability and flexibility not possible in smaller laboratory scale tests. Future use of this facility should simplify and accelerate the development of leaching models and repository specific data. The factor of less than 3 for leachability, corresponding to a 200,000/1 increase in sample volume, enhances the credibility of small scale test data which precedes this work, and supports the ability of the DWPF waste form to meet repository criteria
Assessing large-scale wildlife responses to human infrastructure development.
Torres, Aurora; Jaeger, Jochen A G; Alonso, Juan Carlos
2016-07-26
Habitat loss and deterioration represent the main threats to wildlife species, and are closely linked to the expansion of roads and human settlements. Unfortunately, large-scale effects of these structures remain generally overlooked. Here, we analyzed the European transportation infrastructure network and found that 50% of the continent is within 1.5 km of transportation infrastructure. We present a method for assessing the impacts from infrastructure on wildlife, based on functional response curves describing density reductions in birds and mammals (e.g., road-effect zones), and apply it to Spain as a case study. The imprint of infrastructure extends over most of the country (55.5% in the case of birds and 97.9% for mammals), with moderate declines predicted for birds (22.6% of individuals) and severe declines predicted for mammals (46.6%). Despite certain limitations, we suggest the approach proposed is widely applicable to the evaluation of effects of planned infrastructure developments under multiple scenarios, and propose an internationally coordinated strategy to update and improve it in the future.
Development of Large-Format Lithium-Ion Cells with Silicon Anode and Low Flammable Electrolyte
Wu, James J.; Hernandez-Lugo, D. M.; Smart, M. C.; Ratnakumar, B. V.; Miller, T. B.; Lvovich, V. F.; Lytle, J. K.
2014-01-01
NASA is developing safe, high energy and high capacity lithium-ion cell designs and batteries for future missions under NASAs Advanced Space Power System (ASPS) project. Advanced cell components, such as high specific capacity silicon anodes and low-flammable electrolytes have been developed for improving the cell specific energy and enhancing safety. To advance the technology readiness level, we have developed large-format flight-type hermetically sealed battery cells by incorporating high capacity silicon anodes, commercially available lithium nickel, cobalt, aluminum oxide (NCA) cathodes, and low-flammable electrolytes. In this report, we will present the performance results of these various battery cells. In addition, we will also discuss the post-test cell analysis results as well.
Lifescience Database Archive (English)
Full Text Available avtlllelhlhvmhfvtq*lhvqmdllmevklfhlhlfqtvnskvqvhliaqql i*kv*watgntks*nlylqlliyiqvv**edlc*vlvf*sdsyw*svh*vss*...nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnkk kckytinslsy*cnhnktsrkffkeqnki Frame B: ---hic
Research and development of safeguards measures for the large scale reprocessing plant
Energy Technology Data Exchange (ETDEWEB)
Kikuchi, Masahiro; Sato, Yuji; Yokota, Yasuhiro; Masuda, Shoichiro; Kobayashi, Isao; Uchikoshi, Seiji; Tsutaki, Yasuhiro; Nidaira, Kazuo [Nuclear Material Control Center, Tokyo (Japan)
1994-12-31
The Government of Japan agreed on the safeguards concepts of commercial size reprocessing plant under the bilateral agreement for cooperation between the Japan and the United States. In addition, the LASCAR, that is the forum of large scale reprocessing plant safeguards, could obtain the fruitful results in the spring of 1992. The research and development of safeguards measures for the Rokkasho Reprocessing Plant should be progressed with every regard to the concepts described in both documents. Basically, the material accountancy and monitoring system should be established, based on the NRTA and other measures in order to obtain the timeliness goal for plutonium, and the un-attended mode inspection approach based on the integrated containment/surveillance system coupled with radiation monitoring in order to reduce the inspection efforts. NMCC has been studying on the following measures for a large scale reprocessing plant safeguards (1) A radiation gate monitor and integrated surveillance system (2) A near real time Shipper and Receiver Difference monitoring (3) A near real time material accountancy system operated for the bulk handling area (4) A volume measurement technique in a large scale input accountancy vessel (5) An in-process inventory estimation technique applied to the process equipment such as the pulse column and evaporator (6) Solution transfer monitoring approach applied to buffer tanks in the chemical process (7) A timely analysis technique such as a hybrid K edge densitometer operated in the on-site laboratory (J.P.N.).
Rules of song development and their use in vocal interactions by birds with large repertoires.
Geberzahn, Nicole; Hultsch, Henrike
2004-06-01
Songbirds are well known for settling their disputes by vocal signals, and their singing plays a dominant role. Most studies on this issue have concentrated on bird species that develop and use small vocal repertoires. In this article we will go farther and focus on examples of how species with large song repertoires make use of their vocal competence. In particular, we will outline the study of interaction rules which have been elucidated by examining time- and pattern-specific relationships between signals exchanged by territorial neighbors. First we present an inquiry into the rules of song learning and development. In birds with large song repertoires, the ontogeny of such rules proceeds along a number of trajectories which help in understanding the often remarkable accomplishments of adult birds. In both approaches, our model species will be the Common Nightingale Luscinia megarhynchos that has been investigated intensively in the field and in the laboratory.
Development of a large scale Chimera grid system for the Space Shuttle Launch Vehicle
Pearce, Daniel G.; Stanley, Scott A.; Martin, Fred W., Jr.; Gomez, Ray J.; Le Beau, Gerald J.; Buning, Pieter G.; Chan, William M.; Chiu, Ing-Tsau; Wulf, Armin; Akdag, Vedat
1993-01-01
The application of CFD techniques to large problems has dictated the need for large team efforts. This paper offers an opportunity to examine the motivations, goals, needs, problems, as well as the methods, tools, and constraints that defined NASA's development of a 111 grid/16 million point grid system model for the Space Shuttle Launch Vehicle. The Chimera approach used for domain decomposition encouraged separation of the complex geometry into several major components each of which was modeled by an autonomous team. ICEM-CFD, a CAD based grid generation package, simplified the geometry and grid topology definition by provoding mature CAD tools and patch independent meshing. The resulting grid system has, on average, a four inch resolution along the surface.
Energy Technology Data Exchange (ETDEWEB)
Takita, M [New Energy and Industrial Technology Development Organization, Tokyo (Japan)
1994-12-01
Described herein are the results of the FY1994 research program for development of large scale wind energy conversion system. The study on technological development of key components evaluates performance of, and confirms reliability and applicability of, hydraulic systems centered by those equipped with variable pitch mechanisms and electrohydraulic servo valves that control them. The study on blade conducts fatigue and crack-propagation tests, which show that the blades developed have high strength. The study on speed-increasing gear conducts load tests, confirming the effects of reducing vibration and noise by modification of the gear teeth. The study on NACELLE cover conducts vibration tests to confirm its vibration characteristics, and analyzes three-dimensional vibration by the finite element method. Some components for a 500kW commercial wind mill are fabricated, including rotor heads, variable pitch mechanisms, speed-increasing gears, YAW systems, and hydraulic control systems. The others fabricated include a remote supervisory control system for maintenance, system to integrate the wind mill into a power system, and electrical control devices in which site conditions, such as atmospheric temperature and lightening, are taken into consideration.
Should we build more large dams? The actual costs of hydropower megaproject development
International Nuclear Information System (INIS)
Ansar, Atif; Flyvbjerg, Bent; Budzier, Alexander; Lunn, Daniel
2014-01-01
A brisk building boom of hydropower mega-dams is underway from China to Brazil. Whether benefits of new dams will outweigh costs remains unresolved despite contentious debates. We investigate this question with the “outside view” or “reference class forecasting” based on literature on decision-making under uncertainty in psychology. We find overwhelming evidence that budgets are systematically biased below actual costs of large hydropower dams—excluding inflation, substantial debt servicing, environmental, and social costs. Using the largest and most reliable reference data of its kind and multilevel statistical techniques applied to large dams for the first time, we were successful in fitting parsimonious models to predict cost and schedule overruns. The outside view suggests that in most countries large hydropower dams will be too costly in absolute terms and take too long to build to deliver a positive risk-adjusted return unless suitable risk management measures outlined in this paper can be affordably provided. Policymakers, particularly in developing countries, are advised to prefer agile energy alternatives that can be built over shorter time horizons to energy megaprojects. - Highlights: • We investigate ex post outcomes of schedule and cost estimates of hydropower dams. • We use the “outside view” based on Kahneman and Tversky's research in psychology. • Estimates are systematically and severely biased below actual values. • Projects that take longer have greater cost overruns; bigger projects take longer. • Uplift required to de-bias systematic cost underestimation for large dams is +99%
Development of a large-scale general purpose two-phase flow analysis code
International Nuclear Information System (INIS)
Terasaka, Haruo; Shimizu, Sensuke
2001-01-01
A general purpose three-dimensional two-phase flow analysis code has been developed for solving large-scale problems in industrial fields. The code uses a two-fluid model to describe the conservation equations for two-phase flow in order to be applicable to various phenomena. Complicated geometrical conditions are modeled by FAVOR method in structured grid systems, and the discretization equations are solved by a modified SIMPLEST scheme. To reduce computing time a matrix solver for the pressure correction equation is parallelized with OpenMP. Results of numerical examples show that the accurate solutions can be obtained efficiently and stably. (author)
Seifvand, Atiyeh
2012-01-01
Software innovations can offer organizations with competitive advantages. Research and development entities within the petroleum industry therefore seek to utilize IT capabilities to produce innovative software. Many factors may influence the success or failure of developing and implementing research-based software innovations in organizations. Of these issues the relation between software innovation and IT governance remains largely unexplored in the research literature.This study explores t...
Energy Technology Data Exchange (ETDEWEB)
Babu, Sudarsanam Suresh [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Manufacturing Demonstration Facility; Love, Lonnie J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Manufacturing Demonstration Facility; Peter, William H. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Manufacturing Demonstration Facility; Dehoff, Ryan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Manufacturing Demonstration Facility
2016-05-01
) systems development, (iv) material feedstock, (v) process planning, (vi) residual stress & distortion, (vii) post-processing, (viii) qualification of parts, (ix) supply chain and (x) business case. Furthermore, an open innovation network methodology was proposed to accelerate the development and deployment of new large-scale metal additive manufacturing technology with the goal of creating a new generation of high deposition rate equipment, affordable feed stocks, and large metallic components to enhance America’s economic competitiveness.
International Nuclear Information System (INIS)
Oshita, Kazuyuki; Fujime, Motochika; Takaoka, Masaki; Fujimori, Takashi; Appels, Lise; Dewil, Raf
2015-01-01
Highlights: • Siloxanes hamper the energy-use of anaerobic digestion biogas. • D5 siloxane was considered as target compound in this study. • The treatment removed 80% of D5 in sewage sludge at 55 °C and 135 g-NaOH kg −1 -VTS. • D5 removal and the disintegration of VSS in the sludge were correlated. • At the optimal conditions, the costs of anaerobic digestion were notably diminished. - Abstract: A thermo-alkaline treatment with air stripping was applied before anaerobic sludge digestion for both siloxane removal and sludge disintegration. The treatment was expected to increase the amount of biogas produced and to reduce the amount of siloxane in the gas. Adding sodium hydroxide (NaOH) to the sludge improved the removal of siloxane from the sludge, with approximately 90% of the siloxane removed to the gas phase using a thermo-alkaline treatment. Over 80% of decamethylcyclopentasiloxane (D5) could be removed under the following conditions: 55 °C treatment temperature, 135 g-NaOH kg −1 volatile total solids (VTS), and 0.5 L min −1 air-stripping rate. The disintegration ratio of volatile suspended solids (VSS) in the sludge was correlated with the D5 removal ratio. Because most of the siloxane was adsorbed to, or was contained in the VSS, the siloxane removal ratio increased with VSS disintegration. Finally, the energy consumption and operational costs of this system were evaluated for several scenarios. Thermo-alkaline treatment at the indicated operational conditions had the lowest operating costs for a 400 m 3 day −1 anaerobic sludge digestion system
Kolla, Nathan J; Dunlop, Katharine; Downar, Jonathan; Links, Paul; Bagby, R Michael; Wilson, Alan A; Houle, Sylvain; Rasquinha, Fawn; Simpson, Alexander I; Meyer, Jeffrey H
2016-04-01
Impulsivity is a core feature of antisocial personality disorder (ASPD) associated with abnormal brain function and neurochemical alterations. The ventral striatum (VS) is a key region of the neural circuitry mediating impulsive behavior, and low monoamine oxidase-A (MAO-A) level in the VS has shown a specific relationship to the impulsivity of ASPD. Because it is currently unknown whether phenotypic MAO-A markers can influence brain function in ASPD, we investigated VS MAO-A level and the functional connectivity (FC) of two seed regions, superior and inferior VS (VSs, VSi). Nineteen impulsive ASPD males underwent [(11)C] harmine positron emission tomography scanning to measure VS MAO-A VT, an index of MAO-A density, and resting-state functional magnetic resonance imaging that assessed the FC of bilateral seed regions in the VSi and VSs. Subjects also completed self-report impulsivity measures. Results revealed functional coupling of the VSs with bilateral dorsomedial prefrontal cortex (DMPFC) that was correlated with VS MAO-A VT (r=0.47, p=0.04), and functional coupling of the VSi with right hippocampus that was anti-correlated with VS MAO-A VT (r=-0.55, p=0.01). Additionally, VSs-DMPFC FC was negatively correlated with NEO Personality Inventory-Revised impulsivity (r=-0.49, p=0.03), as was VSi-hippocampus FC with Barratt Impulsiveness Scale-11 motor impulsiveness (r=-0.50, p=0.03). These preliminary results highlight an association of VS MAO-A level with the FC of striatal regions linked to impulsive behavior in ASPD and suggest that phenotype-based brain markers of ASPD have relevance to understanding brain function. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.
Valley–spin Seebeck effect in heavy group-IV monolayers
International Nuclear Information System (INIS)
Zhai, Xuechao; Wang, Shengdong; Zhang, Yan
2017-01-01
Akin to electron spin, the valley has become another highly valued degree of freedom in modern electronics, specifically after tremendous studies on monolayers of group-IV materials, i.e. graphene, silicene, germanene and stanene. Except for graphene, the other heavy group-IV monolayers have observable intrinsic spin–orbit interactions due to their buckled structures. Distinct from the usual electric or optical control of valley and spin, we here employ a temperature difference to drive electron motion in ferromagnetic heavy group-IV monolayers via designing a caloritronic device locally modulated by an interlayer electric (E z ) field. A unique valley–spin Seebeck (VSS) effect is discovered, with the current contributed only by one (the other) valley and one (the other) spin moving along one (the opposite) direction. This effect is suggested to be detected below the critical temperature about 18 K for silicene, 200 K for germanene and 400 K for stanene, arising from the characteristic valley–spin nondegenerate band structures tuned by the E z field, but cannot be driven in graphene without spin–orbit interaction. Above the critical temperature, the VSS effect is broken by overlarge temperature broadening. Besides the temperature, it is also found that the E z field can drive a transition between the VSS effect and the normal spin Seebeck effect. Further calculations indicate that the VSS effect is robust against many realistic perturbations. Our research represents a conceptually but substantially major step towards the study of the Seebeck effect. These findings provide a platform for encoding information simultaneously by the valley and spin quantum numbers of electrons in future thermal-logic circuits and energy-saving devices. (paper)
Ye, Min; Nagar, Swati; Korzekwa, Ken
2016-04-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data were often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding and the blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate the model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for the terminal elimination half-life (t1/2 , 100% of drugs), peak plasma concentration (Cmax , 100%), area under the plasma concentration-time curve (AUC0-t , 95.4%), clearance (CLh , 95.4%), mean residence time (MRT, 95.4%) and steady state volume (Vss , 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
1999-01-01
The principal objective of the project was to participate in the definition of a new IEA task concerning solar procurement (''the Task'') and to assess whether involvement in the task would be in the interest of the UK active solar heating industry. The project also aimed to assess the importance of large scale solar purchasing to UK active solar heating market development and to evaluate the level of interest in large scale solar purchasing amongst potential large scale purchasers (in particular housing associations and housing developers). A further aim of the project was to consider means of stimulating large scale active solar heating purchasing activity within the UK. (author)
National Aeronautics and Space Administration — Development of computational infrastructure to support hyper-resolution large-ensemble hydrology simulations from local-to-continental scales A move is currently...
Model development to acceptability-assessment of large scale power plants for electricity generation
International Nuclear Information System (INIS)
Schubert, Katharina
2013-01-01
An approach to specific assessment of large power plants is presented. This approach is intended to provide the decision which kind of nuclear, fossil and renewable installation operation minimizes unacceptable consequences for the environment, economy, and society. The tool ACCEPPT, which is currently under development for this purpose, allows a comprehensible and quantitative assessment of the reasonableness of unintended side-effects of different power plant types. The flexible design of the tool elements frame conditions and system technology supports a dynamic acceptability assessment under consideration of the particular context and plant configuration. Thus, current conditions can be used for evaluation as well as development scenarios. Finally the comprehensible acceptability results are intended to contribute overcoming of acceptance problems in the society. (orig.)
International Nuclear Information System (INIS)
Ficini, G.; Campbell, J.H.
1996-01-01
Nd-doped phosphate glasses are the preferred gain medium for high-peak-power lasers used for Inertial Confinement Fusion research because they have excellent energy storage and extraction characteristics. In addition, these glasses can be manufactured defect-free in large sizes and at relatively low cost. To meet the requirements of the future mega-joule size lasers, advanced laser glass manufacturing methods are being developed that would enable laser glass to be continuously produced at the rate of several thousand large (790 x 440 x 44 mm 3 ) plates of glass per year. This represents more than a 10 to 100-fold improvement in the scale of the present manufacturing technology
Development of the simulation package 'ELSES' for extra-large-scale electronic structure calculation
Energy Technology Data Exchange (ETDEWEB)
Hoshi, T [Department of Applied Mathematics and Physics, Tottori University, Tottori 680-8550 (Japan); Fujiwara, T [Core Research for Evolutional Science and Technology, Japan Science and Technology Agency (CREST-JST) (Japan)
2009-02-11
An early-stage version of the simulation package 'ELSES' (extra-large-scale electronic structure calculation) is developed for simulating the electronic structure and dynamics of large systems, particularly nanometer-scale and ten-nanometer-scale systems (see www.elses.jp). Input and output files are written in the extensible markup language (XML) style for general users. Related pre-/post-simulation tools are also available. A practical workflow and an example are described. A test calculation for the GaAs bulk system is shown, to demonstrate that the present code can handle systems with more than one atom species. Several future aspects are also discussed.
Biasetti, Jacopo; Spazzini, Pier Giorgio; Swedenborg, Jesper; Gasser, T Christian
2012-01-01
Abdominal Aortic Aneurysms (AAAs) are frequently characterized by the presence of an Intra-Luminal Thrombus (ILT) known to influence their evolution biochemically and biomechanically. The ILT progression mechanism is still unclear and little is known regarding the impact of the chemical species transported by blood flow on this mechanism. Chemical agonists and antagonists of platelets activation, aggregation, and adhesion and the proteins involved in the coagulation cascade (CC) may play an important role in ILT development. Starting from this assumption, the evolution of chemical species involved in the CC, their relation to coherent vortical structures (VSs) and their possible effect on ILT evolution have been studied. To this end a fluid-chemical model that simulates the CC through a series of convection-diffusion-reaction (CDR) equations has been developed. The model involves plasma-phase and surface-bound enzymes and zymogens, and includes both plasma-phase and membrane-phase reactions. Blood is modeled as a non-Newtonian incompressible fluid. VSs convect thrombin in the domain and lead to the high concentration observed in the distal portion of the AAA. This finding is in line with the clinical observations showing that the thickest ILT is usually seen in the distal AAA region. The proposed model, due to its ability to couple the fluid and chemical domains, provides an integrated mechanochemical picture that potentially could help unveil mechanisms of ILT formation and development.
Development of A Hydraulic Drive for a novel Diesel-Hydraulic system for Large commercial Vehicles
DEFF Research Database (Denmark)
Stecki, J. S.; Conrad, Finn; Matheson, P.
2002-01-01
The objectives and results of the research project Hybrid Diesel-Hydraulic System for Large commercial vehicles, e.g. urban freight delivery, buses or garbage trucks. The paper presents and discusses the research and development of the system, modelling approach and results from preliminary...... performance tests on a 10 ton vehicle....
Development of Integrated Die Casting Process for Large Thin-Wall Magnesium Applications
Energy Technology Data Exchange (ETDEWEB)
Carter, Jon T. [General Motors LLC, Warren, MI (United States); Wang, Gerry [Meridian Lightweight Technologies, Plymouth MI (United States); Luo, Alan [General Motors LLC, Warren, MI (United States)
2017-11-29
The purpose of this project was to develop a process and product which would utilize magnesium die casting and result in energy savings when compared to the baseline steel product. The specific product chosen was a side door inner panel for a mid-size car. The scope of the project included: re-design of major structural parts of the door, design and build of the tooling required to make the parts, making of parts, assembly of doors, and testing (both physical and simulation) of doors. Additional work was done on alloy development, vacuum die casting, and overcasting, all in order to improve the performance of the doors and reduce cost. The project achieved the following objectives: 1. Demonstrated ability to design a large thin-wall magnesium die casting. 2. Demonstrated ability to manufacture a large thin-wall magnesium die casting in AM60 alloy. 3. Tested via simulations and/or physical tests the mechanical behavior and corrosion behavior of magnesium die castings and/or lightweight experimental automotive side doors which incorporate a large, thin-wall, powder coated, magnesium die casting. Under some load cases, the results revealed cracking of the casting, which can be addressed with re-design and better material models for CAE analysis. No corrosion of the magnesium panel was observed. 4. Using life cycle analysis models, compared the energy consumption and global warming potential of the lightweight door with those of a conventional steel door, both during manufacture and in service. Compared to a steel door, the lightweight door requires more energy to manufacture but less energy during operation (i.e., fuel consumption when driving vehicle). Similarly, compared to a steel door, the lightweight door has higher global warming potential (GWP) during manufacture, but lower GWP during operation. 5. Compared the conventional magnesium die casting process with the “super-vacuum” die casting process. Results achieved with cast tensile bars suggest some
Mizell, Carolyn; Malone, Linda
2007-01-01
It is very difficult for project managers to develop accurate cost and schedule estimates for large, complex software development projects. None of the approaches or tools available today can estimate the true cost of software with any high degree of accuracy early in a project. This paper provides an approach that utilizes a software development process simulation model that considers and conveys the level of uncertainty that exists when developing an initial estimate. A NASA project will be analyzed using simulation and data from the Software Engineering Laboratory to show the benefits of such an approach.
Development of a PSA-based Loss of Large Area Analysis Method
Energy Technology Data Exchange (ETDEWEB)
Hwang, Mee Jeong; Jung, Woosik [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Myungsu [Korea Hydro Nuclear Power, Central Research Institute, Daejeon (Korea, Republic of)
2015-10-15
As a result of these initial post 9-11 assessments in 2002, the NRC issued an interim safeguards and security compensatory measures order. In 'Interim Compensatory Measures for High Threat Environment,'. Section B.5.b (not publically available) of this order, current NPP licensees had to adopt mitigation or restore reactor core cooling, containment, and spent fuel pool (SFP) cooling capabilities to cope with a LOLA due to large fires and explosions from any cause, including beyond-design basis threat(BDBT) aircraft impacts. In 2009, the NRC issued amendments to 10CFR Part 52, and Part 73 for power reactor security requirements for operating and new reactors. New U.S. licensed commercial nuclear power plant operators are required to provide a LOLA(Loss of Large Area) analysis as per the U.S. Code of Federal Regulations, 10CFR50.54(hh)(2). Additionally 10CFR52.80(d) provides the required submittal information on how an applicant for a combined operating license(COL) for a nuclear power plant to meet these requirements. It is necessary to prepare our own guidance for a development of LOLA strategies. In this paper, we proposed a method to look for interesting combinations of rooms in certain targets getting through VAI model, and produced insights that could be used to influence LOLA strategies.
Software development and maintenance: An approach for a large accelerator control system
International Nuclear Information System (INIS)
Casalegno, L.; Orsini, L.; Sicard, C.H.
1990-01-01
Maintenance costs presently form a large part of the total life-cycle cost of a software system. In case of large systems, while the costs of eliminating bugs, fixing analysis and design errors and introducing updates must be taken into account, the coherence of the system as a whole must be maintained while its parts are evolving independently. The need to devise and supply tools to aid programmers in housekeeping and updating has been strongly felt in the case of the LEP preinjector control system. A set of utilities has been implemented to create a safe interface between the programmers and the files containing the control software. Through this interface consistent naming schemes, common compiling and object-building procedures can be enforced, so that development and maintenance staff need not be concerned with the details of executable code generation. Procedures have been built to verify the consistency, generate maintenance diagnostics and automatically update object and executable files, taking into account multiple releases and versions. The tools and the techniques reported in this paper are of general use in the UNIX environment and have already been adopted for other projects. (orig.)
Cuellar, Maria C; Heijnen, Joseph J; van der Wielen, Luuk A M
2013-06-01
Industrial biotechnology is playing an important role in the transition to a bio-based economy. Currently, however, industrial implementation is still modest, despite the advances made in microorganism development. Given that the fuels and commodity chemicals sectors are characterized by tight economic margins, we propose to address overall process design and efficiency at the start of bioprocess development. While current microorganism development is targeted at product formation and product yield, addressing process design at the start of bioprocess development means that microorganism selection can also be extended to other critical targets for process technology and process scale implementation, such as enhancing cell separation or increasing cell robustness at operating conditions that favor the overall process. In this paper we follow this approach for the microbial production of diesel-like biofuels. We review current microbial routes with both oleaginous and engineered microorganisms. For the routes leading to extracellular production, we identify the process conditions for large scale operation. The process conditions identified are finally translated to microorganism development targets. We show that microorganism development should be directed at anaerobic production, increasing robustness at extreme process conditions and tailoring cell surface properties. All the same time, novel process configurations integrating fermentation and product recovery, cell reuse and low-cost technologies for product separation are mandatory. This review provides a state-of-the-art summary of the latest challenges in large-scale production of diesel-like biofuels. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Development of membrane cryostats for large liquid argon neutrino detectors
Montanari, D; Gendotti, A; Geynisman, M; Hentschel, S; Loew, T; Mladenov, D; Montanari, C; Murphy, S; Nessi, M; Norris, B; Noto, F; Rubbia, A; Sharma, R; Smargianaki, D; Stewart, J; Vignoli, C; Wilson, P; Wu, S
2015-01-01
A new collaboration is being formed to develop a multi-kiloton Long-Baseline neutrino experiment that will be located at the Surf Underground Research Facility (SURF) in Lead, SD. In the present design, the detector will be located inside cryostats filled with 68,400 ton of ultrapure liquid argon (less than 100 parts per trillion of oxygen equivalent contamination). To qualify the membrane technology for future very large-scale and underground implementations, a strong prototyping effort is ongoing: several smaller detectors of growing size with associated cryostats and cryogenic systems will be designed and built at Fermilab and CERN. They will take physics data and test different detector elements, filtration systems, design options and installation procedures. In addition, a 35 ton prototype is already operational at Fermilab and will take data with single-phase detector in early 2016. After the prototyping phase, the multi-kton detector will be constructed. After commissioning, it will detect and study ne...
Zuccaro Marchi, Alessandro; D'Amato, Francesco; Gallieni, Daniele; Biasi, Roberto; Molina, Marco; Duò, Fabrizio; Ruder, Nikolaus; Salinari, Piero; Lisi, Franco; Riccardi, Armando; Gambicorti, Lisa; Simonetti, Francesca; Pereira do Carmo, Joao Pedro N.
2017-11-01
The increasing interest on space telescopes for scientific applications leads to implement the manufacturing technology of the most critical element, i.e. the primary mirror: being more suitable a large aperture, it must be lightweight and deployable. The presented topic was originally addressed to a spaceborne DIAL (Differential Absorption LIDAR) mission operating at 935.5 nm for the measurement of water vapour profile in atmosphere, whose results were presented at ICSO 2006 and 2008. Aim of this paper is to present the latest developments on the main issues related to the fabrication of a breadboard, covering two project critical areas identified during the preliminary studies: the design and performances of the long-stroke actuators used to implement the mirror active control and the mirror survivability to launch via Electrostatic Locking (EL) between mirror and backplane. The described work is developed under the ESA/ESTEC contract No. 22321/09/NL/RA. The lightweight mirror is structured as a central sector surrounded by petals, all of them actively controlled to reach the specified shape after initial deployment and then maintained within specs for the entire mission duration. The presented study concerns: a) testing the Carbon Fiber Reinforced Plastic (CFRP) backplane manufacturing and EL techniques, with production of suitable specimens; b) actuator design optimisation; c) design of the deployment mechanism including a high precision latch; d) the fabrication of thin mirrors mock-ups to validate the fabrication procedure for the large shells. The current activity aims to the construction of an optical breadboard capable of demonstrating the achievement of all these coupled critical aspects: optical quality of the thin shell mirror surface, actuators performances and back-plane - EL subsystem functionality.
Developing a NASA strategy for the verification of large space telescope observatories
Crooke, Julie A.; Gunderson, Johanna A.; Hagopian, John G.; Levine, Marie
2006-06-01
In July 2005, the Office of Program Analysis and Evaluation (PA&E) at NASA Headquarters was directed to develop a strategy for verification of the performance of large space telescope observatories, which occurs predominantly in a thermal vacuum test facility. A mission model of the expected astronomical observatory missions over the next 20 years was identified along with performance, facility and resource requirements. Ground testing versus alternatives was analyzed to determine the pros, cons and break points in the verification process. Existing facilities and their capabilities were examined across NASA, industry and other government agencies as well as the future demand for these facilities across NASA's Mission Directorates. Options were developed to meet the full suite of mission verification requirements, and performance, cost, risk and other analyses were performed. Findings and recommendations from the study were presented to the NASA Administrator and the NASA Strategic Management Council (SMC) in February 2006. This paper details the analysis, results, and findings from this study.
HSTDEK: Developing a methodology for construction of large-scale, multi-use knowledge bases
Freeman, Michael S.
1987-01-01
The primary research objectives of the Hubble Space Telescope Design/Engineering Knowledgebase (HSTDEK) are to develop a methodology for constructing and maintaining large scale knowledge bases which can be used to support multiple applications. To insure the validity of its results, this research is being persued in the context of a real world system, the Hubble Space Telescope. The HSTDEK objectives are described in detail. The history and motivation of the project are briefly described. The technical challenges faced by the project are outlined.
Energy Technology Data Exchange (ETDEWEB)
NONE
1981-03-01
A survey is conducted into the effects of projects implemented under the large-scale industrial technology research and development system. In the development of 'ultraperformance computers,' each of the technologies is being widely utilized, and the data service system of Nippon Telegraph and Telephone Public Corporation and the large computer (HITAC8800) owe much for their success to the fruits of the development endeavor. In the development of the 'desulfurization technology,' the fruits are in use by Tokyo Electric Power Co., Inc., and Chubu Electric Power Co., Inc., incorporated into their desulfurization systems. Although there is no practical plant based on the 'great-depth remotely controlled submarine oil drilling rig,' yet oceanic technologies and control methods are being utilized in various fields. The 'seawater desalination and by-product utilization' technologies have enabled the establishment of technologies of the top level in the world thanks to the resultant manufacture of concrete evaporator and related technologies. Eleven plants have been completed utilizing the fruits of the development. In the field of 'electric vehicle,' there is no commercialization in progress due to problems in cost effectiveness though remarkable improvement has been achieved in terms of performance. Technologies about weight reduction, semiconductor devices, battery parts and components, etc., are being utilized in many fields. (NEDO)
Vogelmann, Andrew M.; Fridlind, Ann M.; Toto, Tami; Endo, Satoshi; Lin, Wuyin; Wang, Jian; Feng, Sha; Zhang, Yunyan; Turner, David D.; Liu, Yangang; Li, Zhijin; Xie, Shaocheng; Ackerman, Andrew S.; Zhang, Minghua; Khairoutdinov, Marat
2015-06-01
Observation-based modeling case studies of continental boundary layer clouds have been developed to study cloudy boundary layers, aerosol influences upon them, and their representation in cloud- and global-scale models. Three 60 h case study periods span the temporal evolution of cumulus, stratiform, and drizzling boundary layer cloud systems, representing mixed and transitional states rather than idealized or canonical cases. Based on in situ measurements from the Routine AAF (Atmospheric Radiation Measurement (ARM) Aerial Facility) CLOWD (Clouds with Low Optical Water Depth) Optical Radiative Observations (RACORO) field campaign and remote sensing observations, the cases are designed with a modular configuration to simplify use in large-eddy simulations (LES) and single-column models. Aircraft measurements of aerosol number size distribution are fit to lognormal functions for concise representation in models. Values of the aerosol hygroscopicity parameter, κ, are derived from observations to be 0.10, which are lower than the 0.3 typical over continents and suggestive of a large aerosol organic fraction. Ensemble large-scale forcing data sets are derived from the ARM variational analysis, European Centre for Medium-Range Weather Forecasts, and a multiscale data assimilation system. The forcings are assessed through comparison of measured bulk atmospheric and cloud properties to those computed in "trial" large-eddy simulations, where more efficient run times are enabled through modest reductions in grid resolution and domain size compared to the full-sized LES grid. Simulations capture many of the general features observed, but the state-of-the-art forcings were limited at representing details of cloud onset, and tight gradients and high-resolution transients of importance. Methods for improving the initial conditions and forcings are discussed. The cases developed are available to the general modeling community for studying continental boundary clouds.
Vogelmann, Andrew M.; Fridlind, Ann M.; Toto, Tami; Endo, Satoshi; Lin, Wuyin; Wang, Jian; Feng, Sha; Zhang, Yunyan; Turner, David D.; Liu, Yangang;
2015-01-01
Observation-based modeling case studies of continental boundary layer clouds have been developed to study cloudy boundary layers, aerosol influences upon them, and their representation in cloud- and global-scale models. Three 60 h case study periods span the temporal evolution of cumulus, stratiform, and drizzling boundary layer cloud systems, representing mixed and transitional states rather than idealized or canonical cases. Based on in situ measurements from the Routine AAF (Atmospheric Radiation Measurement (ARM) Aerial Facility) CLOWD (Clouds with Low Optical Water Depth) Optical Radiative Observations (RACORO) field campaign and remote sensing observations, the cases are designed with a modular configuration to simplify use in large-eddy simulations (LES) and single-column models. Aircraft measurements of aerosol number size distribution are fit to lognormal functions for concise representation in models. Values of the aerosol hygroscopicity parameter, kappa, are derived from observations to be approximately 0.10, which are lower than the 0.3 typical over continents and suggestive of a large aerosol organic fraction. Ensemble large-scale forcing data sets are derived from the ARM variational analysis, European Centre for Medium-Range Weather Forecasts, and a multiscale data assimilation system. The forcings are assessed through comparison of measured bulk atmospheric and cloud properties to those computed in "trial" large-eddy simulations, where more efficient run times are enabled through modest reductions in grid resolution and domain size compared to the full-sized LES grid. Simulations capture many of the general features observed, but the state-of-the-art forcings were limited at representing details of cloud onset, and tight gradients and high-resolution transients of importance. Methods for improving the initial conditions and forcings are discussed. The cases developed are available to the general modeling community for studying continental boundary
Large area electron beam diode development
International Nuclear Information System (INIS)
Helava, H.; Gilman, C.M.; Stringfield, R.M.; Young, T.
1983-01-01
A large area annular electron beam diode has been tested at Physics International Co. on the multi-terawatt PITHON generator. A twelve element post hole convolute converted the coaxial MITL into a triaxial arrangement of anode current return structures both inside and outside the cathode structure. The presence of both inner and outer current return paths provide magnetic pressure balance for the beam, as determined by diode current measurements. X-ray pinhole photographs indicated uniform emission with intensity maxima between the post positions. Current losses in the post hole region were negligible, as evidenced by the absence of damage to the aluminum hardware. Radial electron flow near the cathode ring however did damage the inner anode cylinder between the post positions. Cutting away these regions prevented further damage of the transmission lines
International Nuclear Information System (INIS)
Siciliano, Giuseppina; Urban, Frauke; Kim, Sour; Dara Lonn, Pich
2015-01-01
Hydropower investment is a priority in many developing countries, as a means to increase electrification rates and promote national development. However, neglect of dam-affected people's needs, can make them vulnerable to the multifaceted impacts of such projects. Using the case of Cambodia's first large dam, the Kamchay dam, this paper reveals social priorities of affected communities and institutional actors linked to environmental and social implications of large hydropower projects using a preference ranking method. Qualitative research revealed concerns among dam-affected communities which included energy access, livelihood changes, environmental impacts, access to natural resources and compensation. Results also reveal divergence between national and local priorities, which in turn brings about an unequal distribution of costs and benefits of the Kamchay Dam between urban and rural areas. The paper provides recommendations to policy-makers, NGOs and international organizations regarding governance issues, consultation processes and mitigation measures. - Highlights: • We assess social priorities linked to the impacts of a large dam in Cambodia. • We examine differences between local actors in the prioritization of the impacts. • Findings show divergences between national and local priorities of dam construction. • Distribution of cost and benefit is spatially unequal between rural and urban areas.
Plan for support of large-plant (post-CRBR) needs in large-leak sodium-water reaction area
International Nuclear Information System (INIS)
Whipple, J.C.
1980-03-01
Work in the large leak test and analysis area of steam generator development has been carried out at GE-ARSD under 189a SG037 since 1973. The currently planned master schedule for the SG037 program is shown. Principal activities are the large leak testing program being carried out at the Large Leak Test Rig and the analysis methods development. The plan for supporting the large plant (post-CRBR) needs in the large leak sodium-water reaction area is outlined. Most of the needs will be answered in the current SG037 large leak program
International Nuclear Information System (INIS)
Oto, Akihiro; Naohara, Nobuyuki; Ishida, Masayoshi; Katsuki, Kenji; Kumazawa, Ryouji
1995-01-01
A sodium-immersed, self-cooled electromagnetic (EM) pump was recently studied as a prospective innovative technology to simplify a fast breeder reactor plant system. The EM pump for a primary pump, a pump type, was designed, and the structural concept and the system performance were clarified. For the flow control method, a constant voltage/frequency method was preferable from the point of view of pump performance and efficiency. The insulation life was tested on a large-scale coil at high temperature as part of the development of a large-capacity EM pump. Mechanical and electrical damage were not observed, and the insulation performance was quite good. The insulation system could also be applied to large-scale coils
Development and introduction of stamping technique for large-size laterals of NPP pipelines
International Nuclear Information System (INIS)
Romashko, N.I.; Moshnin, E.N.; Timokhin, V.S.; Bryukhanov, Yu.V.; Lebedev, V.A.
1984-01-01
The results of development and introduction of stamping technique for large-size laterals of NPP high-pressure pipelines are presented. The main experimental data characterizing technological possibilities of the process are given. The technological process and design of the stamp assure production of laterals from ovalized bars per one heating of the bar and per one running of the press cronnhead. Introduction of new technology decreased labour input of lateral production, reliability and serviceability of pipelines increased in this case. Introduction of this technology gives a considerable benefit
Optimization of a large integrated area development of gas fields offshore Sarawak, Malaysia
International Nuclear Information System (INIS)
Inyang, S.E.; Tak, A.N.H.; Costello, G.
1995-01-01
Optimizations of field development plans are routine in the industry. The size, schedule and nature of the upstream gas supply project to the second Malaysia LNG (MLNG Dua) plant in Bintulu, Sarawak made the need for extensive optimizations critical to realizing a robust and cost effective development scheme, and makes the work of more general interest. The project comprises the upstream development of 11 offshore fields for gas supply to MLNG Dua plant at an initial plateau production of 7.8 million tons per year of LNG. The gas fields span a large geographical area in medium water depths (up to 440 ft), and contain gas reserves of a distinctly variable gas quality. This paper describes the project optimization efforts aimed to ensure an upstream gas supply system effectiveness of over 99% throughout the project life while maintaining high safety and environmental standards and also achieving an economic development in an era of low hydrocarbon prices. Fifty percent of the first of the three phases of this gas supply project has already been completed and the first gas from these fields is scheduled to be available by the end of 1995
Development and application of automatic frequency and power control systems for large power units
Energy Technology Data Exchange (ETDEWEB)
V.A. Bilenko; A.D. Melamed; E.E. Mikushevich; D.Y. Nikol' skii; R.L. Rogachev; N.A. Romanov [ZAO Interavtomatika (Interautomatika AG), Moscow (Russian Federation)
2008-07-01
We describe the results of work carried out at ZAO Interavtomatika on the development and putting into use of a system for automatically controlling the frequency and power output of large coal-fired power units involving the retrofitting of the turbine's hydraulic automatic control system. Certificates affirming conformity to the Standard of the System Operator Centralized Dispatching Administration (SO-CDA) have been received for eight power units as an outcome of these efforts.
Energy Technology Data Exchange (ETDEWEB)
Bonnema, E.; Leach, M.; Pless, S.
2013-06-01
This Technical Support Document describes the process and methodology for the development of the Advanced Energy Design Guide for Large Hospitals: Achieving 50% Energy Savings Toward a Net Zero Energy Building (AEDG-LH) ASHRAE et al. (2011b). The AEDG-LH is intended to provide recommendations for achieving 50% whole-building energy savings in large hospitals over levels achieved by following Standard 90.1-2004. The AEDG-LH was created for a 'standard' mid- to large-size hospital, typically at least 100,000 ft2, but the strategies apply to all sizes and classifications of new construction hospital buildings. Its primary focus is new construction, but recommendations may be applicable to facilities undergoing total renovation, and in part to many other hospital renovation, addition, remodeling, and modernization projects (including changes to one or more systems in existing buildings).
Wang, Dexin; Ma, Wencheng; Han, Hongjun; Li, Kun; Xu, Hao; Fang, Fang; Hou, Baolin; Jia, Shengyong
2016-12-01
Coupling of the Fe-C micro-electrolysis (IC-ME) into the up-flow anaerobic sludge blanket (UASB) was developed for enhanced Fischer-Tropsch wastewater treatment. The COD removal efficiency and methane production in R 3 with IC-ME assisted both reached up to 80.6 ± 1.7% and 1.38 ± 0.11 L/L·d that higher than those values in R 1 with GAC addition (63.0 ± 3.4% and 0.95 ± 0.09 L/L·d) and R 2 with ZVI addition (74.5 ± 2.8% and 1.21 ± 0.09 L/L·d) under the optimum HRT (5 d). The Fe corrosion as electron donor reduced the ORP values and stimulated the activities of hydrogenotrophic methanogens to lower H 2 partial pressure in R 2 and R 3 . Additionally, Fe 2+ as by-product of iron corrosion, its presence could effectively increase the percentage of protein content in tightly bound extracellular polymeric substances (TB-EPS) to promote better bioflocculation, increasing to 90.5 mg protein/g·VSS (R 2 ) and 106.3 mg protein/g·VSS (R 3 ) while this value in R1 was simply 56.6 mg protein/g·VSS. More importantly, compared with R 1 , the excess accumulation of propionic acid and butyric acid in system was avoided. The macroscopic galvanic cells around Fe-C micro-electrolysis carriers in R 3 , that larger than microscopic galvanic cells in R 2 , further accelerate to transfer the electrons from anodic Fe to cathodic carbon that enhance interspecies hydrogen transfer, making the decomposition of propionic acid and butyric acid more thermodynamically feasible, finally facilitate more methane production. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effect of increase in salinity on ANAMMOX-UASB reactor stability.
Xing, Hui; Wang, Han; Fang, Fang; Li, Kai; Liu, Lianwei; Chen, Youpeng; Guo, Jinsong
2017-05-01
The effect of salinity on the anaerobic ammonium oxidation (ANAMMOX) process in a UASB reactor was investigated by analysing ammonium, nitrite, nitrate and TN concentrations, and TN removal efficiency. Extracellular polymeric substances (EPSs) and specific ANAMMOX activity (SAA) were evaluated. Results showed the effluent deteriorated after salinity was increased from 8 to 13 g/L and from 13 to 18 g/L, and TN removal efficiency decreased from 80% to 30% and 80% to 50%, respectively. However, ANAMMOX performance recovered and TN removal efficiency increased to 80% after 40 days when the influent concentrations of [Formula: see text] and [Formula: see text] were 200 mg/L and salinity levels were at 13 and 18 g/L, respectively. The amount of EPSs decreased from 58.9 to 37.1 mg/g volatile suspended solids (VSS) when the reactor was shocked by salinity of 13 g/L, and then increased to 57.2 mg/g VSS when the reactor recovered and ran stably at 13 g/L. The amount of EPSs decreased from 57.2 to 49.1 mg/g VSS when the reactor was shocked by salinity of 18 g/L, and then increased to 60.7 mg/g VSS when the reactor recovered and ran stably at 18 g/L. The amount of EPS and the amounts of polysaccharide, protein and humus showed no evident difference when the reactor recovered from different levels of salinity shocks. Batch tests showed salinity shock load from 8 to 38 g/L inhibited the SAA. However, when the reactor recovered from salinity shocks, SAA was higher compared to that when the reactor was subjected to the same level of salinity shock.
International Nuclear Information System (INIS)
Combs, Stephanie E.; Welzel, Thomas; Schulz-Ertner, Daniela; Huber, Peter E.; Debus, Juergen
2010-01-01
Purpose: To evaluate the outcomes of patients with vestibular schwannoma (VS) treated with fractionated stereotactic radiotherapy (FSRT) vs. those treated with stereotactic radiosurgery (SRS). Methods and Materials: This study is based on an analysis of 200 patients with 202 VSs treated with FSRT (n = 172) or SRS (n = 30). Patients with tumor progression and/or progression of clinical symptoms were selected for treatment. In 165 out of 202 VSs (82%), RT was performed as the primary treatment for VS, and for 37 VSs (18%), RT was conducted for tumor progression after neurosurgical intervention. For patients receiving FSRT, a median total dose of 57.6 Gy was prescribed, with a median fractionation of 5 x 1.8 Gy per week. For patients who underwent SRS, a median single dose of 13 Gy was prescribed to the 80% isodose. Results: FSRT and SRS were well tolerated. Median follow-up time was 75 months. Local control was not statistically different for both groups. The probability of maintaining the pretreatment hearing level after SRS with doses of ≤13 Gy was comparable to that of FSRT. The radiation dose for the SRS group (≤13 Gy vs. >13 Gy) significantly influenced hearing preservation rates (p = 0.03). In the group of patients treated with SRS doses of ≤13 Gy, cranial nerve toxicity was comparable to that of the FSRT group. Conclusions: FSRT and SRS are both safe and effective alternatives for the treatment of VS. Local control rates are comparable in both groups. SRS with doses of ≤13 Gy is a safe alternative to FSRT. While FSRT can be applied safely for the treatment of VSs of all sizes, SRS should be reserved for smaller lesions.
Managing large classes in developing countries | Asodike | Global ...
African Journals Online (AJOL)
This is in line with the global initiative for universal basic education coupled with the rapid population growth and awareness that a literate population is more productive than an illiterate one. Experience has shown that large classes or overcrowded classrooms affect the quality of education delivered in the school system.
Large wind turbine development in Europe
Energy Technology Data Exchange (ETDEWEB)
Zervos, A. [Center for Renewable Energy Sources, Attikis (Greece)
1996-12-31
During the last few years we have witnessed in Europe the development of a new generation of wind turbines ranging from 1000-1500 kW size. They are presently being tested and they are scheduled to reach the market in late 1996 early 1997. The European Commission has played a key role by funding the research leading to the development of these turbines. The most visible initiative at present is the WEGA program - the development, together with Europe`s leading wind industry players of a new generation of turbines in the MW range. By the year 1997 different European manufacturers will have introduced almost a dozen new MW machine types to the international market, half of them rated at 1.5 MW. 3 refs., 3 tabs.
Workshop on technology development issues for the large deployable reflector (LDR)
International Nuclear Information System (INIS)
Nishioka, K.
1986-02-01
The results of the 2nd Large Deployable Reflector (LDR) Technology Review Workshop held at Asilomar, California, March 17 to 22, 1985, are summarized. The workshop was convened to update LDR Technology status and to revise as necessary the results for the first LDR Workshop held in June 1982. There were some 100 participants representing government agencies, industry, and universities. This Workshop's goal was to assess, identify, and set priorities for the LDR technology issues based on requirements identified in the first workshop. Four high-priority technology areas were identified: (1) mirror materials and construction; (2) sensing and controls; (3) system-simulation and modeling capability; and (4) submillimeter instruments. The results of the workshop were used to provide a list of technolgy issues for the development of a technology initiatives plan for the LDR by NASA's Office of Aeronautics and Space Technology
Workshop on Technology Development Issues for the Large Deployable Reflector (LDR)
Nishioka, Kenji (Editor)
1986-01-01
The results of the 2nd Large Deployable Reflector (LDR) Technology Review Workshop held at Asilomar, California, March 17 to 22, 1985, are summarized. The workshop was convened to update LDR Technology status and to revise as necessary the results for the first LDR Workshop held in June 1982. There were some 100 participants representing government agencies, industry, and universities. This Workshop's goal was to assess, identify, and set priorities for the LDR technology issues based on requirements identified in the first workshop. Four high-priority technology areas were identified: (1) mirror materials and construction; (2) sensing and controls; (3) system-simulation and modeling capability; and (4) submillimeter instruments. The results of the workshop were used to provide a list of technolgy issues for the development of a technology initiatives plan for the LDR by NASA's Office of Aeronautics and Space Technology.
Development of Large Concrete Object Geometrical Model Based on Terrestrial Laser Scanning
Directory of Open Access Journals (Sweden)
Zaczek-Peplinska Janina
2015-02-01
Full Text Available The paper presents control periodic measurements of movements and survey of concrete dam on Dunajec River in Rożnów, Poland. Topographical survey was conducted using laser scanning technique. The goal of survey was data collection and creation of a geometrical model. Acquired cross- and horizontal sections were utilised to create a numerical model of object behaviour at various load depending of changing level of water in reservoir. Modelling was accomplished using finite elements technique. During the project an assessment was conducted to terrestrial laser scanning techniques for such type of research of large hydrotechnical objects such as gravitational water dams. Developed model can be used to define deformations and displacement prognosis.
DEFF Research Database (Denmark)
Dalsgaard, Peter; Eriksson, Eva
2013-01-01
In this paper, we present a case study of a participatory project that focuses on interaction in large-scale design, namely, the development of the new Urban Mediaspace Aarhus. This project, which has been under way for ten years, embodies a series of issues that arise when participatory design...
Analyses of Large Coal-Based SOFCs for High Power Stack Block Development
Energy Technology Data Exchange (ETDEWEB)
Recknagle, Kurtis P; Koeppel, Brian J
2010-10-01
This report summarizes the numerical modeling and analytical efforts for SOFC stack development performed for the coal-based SOFC program. The stack modeling activities began in 2004, but this report focuses on the most relevant results obtained since August 2008. This includes the latter half of Phase-I and all of Phase-II activities under technical guidance of VPS and FCE. The models developed to predict the thermal-flow-electrochemical behaviors and thermal-mechanical responses of generic planar stacks and towers are described. The effects of cell geometry, fuel gas composition, on-cell reforming, operating conditions, cell performance, seal leak, voltage degradation, boundary conditions, and stack height are studied. The modeling activities to evaluate and achieve technical targets for large stack blocks are described, and results from the latest thermal-fluid-electrochemical and structural models are summarized. Modeling results for stack modifications such as scale-up and component thickness reduction to realize cost reduction are presented. Supporting modeling activities in the areas of cell fabrication and loss of contact are also described.
Development of Spray on Bag for manufacturing of large composites parts: Diffusivity analysis
Dempah, Maxime Joseph
Bagging materials are utilized in many composites manufacturing processes. The selection is mainly driven by cost, temperature requirements, chemical compatibility and tear properties of the bag. The air barrier properties of the bag are assumed to be adequate or in many cases are not considered at all. However, the gas barrier property of a bag is the most critical parameter, as it can negatively affect the quality of the final laminate. The barrier property is a function of the bag material, uniformity, thickness and temperature. Improved barrier properties are needed for large parts, high pressure consolidated components and structures where air stays entrapped on the part surface. The air resistance property of the film is defined as permeability and is investigated in this thesis. A model was developed to evaluate the gas transport through the film and an experimental cell was implemented to characterize various commercial films. Understanding and characterizing the transport phenomena through the film allows optimization of the bagging material for various manufacturing processes. Spray-on-Bag is a scalable alternative bagging method compared to standard films. The approach allows in-situ fabrication of the bag on large and complex geometry structures where optimization of the bag properties can be varied on a local level. An experimental setup was developed and implemented using a six axis robot and an automated spraying system. Experiments were performed on a flat surface and specimens were characterized and compared to conventional films. Air barrier properties were within range of standard film approaches showing the potential to fabricate net shape bagging structures in an automated process.
International Nuclear Information System (INIS)
Martin, S.E.; Newman, J.B.
1980-11-01
A thermomechanical theory of large deformation elastic-inelastic material behavior is developed which is based on a multiplicative decomposition of the strain. Very general assumptions are made for the elastic and inelastic constitutive relations and effects such as thermally-activated creep, fast-neutron-flux-induced creep and growth, annealing, and strain recovery are compatible with the theory. Reduced forms of the constitutive equations are derived by use of the second law of thermodynamics in the form of the Clausius-Duhem inequality. Observer invariant equations are derived by use of an invariance principle which is a generalization of the principle of material frame indifference
A Method for Traffic Calming Using Radio Transmitter
Directory of Open Access Journals (Sweden)
Amin Mirza Boroujerdian
2017-01-01
Full Text Available Excessive speed is one of the major factors in transportation safety assessment and is influenced by road geometric design, vehicle properties, and driving pattern. Exploiting innovative methods along with the conventional ones has been proven to be effective in road safety to control the speed limit. In this study, a supplementary tool is introduced to help drivers to observe the speed limit. In line with this objective, the effectiveness of Voice Sign System (VSS as an Intelligent Transportation System is evaluated. In order to measure the speed, video processing software is used. Moreover, SPSS is utilized to perform statistical analysis and compare upstream and downstream speeds before and after a message transmission. The study is conducted in Yadegar-e-Imam expressway, located in Tehran, to evaluate the effectiveness of a voice message. The message reads as follows: “Observe the Speed Limit.” The results reveal that VSS is an effective tool for speed reduction as well as the speed limit observation in expressways. The study shows that the speed is reduced by 18% on average, and speed limit observation is improved by 46.5%, out of which 18.2% is direct and 28.3% is indirect influence of VSS.
Esparza-Soto, M; Arzate-Archundia, O; Solís-Morelos, C; Fall, C
2013-01-01
The aim of this work was to evaluate the performance of a 244-L pilot-scale upflow anaerobic sludge blanket (UASB) reactor during the treatment of chocolate-processing industry wastewater under low-temperature conditions (18 ± 0.6 °C) for approximately 250 d. The applied organic loading rate (OLR) was varied between 4 and 7 kg/m(3)/d by varying the influent soluble chemical oxygen demand (CODsol), while keeping the hydraulic retention time constant (6.4 ± 0.3 h). The CODsol removal efficiency was low (59-78%). The measured biogas production increased from 240 ± 54 to 431 ± 61 L/d during the experiments. A significant linear correlation between the measured biogas production and removed OLR indicated that 81.69 L of biogas were produced per kg/m(3) of CODsol removed. Low average reactor volatile suspended solids (VSS) (2,700-4,800 mg/L) and high effluent VSS (177-313 mg/L) were derived in a short sludge retention time (SRT) (4.9 d). The calculated SRT was shorter than those reported in the literature, but did not affect the reactor's performance. Average sludge yield was 0.20 kg-VSS/kg-CODsol. The low-temperature anaerobic treatment was a good option for the pre-treatment of chocolate-processing industry wastewater.
Virtual slides: application in pulmonary pathology consultations.
Directory of Open Access Journals (Sweden)
Michał Wojciechowski
2008-02-01
Full Text Available The Virtual Slide (VS is an interactive microscope emulator that presents a complete digitized tissue section via the Internet. A successful implementation of VS has been observed for educational, research venues and quality control. VS acquisition for consultative pathology is not so common. The purpose of this study was to explore the efficacy and usability of VS in the consultative pulmonary telepathology. 20 lung tumors entered the study. The performance was programmed for 2 medical centers specialized in pulmonary pathology (beginner and advancer in telepathology. A high-quality VSs were prepared by Coolscope (Nikon, Eclipsnet VSL, Japan, and were evaluated via the Internet. The cases were reviewed for the second time with conventional light microscope. VS diagnostic accuracy and the interobserver variability were evaluated. Also the time taken by examiners to render the diagnoses and time needed to scan the microscopic slide were analyzed. Percentage concordance between original glass-slides diagnosis and diagnosis for VSs was very high. Pathologists found the download speed of VSs adequate; experience in telepathology reduced the time of VS diagnosis. VS implementation suggests advantages for teleconsulation and education but also indicate some technical limitations. This is the first Polish trial of VS implementation in telepathology consultative service.
International Nuclear Information System (INIS)
Kozlowski, T.; Carey, T.A.; Maguire, C.F.
1995-01-01
After evaluation of several modern object-oriented methods for development of the computing systems for the PHENIX detector at RHIC, we selected the Shlaer-Mellor Object-Oriented Analysis and Recursive Design method as the most appropriate for the needs and development environment of a large nuclear or high energy physics detector. This paper discusses our specific needs and environment, our method selection criteria, and major features and components of the Shlaer-Mellor method
Kennedy, Scott Warren
A steady decline in the cost of wind turbines and increased experience in their successful operation have brought this technology to the forefront of viable alternatives for large-scale power generation. Methodologies for understanding the costs and benefits of large-scale wind power development, however, are currently limited. In this thesis, a new and widely applicable technique for estimating the social benefit of large-scale wind power production is presented. The social benefit is based upon wind power's energy and capacity services and the avoidance of environmental damages. The approach uses probabilistic modeling techniques to account for the stochastic interaction between wind power availability, electricity demand, and conventional generator dispatch. A method for including the spatial smoothing effect of geographically dispersed wind farms is also introduced. The model has been used to analyze potential offshore wind power development to the south of Long Island, NY. If natural gas combined cycle (NGCC) and integrated gasifier combined cycle (IGCC) are the alternative generation sources, wind power exhibits a negative social benefit due to its high capacity cost and the relatively low emissions of these advanced fossil-fuel technologies. Environmental benefits increase significantly if charges for CO2 emissions are included. Results also reveal a diminishing social benefit as wind power penetration increases. The dependence of wind power benefits on natural gas and coal prices is also discussed. In power systems with a high penetration of wind generated electricity, the intermittent availability of wind power may influence hourly spot prices. A price responsive electricity demand model is introduced that shows a small increase in wind power value when consumers react to hourly spot prices. The effectiveness of this mechanism depends heavily on estimates of the own- and cross-price elasticities of aggregate electricity demand. This work makes a valuable
Design and development of the large helical device TV Thomson scattering
International Nuclear Information System (INIS)
Yamada, I.; Narihara, K.; Funaba, H.; Hayashi, H.
2004-01-01
We have developed a television (TV) Thomson scattering and installed it on the large helical device (LHD). The LHD TV Thomson scattering consists of a yttrium-aluminum-garnet (YAG) laser, beam transport system, scattered light collection optics, spectrometer, intensified charge coupled device camera, and data acquisition system. The spatial and temporal resolutions are about 7 mm and a few seconds, respectively. The temporal resolution of the LHD TV Thomson scattering is not good, but will be enough for long-time, steady-state discharge experiments in LHD. In the initial experiments, we measured electron temperature profiles of LHD plasmas at five spatial points. It has been found that the electron temperatures measured by the LHD TV Thomson scattering reasonably agree with those obtained by the LHD YAG Thomson scattering. We will report the details of the LHD TV Thomson scattering system with some experimental data
Directory of Open Access Journals (Sweden)
Therese Eriksson
2015-08-01
Full Text Available General management research has increasingly recognised the significance of routines in organisational performance. Among organisational tasks, megaprojects depend more on routines selected and created within the project than standard, small-scale projects do, owing largely to their size, duration, and uniqueness. Within this context, the present paper investigates how project routines were established and developed during the early design phase of an inter-organisational megaproject. A case study of a large public infrastructure project was conducted, in which data were collected during observations, semi-structured interviews, and project document studies over the course of three years. Results of analysis revealed that the client exerted the greatest impact on choice of routines and that the temporary nature of tasks limited efforts to fine-tune routines. Changes in routines were primarily reactive to new knowledge concerning project needs. The findings suggest that meta-routines to consciously review routines should be used to a greater extent and designed to capture supplier experiences as well.
Conceptual design and development of a superconducting bus-line for the Large Helical Device
International Nuclear Information System (INIS)
Mito, T.; Takahata, K.; Yamada, S.; Yamamoto, J.; Uede, T.; Ikeda, M.
1993-01-01
A superconducting bus-line is proposed and preliminarily tested as an electrical feeder between the superconducting coils of the Large Helical Device (LHD) and their electrical power supply. The bus-line consists of a superconductor and its cryogenic transfer-line. The superconductor is a specially developed aluminum stabilized NbTi wire, which is installed in the innermost channel of the transfer-line. The vacuum insulated transfer-line consists of four corrugated tubes assembled coaxially. Liquid helium flows through the innermost channel and shield gas flows through another annular channel in the line. We are completing the conceptual design of the bus-line and the installation plan for the LHD experimental hall and are carrying out development of wires, including an investigation of their mechanical properties and electrical insulation. This report describes the conceptual design of the superconducting bus-line for the LHD, and the results we obtained recently during the design and development of a full-scale demonstration facility. (orig.)
Lee, Corinne; Knight, Suzanne W; Smith, Sharon L; Nagle, Dorothy J; DeVries, Lori
This article addresses the development, implementation, and evaluation of an education program for safe patient handling and mobility at a large academic medical center. The ultimate goal of the program was to increase safety during patient mobility/transfer and reduce nursing staff injury from lifting/pulling. This comprehensive program was designed on the basis of the principles of prework, application, and support at the point of care. A combination of online learning, demonstration, skill evaluation, and coaching at the point of care was used to achieve the goal. Specific roles and responsibilities were developed to facilitate implementation. It took 17 master trainers, 88 certified trainers, 176 unit-based trainers, and 98 coaches to put 3706 nurses and nursing assistants through the program. Evaluations indicated both an increase in knowledge about safe patient handling and an increased ability to safely mobilize patients. The challenge now is sustainability of safe patient-handling practices and the growth and development of trainers and coaches.
Examining the Role of Professional Development in a Large School District's iPad Initiative
Liu, Min; Ko, Yujung; Willmann, Amanda; Fickert, Cynda
2018-01-01
This study examined 342 teachers' views of professional development (PD) provided by a large school district to support its iPad initiative. We were interested in investigating teachers' perceptions of this district-provided PD, any change in teachers' views, and how they used iPads in their instruction while/after receiving PD. The findings,…
Directory of Open Access Journals (Sweden)
Jacopo eBiasetti
2012-07-01
Full Text Available Abdominal Aortic Aneurysms (AAAs are frequently characterized by the presenceof an Intra-Luminal Thrombus (ILT known to influence biochemically and biomechanicallytheir evolution. ILT progression mechanism is still unclear and little is known regardingthe impact on this mechanism of the chemical species transported by blood flow.Chemical agonists and antagonists of platelets activation, aggregation, and adhesion andthe proteins involved in the coagulation cascade (CC may play an important role in ILTdevelopment. Starting from this assumption, the evolution of chemical species involvedin the CC, their relation to coherent vortical structures (VSs and their possible effect onILT evolution have been studied. To this end a fluido-chemical model that simulates theCC through a series of convection-diffusion-reaction (CDR equations has been developed.The model involves plasma-phase and surface bound enzymes and zymogens, and includesboth plasma-phase and membrane-phase reactions. Blood is modeled as a non-Newtonianincompressible fluid. VSs convect thrombin in the domain and lead to the high concentration observed in the distal portion of the AAA. This finding is in line with the clinicalobservations showing that the thickest ILT is usually seen in the distal AAA region. Theproposed model, due to its ability to couple the fluid and chemical domains, provides anintegrated mechanochemical picture that potentially could help unveil mechanisms of ILTformation and development.
Fujita, Takatoshi; Mochizuki, Yuji
2018-04-19
We developed the fragment-based method for calculating nonlocal excitations in large molecular systems. This method is based on the multilayer fragment molecular orbital method and the configuration interaction single (CIS) wave function using localized molecular orbitals. The excited-state wave function for the whole system is described as a superposition of configuration state functions (CSFs) for intrafragment excitations and for interfragment charge-transfer excitations. The formulation and calculations of singlet excited-state Hamiltonian matrix elements in the fragment CSFs are presented in detail. The efficient approximation schemes for calculating the matrix elements are also presented. The computational efficiency and the accuracy were evaluated using the molecular dimers and molecular aggregates. We confirmed that absolute errors of 50 meV (relative to the conventional calculations) are achievable for the molecular systems in their equilibrium geometries. The perturbative electron correlation correction to the CIS excitation energies is also demonstrated. The present theory can compute a large number of excited states in large molecular systems; in addition, it allows for the systematic derivation of a model exciton Hamiltonian. These features are useful for studying excited-state dynamics in condensed molecular systems based on the ab initio electronic structure theory.
Recent Developments in Language Assessment and the Case of Four Large-Scale Tests of ESOL Ability
Stoynoff, Stephen
2009-01-01
This review article surveys recent developments and validation activities related to four large-scale tests of L2 English ability: the iBT TOEFL, the IELTS, the FCE, and the TOEIC. In addition to describing recent changes to these tests, the paper reports on validation activities that were conducted on the measures. The results of this research…
Development of estrogen receptor beta binding prediction model using large sets of chemicals.
Sakkiah, Sugunadevi; Selvaraj, Chandrabose; Gong, Ping; Zhang, Chaoyang; Tong, Weida; Hong, Huixiao
2017-11-03
We developed an ER β binding prediction model to facilitate identification of chemicals specifically bind ER β or ER α together with our previously developed ER α binding model. Decision Forest was used to train ER β binding prediction model based on a large set of compounds obtained from EADB. Model performance was estimated through 1000 iterations of 5-fold cross validations. Prediction confidence was analyzed using predictions from the cross validations. Informative chemical features for ER β binding were identified through analysis of the frequency data of chemical descriptors used in the models in the 5-fold cross validations. 1000 permutations were conducted to assess the chance correlation. The average accuracy of 5-fold cross validations was 93.14% with a standard deviation of 0.64%. Prediction confidence analysis indicated that the higher the prediction confidence the more accurate the predictions. Permutation testing results revealed that the prediction model is unlikely generated by chance. Eighteen informative descriptors were identified to be important to ER β binding prediction. Application of the prediction model to the data from ToxCast project yielded very high sensitivity of 90-92%. Our results demonstrated ER β binding of chemicals could be accurately predicted using the developed model. Coupling with our previously developed ER α prediction model, this model could be expected to facilitate drug development through identification of chemicals that specifically bind ER β or ER α .
Avissar, Roni; Chen, Fei
1993-01-01
Generated by landscape discontinuities (e.g., sea breezes) mesoscale circulation processes are not represented in large-scale atmospheric models (e.g., general circulation models), which have an inappropiate grid-scale resolution. With the assumption that atmospheric variables can be separated into large scale, mesoscale, and turbulent scale, a set of prognostic equations applicable in large-scale atmospheric models for momentum, temperature, moisture, and any other gaseous or aerosol material, which includes both mesoscale and turbulent fluxes is developed. Prognostic equations are also developed for these mesoscale fluxes, which indicate a closure problem and, therefore, require a parameterization. For this purpose, the mean mesoscale kinetic energy (MKE) per unit of mass is used, defined as E-tilde = 0.5 (the mean value of u'(sub i exp 2), where u'(sub i) represents the three Cartesian components of a mesoscale circulation (the angle bracket symbol is the grid-scale, horizontal averaging operator in the large-scale model, and a tilde indicates a corresponding large-scale mean value). A prognostic equation is developed for E-tilde, and an analysis of the different terms of this equation indicates that the mesoscale vertical heat flux, the mesoscale pressure correlation, and the interaction between turbulence and mesoscale perturbations are the major terms that affect the time tendency of E-tilde. A-state-of-the-art mesoscale atmospheric model is used to investigate the relationship between MKE, landscape discontinuities (as characterized by the spatial distribution of heat fluxes at the earth's surface), and mesoscale sensible and latent heat fluxes in the atmosphere. MKE is compared with turbulence kinetic energy to illustrate the importance of mesoscale processes as compared to turbulent processes. This analysis emphasizes the potential use of MKE to bridge between landscape discontinuities and mesoscale fluxes and, therefore, to parameterize mesoscale fluxes
Development of large components for the fusion reactor vacuum circuits
International Nuclear Information System (INIS)
Perinic, D.; Lorrain, C.
1986-06-01
The Commission of the European Communities appointed in mid-1983 the Centre d'Etudes Nucleaires de Saclay and the Kernforschungszentrum Karlsruhe GmbH to investigate whether large vacuum components for use in the fusion machine can be built. The following individual targets have been defined for studies under this project: - Elaboration of technical specifications for large components. - Investigation of the feasibility. - Specification of the tests required and planning of a testing facility. The plasma chamber pumping system is essentially concerned
Managing large-scale models: DBS
International Nuclear Information System (INIS)
1981-05-01
A set of fundamental management tools for developing and operating a large scale model and data base system is presented. Based on experience in operating and developing a large scale computerized system, the only reasonable way to gain strong management control of such a system is to implement appropriate controls and procedures. Chapter I discusses the purpose of the book. Chapter II classifies a broad range of generic management problems into three groups: documentation, operations, and maintenance. First, system problems are identified then solutions for gaining management control are disucssed. Chapters III, IV, and V present practical methods for dealing with these problems. These methods were developed for managing SEAS but have general application for large scale models and data bases
Simulation of the Impact of SRT on Anaerobic Digestability of Ultrasonicated Hog Manure
Elbeshbishy; Nakevski; Hafez; Ray; Nakhla
2010-01-01
Ultrasonication at a specific energy of 500 kJ/kgTS was applied to hog manure in a continuous mode completely mixed anaerobic digestion. A process model in BioWin was developed, calibrated and tested at different solids retention times (SRTs) to evaluate the process economics. The results showed that there was a 36% increase in volatile suspended solids (VSS) removal efficiency, a 20% increase in methane production rate, a 13.5% increase in destruction of bound proteins, and a reduction from ...
International Nuclear Information System (INIS)
Shi, Y; Babu, N Hari; Cardwell, D A
2005-01-01
The critical current density, J c , irreversibility field, B irr , and magnetic field trapping ability of (LRE)-Ba-Cu-O bulk superconductors, where LRE is a light rare earth element such as Nd, Sm, Eu and Gd, are generally superior to those of the more common melt-processed Y-Ba-Cu-O (YBCO). The lack of availability of a suitable seed crystal to grow large, single grain (LRE)-Ba-Cu-O superconductors with controlled orientation, however, has hindered severely the development of these materials for engineering applications over the past ten years. In this communication we report for the first time the development of a generic seed crystal that can be used to fabricate any rare earth (RE) based (RE)-Ba-Cu-O ((RE)BCO) superconductor in the form of a large single grain with controlled orientation. The new seed crystal will potentially enable large grain (LRE)-Ba-Cu-O bulk superconductors to be fabricated routinely, as is the case for YBCO. This will enable the field trapping and current-carrying characteristics of these materials to be explored in more detail than has been possible to date. (rapid communication)
Development of the monoblock rotor for large scale LP turbine
International Nuclear Information System (INIS)
Ninomiya, Satoshi; Kashiwahara, Katsuto
1981-01-01
One of the important points in large steam turbines is the long last stage blades. So far, rotor disks were shrink-fitted to a shaft, but recently, the operation of steam turbines requires frequent start and stop, and is subjected to frequent load variation. In order to improve the reliability of steam turbines drastically under such situation, the large rotors of one-body forging type have been demanded. Hitachi Ltd. Manufactured a large rotor of one-body forging type for trial, and in order to confirm its reliability, the rotation test simulating the temperature distribution in the operation of steam turbines was carried out. The large material must be thoroughly forged to the inner part, and the effect of heat treatment reaches to the whole body, thus the prescribed chemical composition and mechanical properties must be obtained. The material must be homogeneous and stable to the thermal effect in operation. The largest outside diameter of the rotor is about 2.5 m, the shaft length is 12 m, and the finished weight is 220 t. A 500 t ingot of Ni-Cr-Mo-V steel was used. As the results of various tests, it was confirmed that the material was clean and homogeneous, and had good mechanical properties. Also the material was sufficiently thermally stable in the heating deflection measurement. In the high speed rotation test at the actual temperature, the vibration of the rotor was very small, and the good result was obtained. (Kako, I.)
The Waterfall Model in Large-Scale Development
Petersen, Kai; Wohlin, Claes; Baca, Dejan
Waterfall development is still a widely used way of working in software development companies. Many problems have been reported related to the model. Commonly accepted problems are for example to cope with change and that defects all too often are detected too late in the software development process. However, many of the problems mentioned in literature are based on beliefs and experiences, and not on empirical evidence. To address this research gap, we compare the problems in literature with the results of a case study at Ericsson AB in Sweden, investigating issues in the waterfall model. The case study aims at validating or contradicting the beliefs of what the problems are in waterfall development through empirical research.
International Nuclear Information System (INIS)
Bitterling, Oliver
2017-01-01
This works describes the results of a three year project to improve the radiation tolerance of the Quench Protection System of the CERN Large Hadron Collider. Radiation-induced premature beam aborts have been a limiting factor for accelerator availability in the recent years. Furthermore, the future upgrade of the Large Hadron Collider to its High Luminosity phase will further increase the radiation load and has higher requirements for the overall machine availability. Therefore equipment groups like the Quench protection groups have used the last years to redesign many of their systems to fulfill those requirements. In support of the development of radiation-tolerant systems, several proton beam irradiation campaigns were conducted to determine the inherent radiation tolerance of a selection of varied electronic components. Using components from this selection a new Quench Protection System for the 600 A corrector magnets was developed. The radiation tolerance of this system was further improved by developing a filter and error correction system for all discovered failure modes. Furthermore, compliance of the new system with the specification was shown by simulating the behavior of the system using data taken from the irradiation campaigns. The resulting system is operational since the beginning of 2016 and has in the first 9 months of operation not shown a single radiation-induced failure. Using results from simulations and irradiation campaigns the predicted failure cross section for the full new 600 A Quench Protection System is 4.358±0.564.10 -10 cm 2 which is one order of magnitude lower than the target set during the development of this system.
Directory of Open Access Journals (Sweden)
Thomas Hennig
2016-10-01
Full Text Available Southwest China’s Yunnan province is evolving into one of the world’s largest hydro-power-producing regions. It already rivals the world’s largest hydro-producing nations. However, five of Yunnan’s six basins are international and therefore its hydropower development is of great academic and geopolitical interest. While the implementation of large projects on Yunnan’s three large rivers (Jinsha, Mekong and Nu is relatively well studied, hydropower development outside these three main streams is hardly known. Here, we identified 128 large hydropower projects (≥50 MW having a capacity of 16.5 GW, along with another 16.4 GW of other types of power generation, neither of which has been discussed in the academic literature yet. The paper utilizes a powershed approach to study the rapid hydropower development underway in Yunnan, both in its implication and challenges (at basin and administrative level as well as in its trade-offs within the broader electricity context. Yunnan’s power generation and consumption patterns are characterized by diverging interests of local/provincial usage and export utilization. Within the province, the largest (hydro- power users are energy/electricity intensive industries, which themselves have strong impacts on land use changes. Yunnan is also evolving as a major power exporter, already in 2013 exporting about one-third of its generated electricity mainly to Guangdong’s Pearl River Delta. We see a need for a critical revision of those existing generation and consumption paradigms, which includes a rethinking of major development modes, both in terms of future hydropower generation and utilization projects as well as export obligations.
Large-Signal Code TESLA: Current Status and Recent Development
National Research Council Canada - National Science Library
Chernyavskiy, Igor A; Vlasov, Alexander N; Cooke, Simon J; Abe, David K; Levush, Baruch; Antonsen, Jr., Thomas M; Nguyen, Khanh T
2008-01-01
.... One such tool is the large-signal code TESLA, which was successfully applied for the modeling of single-beam and multiple-beam klystron devices at the Naval Research Laboratory and which is now used by number of U.S. companies...
The waterfall model in large-scale development
Petersen, Kai; Wohlin, Claes; Baca, Dejan
2009-01-01
Waterfall development is still a widely used way of working in software development companies. Many problems have been reported related to the model. Commonly accepted problems are for example to cope with change and that defects all too often are detected too late in the software development process. However, many of the problems mentioned in literature are based on beliefs and experiences, and not on empirical evidence. To address this research gap, we compare the problems in literature wit...
An insider's perspective on entrepreneurial program development at a small and a large institution.
Lehman, Michael S
2013-09-01
Entrepreneurship educators have an opportunity to learn from the entrepreneurship programs at both small colleges and large universities that have already sprouted up and experienced growth, challenges, failures, and ultimate successes. Programs that have contributed to the current entrepreneurship milieu can help leaders who are launching new programs or retooling existing ones, providing information to assist in defining their outcome objectives and refining their offerings. The development of new entrepreneurship programs, one at a private liberal arts institution and one at a large state-related research university, is evaluated. The common threads of "what worked" are identified, highlighting themes that other institutions of any size undertaking new initiatives can leverage. Themes discussed include the identification of institutional champions, communication with members of the "student supply chain," and offering both non-credit, experience-based opportunities and dynamic for-credit courses. In addition, implementing a strategy that includes faculty partnerships, designated advisory boards, and refined bootstrapping skills helps to ensure that robust human and capital resources are available for program delivery, growth, and sustainability.
Conceptual design and costs of large wind turbines
International Nuclear Information System (INIS)
Hau, E.; Harrison, R.; Cockerill, T.T.; Snel, H.
1996-01-01
The development of large wind turbines, with capacities in excess of 1 MW is reviewed. Despite statistical evidence to the contrary, there are some reasons to be optimistic that further development will render large machines economic for commercial uses. The direction in which such development should proceed is unclear, however. A cost model, founded on the principles of conceptual design, with the objective of evaluating large wind turbine design options is described. Use of the model allows conclusions to be drawn regarding the potential for development of certain large wind turbine configurations. (author)
Developments and validation of large eddy simulation of turbulent flows in an industrial code
International Nuclear Information System (INIS)
Ackermann, C.
2000-01-01
Large Eddy Simulation, where large scales of the flow are resolved and sub-grid scales are modelled, is well adapted to the study of turbulent flow, in which geometry and/or heat transfer effects lead to unsteady phenomena. To obtain an improved numerical tool, simulations of elementary test cases, Homogeneous Isotropic Turbulence and Turbulent Plane Channel, were clone on both structured and unstructured grids, before moving to more complex geometries. This allowed the influence of the different physical and numerical parameters to be studied separately. On structured grids, the different properties of the numerical methods corresponding to our problem were identified, a new sub-grid model was elaborated and several laws of the wall tested: for this discretization, our numerical tool is yet validated. On unstructured grids, the construction of numerical methods with the same properties as on the structured grids is harder, especially for the convection scheme: several numerical schemes were tested, and sub-grid models and laws of the wall were adapted to unstructured grids. Simulations of the same elementary tests were clone: the results are relatively satisfactorily, even if they are not so good as the one obtained in structured grids, most probably because the numerical methods chosen cannot perfectly isolate the effects between the convection scheme, physical modelling and the mesh chosen. This work is the first stage towards the development of a practical Large Eddy Simulation tool for unstructured grid. (author) [fr
Kessel, Steven Thomas; Elamin, Nasreldin Alhasan; Yurkowski, David James; Chekchak, Tarik; Walter, Ryan Patrick; Klaus, Rebecca; Hill, Graham; Hussey, Nigel Edward
2017-01-01
A large reef manta ray (Manta alfredi) aggregation has been observed off the north Sudanese Red Sea coast since the 1950s. Sightings have been predominantly within the boundaries of a marine protected area (MPA), which was designated a UNESCO World Heritage Site in July 2016. Contrasting economic development trajectories have been proposed for the area (small-scale ecotourism and large-scale island development). To examine space-use, Wildlife Computers® SPOT 5 tags were secured to three manta rays. A two-state switching Bayesian state space model (BSSM), that allowed movement parameters to switch between resident and travelling, was fit to the recorded locations, and 50% and 95% kernel utilization distributions (KUD) home ranges calculated. A total of 682 BSSM locations were recorded between 30 October 2012 and 6 November 2013. Of these, 98.5% fell within the MPA boundaries; 99.5% for manta 1, 91.5% for manta 2, and 100% for manta 3. The BSSM identified that all three mantas were resident during 99% of transmissions, with 50% and 95% KUD home ranges falling mainly within the MPA boundaries. For all three mantas combined (88.4%), and all individuals (manta 1-92.4%, manta 2-64.9%, manta 3-91.9%), the majority of locations occurred within 15 km of the proposed large-scale island development. Results indicated that the MPA boundaries are spatially appropriate for manta rays in the region, however, a close association to the proposed large-scale development highlights the potential threat of disruption. Conversely, the focused nature of spatial use highlights the potential for reliable ecotourism opportunities.
Directory of Open Access Journals (Sweden)
Steven Thomas Kessel
Full Text Available A large reef manta ray (Manta alfredi aggregation has been observed off the north Sudanese Red Sea coast since the 1950s. Sightings have been predominantly within the boundaries of a marine protected area (MPA, which was designated a UNESCO World Heritage Site in July 2016. Contrasting economic development trajectories have been proposed for the area (small-scale ecotourism and large-scale island development. To examine space-use, Wildlife Computers® SPOT 5 tags were secured to three manta rays. A two-state switching Bayesian state space model (BSSM, that allowed movement parameters to switch between resident and travelling, was fit to the recorded locations, and 50% and 95% kernel utilization distributions (KUD home ranges calculated. A total of 682 BSSM locations were recorded between 30 October 2012 and 6 November 2013. Of these, 98.5% fell within the MPA boundaries; 99.5% for manta 1, 91.5% for manta 2, and 100% for manta 3. The BSSM identified that all three mantas were resident during 99% of transmissions, with 50% and 95% KUD home ranges falling mainly within the MPA boundaries. For all three mantas combined (88.4%, and all individuals (manta 1-92.4%, manta 2-64.9%, manta 3-91.9%, the majority of locations occurred within 15 km of the proposed large-scale island development. Results indicated that the MPA boundaries are spatially appropriate for manta rays in the region, however, a close association to the proposed large-scale development highlights the potential threat of disruption. Conversely, the focused nature of spatial use highlights the potential for reliable ecotourism opportunities.
MANAGING LARGE CLASSES IN DEVELOPING COUNTRIES
African Journals Online (AJOL)
PROF. BARTH EKWUEME
GLOBAL JOURNAL OF EDUCATIONAL RESEARCH VOL 15, 2016: 31-39. COPYRIGHT© ... classes or overcrowded classrooms affect the quality of education delivered in the school system. ... central to their national development strategy.
Development of large-area silicon photomultiplier detectors for PET applications at FBK
Energy Technology Data Exchange (ETDEWEB)
Zorzi, Nicola, E-mail: zorzi@fbk.eu [Fondazione Bruno Kessler (FBK), Via Sommarive 18, I-38123 Trento Povo (Italy); Melchiorri, Mirko; Piazza, Alessandro; Piemonte, Claudio; Tarolli, Alessandro [Fondazione Bruno Kessler (FBK), Via Sommarive 18, I-38123 Trento Povo (Italy)
2011-04-21
This paper reports on the development of large-area silicon photomultiplier (SiPM) detectors specifically designed for positron emission tomography (PET) instruments. The sensors under study are monolithic arrays of two different types: a 2x2 array of {approx}4x4 mm{sup 2} elements and an 8x8 array of 1.5x1.5 mm{sup 2} pixels. These devices are characterized at wafer level by means of an automatic test procedure, consisting of current-voltage curves in forward and reverse bias. The tests allowed selection of functioning devices and evaluation of the uniformity of basic parameters. Results of the electrical characterization are reported showing that acceptable values of yield together with rather uniform distribution of parameters have been obtained. Reliability of produced SiPMs has been proved by long-term accelerated stress tests.
Development of large-area silicon photomultiplier detectors for PET applications at FBK
International Nuclear Information System (INIS)
Zorzi, Nicola; Melchiorri, Mirko; Piazza, Alessandro; Piemonte, Claudio; Tarolli, Alessandro
2011-01-01
This paper reports on the development of large-area silicon photomultiplier (SiPM) detectors specifically designed for positron emission tomography (PET) instruments. The sensors under study are monolithic arrays of two different types: a 2x2 array of ∼4x4 mm 2 elements and an 8x8 array of 1.5x1.5 mm 2 pixels. These devices are characterized at wafer level by means of an automatic test procedure, consisting of current-voltage curves in forward and reverse bias. The tests allowed selection of functioning devices and evaluation of the uniformity of basic parameters. Results of the electrical characterization are reported showing that acceptable values of yield together with rather uniform distribution of parameters have been obtained. Reliability of produced SiPMs has been proved by long-term accelerated stress tests.
Quenches in large superconducting magnets
International Nuclear Information System (INIS)
Eberhard, P.H.; Alston-Garnjost, M.; Green, M.A.; Lecomte, P.; Smits, R.G.; Taylor, J.D.; Vuillemin, V.
1977-08-01
The development of large high current density superconducting magnets requires an understanding of the quench process by which the magnet goes normal. A theory which describes the quench process in large superconducting magnets is presented and compared with experimental measurements. The use of a quench theory to improve the design of large high current density superconducting magnets is discussed
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-03-07
Mar 7, 2018 ... International License. ... Journal of Fundamental and Applied Scienc ... ndamental and Applied Sciences is licensed under a Creative Commons Attribution ... spatial skills (VSS), level of Geometry thinking (LGT), SketchUp.
Developing a GIS to facilitate data analysis for environmental restoration of a large waste site
International Nuclear Information System (INIS)
Tzemos, S.; Evans, B.J.; White, M.E.
1991-05-01
The Hanford Site area located southeastern Washington State and is a US Department of Energy Superfund cleanup site. The site contains a complex mixture of chemical and radioactive pollutants, which makes environmental monitoring, analysis, and restoration a complicated task. The Hanford Environmental Information System (HEIS) has been developed to manage the data generated from the characterization and environmental monitoring of the Hanford Site. The Geographic Information Systems (GIS) component of HEIS, known as HEISGIS, is being developed to help scientists spatially analyze the environmental data stored in the HEIS database and provide an integrated system for environmental restoration. HEISGIS is in its second stage of development. The first stage produced a working prototype. The second stage focuses on improvements in data accuracy, data standardization, analytical modeling capabilities, interfaces between the various software packages, and the graphical user interface. This paper describes the development of the HEISGIS and summarizes the considerations and difficulties encountered in the integration of the GIS with a large relational database. 1 ref., 1 fig., 3 tabs
Energy Technology Data Exchange (ETDEWEB)
Bitterling, Oliver
2017-04-03
This works describes the results of a three year project to improve the radiation tolerance of the Quench Protection System of the CERN Large Hadron Collider. Radiation-induced premature beam aborts have been a limiting factor for accelerator availability in the recent years. Furthermore, the future upgrade of the Large Hadron Collider to its High Luminosity phase will further increase the radiation load and has higher requirements for the overall machine availability. Therefore equipment groups like the Quench protection groups have used the last years to redesign many of their systems to fulfill those requirements. In support of the development of radiation-tolerant systems, several proton beam irradiation campaigns were conducted to determine the inherent radiation tolerance of a selection of varied electronic components. Using components from this selection a new Quench Protection System for the 600 A corrector magnets was developed. The radiation tolerance of this system was further improved by developing a filter and error correction system for all discovered failure modes. Furthermore, compliance of the new system with the specification was shown by simulating the behavior of the system using data taken from the irradiation campaigns. The resulting system is operational since the beginning of 2016 and has in the first 9 months of operation not shown a single radiation-induced failure. Using results from simulations and irradiation campaigns the predicted failure cross section for the full new 600 A Quench Protection System is 4.358±0.564.10{sup -10} cm{sup 2} which is one order of magnitude lower than the target set during the development of this system.
Rules of song development and their use in vocal interactions by birds with large repertoires
Geberzahn Nicole; Hultsch Henrike
2004-01-01
Songbirds are well known for settling their disputes by vocal signals, and their singing plays a dominant role. Most studies on this issue have concentrated on bird species that develop and use small vocal repertoires. In this article we will go farther and focus on examples of how species with large song repertoires make use of their vocal competence. In particular, we will outline the study of interaction rules which have been elucidated by examining time- and pattern-specific relationships...
Jadcherla, Sudarshan R.; Stoner, Erin; Gupta, Alankar; Bates, D. Gregory; Fernandez, Soledad; Di Lorenzo, Carlo; Linscheid, Thomas
2013-01-01
Background and objectives Abnormal swallowing (dysphagia) among neonates is commonly evaluated using the videofluoroscopic swallow study (VSS). Radiological findings considered high risk for administration of oral feeding include nasopharyngeal reflux, laryngeal penetration, aspiration, or pooling. Our aims were to determine pharyngoesophageal motility correlates in neonates with dysphagia and the impact of multidisciplinary feeding strategy. Methods Twenty dysphagic neonates (mean gestation ± standard deviation [SD] = 30.9 ± 4.9 weeks; median 31.1 weeks; range = 23.7–38.6 weeks) with abnormal VSS results were evaluated at 49.9 ± 16.5 weeks (median 41.36 weeks) postmenstrual age. The subjects underwent a swallow-integrated pharyngoesophageal motility assessment of basal and adaptive swallowing reflexes using a micromanometry catheter and pneumohydraulic water perfusion system. Based on observations during the motility study, multidisciplinary feeding strategies were applied and included postural adaptation, sensory modification, hunger manipulation, and operant conditioning methods. To discriminate pharyngoesophageal manometry correlates between oral feeders and tube feeders, data were stratified based on the primary feeding method at discharge, oral feeding versus tube feeding. Results At discharge, 15 of 20 dysphagic neonates achieved oral feeding success, and the rest required chronic tube feeding. Pharyngoesophageal manometry correlates were significantly different (P dysphagia or its consequences. Manometry may be a better predictor than VSS in identifying patients who are likely to succeed in vigorous intervention programs. PMID:19179881
Association between vestibular schwannomas and mobile phone use.
Moon, In Seok; Kim, Bo Gyung; Kim, Jinna; Lee, Jong Dae; Lee, Won-Sang
2014-01-01
Vestibular schwannomas (VSs) grow in the region where the energy from mobile phone use is absorbed. We examined the associations of VSs with mobile phone use. This study included 119 patients who had undergone surgical tumor removal. We used two approaches in this investigation. First, a case-control study for the association of mobile phone use and incidence of VSs was conducted. Both cases and controls were investigated with questions based on INTERPHONE guidelines. Amount of mobile phone use according to duration, daily amount, and cumulative hours were compared between two groups. We also conducted a case-case study. The location and volume of the tumors were investigated by MRI. Associations between the estimated amount of mobile phone use and tumor volume and between the laterality of phone use and tumor location were analyzed. In a case-control study, the odds ratio (OR) of tumor incidence according to mobile phone use was 0.956. In the case-case study, tumor volume and estimated cumulative hours showed a strong correlation (r(2) = 0.144, p = 0.002), and regular mobile phone users showed tumors of a markedly larger volume than those of non-regular users (p mobile phones and tumor volume that showed strong correlation with amount of mobile phone use, thus there is a possibility that mobile phone use may affect tumor growth.
Ye, Tingting; Li, Xiang; Zhang, Ting; Su, Yinglong; Zhang, Wenjuan; Li, Jun; Gan, Yanfei; Zhang, Ai; Liu, Yanan; Xue, Gang
2018-03-20
Bio-refinery of food waste and waste activated sludge to high value-added chemicals, such as lactic acid, has attracted particular interest in recent years. In this paper, the effect of copper (II) dosing to the organic waste fermentation system on lactic acid production was evaluated, which proved to be a promising method to stimulate high yield of lactic acid (77.0% higher than blank) at dosage of 15 μM-Cu 2+ /g VSS. As mechanism study suggested, copper addition enhanced the activity of α-glycosidase and glycolysis, which increased the substrate for subsequent acidification; whereas, the high dosage (70 μM-Cu 2+ /g VSS) inhibited the conversion of lactic acid to VFA, thus stabilized lactic acid concentration. Microbial community study revealed that small amount of copper (II) at 15 μM/g VSS resulted in the proliferation of Lactobacillus to 82.6%, which mainly produced lactic acid. Finally, the variation of functional capabilities implied that the proposed homeostatic system II was activated at relatively low concentration of copper. Meanwhile, membrane transport function and carbohydrate metabolism were also strengthened. This study provides insights into the effect of copper (II) on the enhancement of lactic acid production from co-fermentation of food waste and waste activated sludge. Copyright © 2018 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Hayashi, Daisuke; Krey, Matthias
2007-01-01
This paper assesses clean development mechanism (CDM) potential of large-scale energy efficiency measures in selected heavy industries (iron and steel, cement, aluminium, pulp and paper, and ammonia) taking India and Brazil as examples of CDM project host countries. We have chosen two criteria for identification of the CDM potential of each energy efficiency measure: (i) emission reductions volume (in CO 2 e) that can be expected from the measure and (ii) likelihood of the measure passing the additionality test of the CDM Executive Board (EB) when submitted as a proposed CDM project activity. The paper shows that the CDM potential of large-scale energy efficiency measures strongly depends on the project-specific and country-specific context. In particular, technologies for the iron and steel industry (coke dry quenching (CDQ), top pressure recovery turbine (TRT), and basic oxygen furnace (BOF) gas recovery), the aluminium industry (point feeder prebake (PFPB) smelter), and the pulp and paper industry (continuous digester technology) offer promising CDM potential
International Nuclear Information System (INIS)
Okawa, Tomio; Yoneda, Kimitoshi
1998-01-01
It is experimentally clarified that behavior of gas-liquid two-phase flow in large diameter pipe is different from one occurred in small diameter pipe. However, no special model for large diameter pipe is used in existing nuclear reactor safety analysis codes. In the present study, detailed investigation about the two-phase flow model used in the safety analysis was carried out to specify the physical phenomena which should be modeled more precisely. Based on the investigation, steam-water two-phase flow experiments using large diameter pipe was conducted to obtain new models. As a result, new evaluation methods for bubble size, heterogeneous distribution of void fraction, and wake formed behind bubble were developed. These new models were applied to the prediction of steam-water two-phase flow experiments using large diameter pipes to clarify their validity. It was consequently demonstrated that the accuracy of the numerical solution is remarkably improved not only for the experiment used for model development but also for the experiment where the pipe diameter, pressure, velocities, void fraction are different. (author)
International Nuclear Information System (INIS)
Misawa, Takeharu; Yoshida, Hiroyuki; Akimoto, Hajime
2008-01-01
In Japan Atomic Energy Agency (JAEA), the Innovative Water Reactor for Flexible Fuel Cycle (FLWR) has been developed. For thermal design of FLWR, it is necessary to develop analytical method to predict boiling transition of FLWR. Japan Atomic Energy Agency (JAEA) has been developing three-dimensional two-fluid model analysis code ACE-3D, which adopts boundary fitted coordinate system to simulate complex shape channel flow. In this paper, as a part of development of ACE-3D to apply to rod bundle analysis, introduction of parallelization to ACE-3D and assessments of ACE-3D are shown. In analysis of large-scale domain such as a rod bundle, even two-fluid model requires large number of computational cost, which exceeds upper limit of memory amount of 1 CPU. Therefore, parallelization was introduced to ACE-3D to divide data amount for analysis of large-scale domain among large number of CPUs, and it is confirmed that analysis of large-scale domain such as a rod bundle can be performed by parallel computation with keeping parallel computation performance even using large number of CPUs. ACE-3D adopts two-phase flow models, some of which are dependent upon channel geometry. Therefore, analyses in the domains, which simulate individual subchannel and 37 rod bundle, are performed, and compared with experiments. It is confirmed that the results obtained by both analyses using ACE-3D show agreement with past experimental result qualitatively. (author)
Susan Will-Wolf; Peter Neitlich
2010-01-01
Development of a regional lichen gradient model from community data is a powerful tool to derive lichen indexes of response to environmental factors for large-scale and long-term monitoring of forest ecosystems. The Forest Inventory and Analysis (FIA) Program of the U.S. Department of Agriculture Forest Service includes lichens in its national inventory of forests of...
Development of a spatially uniform fast ionization wave in a large-volume discharge
International Nuclear Information System (INIS)
Zatsepin, D.V.; Starikovskaya, S.M.; Starikovskii, A.Yu.
1998-01-01
A study is made of a high-voltage nanosecond breakdown in the form of a fast ionization wave produced in a large-volume (401) discharge chamber. The propagation speed of the wave front and the integral energy deposition in a plasma are measured for various regimes of the air discharge at pressures of 10 -2 -4 Torr. A high degree of both the spatial uniformity of the discharge and the reproducibility of the discharge parameters is obtained. The possibility of the development of a fast ionization wave in an electrodeless system is demonstrated. A transition of the breakdown occurring in the form of a fast ionization wave into the streamer breakdown is observed. It is shown that such discharges are promising for technological applications
McDougall, Cameron M; Ban, Vin Shen; Beecher, Jeffrey; Pride, Lee; Welch, Babu G
2018-03-02
OBJECTIVE The role of venous sinus stenting (VSS) for idiopathic intracranial hypertension (IIH) is not well understood. The aim of this systematic review is to attempt to identify subsets of patients with IIH who will benefit from VSS based on the pressure gradients of their venous sinus stenosis. METHODS MEDLINE/PubMed was searched for studies reporting venous pressure gradients across the stenotic segment of the venous sinus, pre- and post-stent pressure gradients, and clinical outcomes after VSS. Findings are reported according to the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses) guidelines. RESULTS From 32 eligible studies, a total of 186 patients were included in the analysis. Patients who had favorable outcomes had higher mean pressure gradients (22.8 ± 11.5 mm Hg vs 17.4 ± 8.0 mm Hg, p = 0.033) and higher changes in pressure gradients after stent placement (19.4 ± 10.0 mm Hg vs 12.0 ± 6.0 mm Hg, p = 0.006) compared with those with unfavorable outcomes. The post-stent pressure gradients between the 2 groups were not significantly different (2.8 ± 4.0 mm Hg vs 2.7 ± 2.0 mm Hg, p = 0.934). In a multivariate stepwise logistic regression controlling for age, sex, body mass index, CSF opening pressure, pre-stent pressure gradient, and post-stent pressure gradient, the change in pressure gradient with stent placement was found to be an independent predictor of favorable outcome (p = 0.028). Using a pressure gradient of 21 as a cutoff, 81/86 (94.2%) of patients with a gradient > 21 achieved favorable outcomes, compared with 82/100 (82.0%) of patients with a gradient ≤ 21 (p = 0.022). CONCLUSIONS There appears to be a relationship between the pressure gradient of venous sinus stenosis and the success of VSS in IIH. A randomized controlled trial would help elucidate this relationship and potentially guide patient selection.
Linear accelerator radiosurgery for vestibular schwannomas: Results of medium-term follow-up.
Ellenbogen, Jonathan R; Waqar, Mueez; Kinshuck, Andrew J; Jenkinson, Michael D; Lesser, Tristram H J; Husband, David; Javadpour, Mohsen
2015-01-01
To examine tumour control, via volume changes, and the complications of linear accelerator (LINAC)-based stereotactic radiosurgery (SRS) treatment of vestibular schwannomas (VSs) on medium-term follow-up. Between September 2003 and November 2009 fifty consecutive patients with VSs treated with SRS using a marginal dose of 12.5 Gy utilizing a LINAC equipped with a micro-multileaf collimator were identified. Evaluation included serial magnetic resonance imaging (MRI), and neurological and hearing examinations. The median tumour volume at treatment was 2.4 (range: 0.24-10.59) cm3. The intracranial diameter of the tumours ranged between 7.7 and 28.7 (median: 15.8) mm. Follow-up MRI was available for analysis on 49 patients. The median radiological follow-up period was 5.8 (range: 1.4-9.2) years. The median tumour volume at last follow-up was 1.1 (range: 0.03-5.3) cm3. VS decreased in size in 45 (90%) patients, with a median reduction in tumour volume of 1.46 (range: 0.06-9.29) cm3 or a median tumour size reduction of 59% of the baseline (range: 6-90%) in these patients. VS remained stable in 2 patients and increased in size in 2 patients. Only 1 patient (2%) required additional intervention (surgery). 15 patients had useful hearing pre-treatment; 10 post-treatment pure-tone audiograms of these patients were available. 5 (50%) patients still had useful hearing post treatment. Non-auditory adverse radiation effects included new (House-Brackmann grade II) or worsened facial nerve palsy (House-Brackmann grade II to grade V) in 2 (4%) patients and trigeminal sensory disturbance in 2 (4%) patients. At medium term, the vast majority of VSs treated with LINAC-based SRS exhibit tumour shrinkage. The slightly higher rate of facial nerve palsy compared with Gamma Knife surgery (GKS) results may be related to the learning curve. Other complications were similar to reported GKS results for VSs of comparable sizes.
Investigation and development of the suppression methods of the {sup 42}K background in LArGe
Energy Technology Data Exchange (ETDEWEB)
Lubashevskiy, Alexey [Max-Planck-Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); Collaboration: GERDA-Collaboration
2013-07-01
GERDA is an ultra-low background experiment aimed for the neutrinoless double beta decay search. The search is performed using HPGe detectors operated in liquid argon (LAr). One of the most dangerous backgrounds in GERDA is the background from {sup 42}K which is a daughter isotope of cosmogenically produced {sup 42}Ar. {sup 42}K ions are collected towards to the detector by the electric field of the detector. Estimation of the background contribution and development of the suppression methods were performed in the low background test facility LArGe. For this purpose encapsulated HPGe and bare BEGe detectors were operated in 1m{sup 3} of LAr in the LArGe setup. It is equipped with scintillation veto, so particles which deposit part of their energy in LAr can be detected by 9 PMTs. In order to better understand background and to increase statistics the LAr of LArGe was spiked with specially produced {sup 42}Ar. All these investigations allowed us to estimate background contribution from {sup 42}K and demonstrate the possibility to suppress it in future measurements in GERDA Phase II.
Developing natural convection in a fluid layer with localized heating and large viscosity variation
Energy Technology Data Exchange (ETDEWEB)
Hickox, C.E.; Chu, Tze Yao.
1991-01-01
Numerical simulations and laboratory experiments are used to elucidate aspects of transient natural convection in a magma chamber. The magma chamber is modeled as a horizontal fluid layer confined within an enclosure of square planform and heated from below by a strip heater centered on the lower boundary of the enclosure. The width of the strip heater and the depth of the fluid layer are one-fourth of the layer width. Corn syrup is used as the working fluid in order to approximate the large viscosity variation with temperature and the large Prandtl number typical of magma. The quiescent, uniform, fluid layer is subjected to instantaneous heating from the strip heater producing a transient flow which is dominated by two counter-rotating convective cells. Experimentally determined characteristics of the developing flow are compared with numerical simulations carried out with a finite element computer program. The results of numerical simulations are in essential agreement with experimental data. Differences between the numerical simulations and experimental measurements are conjectured to result from non-ideal effects present in the experiment which are difficult to represent accurately in a numerical simulation.
Earthquakes drive large-scale submarine canyon development and sediment supply to deep-ocean basins.
Mountjoy, Joshu J; Howarth, Jamie D; Orpin, Alan R; Barnes, Philip M; Bowden, David A; Rowden, Ashley A; Schimel, Alexandre C G; Holden, Caroline; Horgan, Huw J; Nodder, Scott D; Patton, Jason R; Lamarche, Geoffroy; Gerstenberger, Matthew; Micallef, Aaron; Pallentin, Arne; Kane, Tim
2018-03-01
Although the global flux of sediment and carbon from land to the coastal ocean is well known, the volume of material that reaches the deep ocean-the ultimate sink-and the mechanisms by which it is transferred are poorly documented. Using a globally unique data set of repeat seafloor measurements and samples, we show that the moment magnitude ( M w ) 7.8 November 2016 Kaikōura earthquake (New Zealand) triggered widespread landslides in a submarine canyon, causing a powerful "canyon flushing" event and turbidity current that traveled >680 km along one of the world's longest deep-sea channels. These observations provide the first quantification of seafloor landscape change and large-scale sediment transport associated with an earthquake-triggered full canyon flushing event. The calculated interevent time of ~140 years indicates a canyon incision rate of 40 mm year -1 , substantially higher than that of most terrestrial rivers, while synchronously transferring large volumes of sediment [850 metric megatons (Mt)] and organic carbon (7 Mt) to the deep ocean. These observations demonstrate that earthquake-triggered canyon flushing is a primary driver of submarine canyon development and material transfer from active continental margins to the deep ocean.
Piper, Benjamin; Oyanga, Arbogast; Mejia, Jessica; Pouezevara, Sarah
2017-01-01
Previous large-scale education technology interventions have shown only modest impacts on student achievement. Building on results from an earlier randomized controlled trial of three different applications of information and communication technologies (ICTs) on primary education in Kenya, the Tusome Early Grade Reading Activity developed the…
International Nuclear Information System (INIS)
Murdock, S.H.; Leistritz, F.L.; Hamm, R.R.
1983-01-01
High-level nuclear waste repositories will likely be located in sparsely settled rural areas in the US. These projects will significantly affect the economic, demographic, public service, fiscal, and social (the socioeconomic) dimensions of those rural areas. The impacts and means of mitigating them thus require careful analysis. This paper examines some of the potential socioeconomic impacts likely to occur in rural areas as a result of repository siting and development, and it describes some of the characteristics of mitigation programs that are likely to be necessary, if the impacts are to be addressed. Both (1) standard impacts, those resulting from the fact that, like many other large-scale developments, repositories will involve a substantial number of new workers and residents (relative to the size of existing communities), and (2) special impacts, those resulting from the fact that repositories store radioactive materials, are examined. The discussion indicates that economic, demographic, public service, fiscal, and social impacts (standard and special) of these repositories will be substantial and problematic in many cases. Unless the impacts are effectively addressed with carefully planned and well financed mitigation efforts that insure that high-quality planning information is provided to local residents, and that local residents are involved in impact planning and management throughout the siting and development process, repository siting is unlikely to be effectively and equitably achieved. 44 references
Lei, Ying; Li, Shi Feng; Yu, Yi Ling; Tan, Jun; Gold, Michael H
2017-06-01
Hypertrophic scarring is seen regularly. Tissue penetration of laser energy into hypertrophic scars using computer defaults from some lasers may be insufficient and penetration not enough. We have developed a treatment with an interrupted laser "drilling" by the Ultrapulse CO 2 (Manual Fractional Technology, MFT) and, a second pass, with fractional CO 2 . The MFT with fractional CO 2 lasers to treat hypertrophic scars is evaluated. A total of 158 patients with hypertrophic scars had three sessions of MFT with fractional CO 2 laser at 3-month intervals. Evaluations made before and 6 months after the 3rd treatment: (1) the Vancouver Scar Scale (VSS), (2) the University of North Carolina (UNC) Scar Scale, and (3) a survey of patient satisfaction. All data were analyzed using a t-test before and after treatment. The VSS score decreased from 9.35 to 3.12 (Plaser drilling by MFT and a fractional CO2 laser had profound effects on the hypertrophic scars treated. It works by increasing the penetration depth of the CO 2 laser in the scar tissue, exerting more precise effects on the hypertrophic scars. MFT combined with fractional CO 2 laser has the potential to be a major advance in the treatment of hypertrophic scars. © 2017 Wiley Periodicals, Inc.
Wu, Chih-Chun; Guo, Wan-Yuo; Chung, Wen-Yuh; Wu, Hisu-Mei; Lin, Chung-Jung; Lee, Cheng-Chia; Liu, Kang-Du; Yang, Huai-Che
2017-12-01
OBJECTIVE Gamma Knife surgery (GKS) is a promising treatment modality for patients with vestibular schwannomas (VSs), but a small percentage of patients have persistent postradiosurgical tumor growth. The aim of this study was to determine the clinical and quantitative MRI features of VS as predictors of long-term tumor control after GKS. METHODS The authors performed a retrospective study of all patients with VS treated with GKS using the Leksell Gamma Knife Unit between 2005 and 2013 at their institution. A total of 187 patients who had a minimum of 24 months of clinical and radiological assessment after radiosurgery were included in this study. Those who underwent a craniotomy with tumor removal before and after GKS were excluded. Study patients comprised 85 (45.5%) males and 102 (54.5%) females, with a median age of 52.2 years (range 20.4-82.3 years). Tumor volumes, enhancing patterns, and apparent diffusion coefficient (ADC) values were measured by region of interest (ROI) analysis of the whole tumor by serial MRI before and after GKS. RESULTS The median follow-up period was 60.8 months (range 24-128.9 months), and the median treated tumor volume was 3.54 cm 3 (0.1-16.2 cm 3 ). At last follow-up, imaging studies indicated that 150 tumors (80.2%) showed decreased tumor volume, 20 (10.7%) had stabilized, and 17 (9.1%) continued to grow following radiosurgery. The postradiosurgical outcome was not significantly correlated with pretreatment volumes or postradiosurgical enhancing patterns. Tumors that showed regression within the initial 12 months following radiosurgery were more likely to have a larger volume reduction ratio at last follow-up than those that did not (volume reduction ratio 55% vs 23.6%, respectively; p < 0.001). Compared with solid VSs, cystic VSs were more likely to regress or stabilize in the initial postradiosurgical 6-12-month period and during extended follow-up. Cystic VSs exhibited a greater volume reduction ratio at last follow-up (cystic
Peng, Zhang; Liangfa, Xie; Ming, Wei; Jianli, Li
In the shipbuilding industry, the welding efficiency of the ship plate not only has a great effect on the construction cost of the ship, but also affects the construction speed and determines the delivery cycle. The steel plate used for large heat input welding was developed sufficiently. In this paper, the composition of the steel with a small amount of Nb, Ti and large amount of Mn had been designed in micro-alloyed route. The content of C and the carbon equivalent were also designed to a low level. The technology of oxide metallurgy was used during the smelting process of the steel. The rolling technology of TMCP was controlled at a low rolling temperature and ultra-fast cooling technology was used, for the purpose of controlling the transformation of the microstructure. The microstructure of the steel plate was controlled to be the mixed microstructure of low carbon bainite and ferrite. Large amount of oxide particles dispersed in the microstructure of steel, which had a positive effects on the mechanical property and welding performance of the steel. The mechanical property of the steel plate was excellent and the value of longitudinal Akv at -60 °C is more than 200 J. The toughness of WM and HAZ were excellent after the steel plate was welded with a large heat input of 100-250 kJ/cm. The steel plate processed by mentioned above can meet the requirement of large heat input welding.
Energy Technology Data Exchange (ETDEWEB)
Sadeghian, Hamed, E-mail: hamed.sadeghianmarnani@tno.nl, E-mail: h.sadeghianmarnani@tudelft.nl [Department of Optomechatronics, Netherlands Organization for Scientific Applied Research, TNO, Stieltjesweg 1, 2628 CK Delft (Netherlands); Department of Precision and Microsystems Engineering, Delft University of Technology, Mekelweg 2, 2628 CD Delft (Netherlands); Herfst, Rodolf; Winters, Jasper; Crowcombe, Will; Kramer, Geerten; Dool, Teun van den; Es, Maarten H. van [Department of Optomechatronics, Netherlands Organization for Scientific Applied Research, TNO, Stieltjesweg 1, 2628 CK Delft (Netherlands)
2015-11-15
We have developed a high speed, miniature scanning probe microscope (MSPM) integrated with a Positioning Unit (PU) for accurately positioning the MSPM on a large substrate. This combination enables simultaneous, parallel operation of many units on a large sample for high throughput measurements. The size of the MSPM is 19 × 45 × 70 mm{sup 3}. It contains a one-dimensional flexure stage with counter-balanced actuation for vertical scanning with a bandwidth of 50 kHz and a z-travel range of more than 2 μm. This stage is mechanically decoupled from the rest of the MSPM by suspending it on specific dynamically determined points. The motion of the probe, which is mounted on top of the flexure stage is measured by a very compact optical beam deflection (OBD). Thermal noise spectrum measurements of short cantilevers show a bandwidth of 2 MHz and a noise of less than 15 fm/Hz{sup 1/2}. A fast approach and engagement of the probe to the substrate surface have been achieved by integrating a small stepper actuator and direct monitoring of the cantilever response to the approaching surface. The PU has the same width as the MSPM, 45 mm and can position the MSPM to a pre-chosen position within an area of 275×30 mm{sup 2} to within 100 nm accuracy within a few seconds. During scanning, the MSPM is detached from the PU which is essential to eliminate mechanical vibration and drift from the relatively low-resonance frequency and low-stiffness structure of the PU. Although the specific implementation of the MSPM we describe here has been developed as an atomic force microscope, the general architecture is applicable to any form of SPM. This high speed MSPM is now being used in a parallel SPM architecture for inspection and metrology of large samples such as semiconductor wafers and masks.
Development of Large-Scale Spacecraft Fire Safety Experiments
DEFF Research Database (Denmark)
Ruff, Gary A.; Urban, David L.; Fernandez-Pello, A. Carlos
2013-01-01
exploration missions outside of low-earth orbit and accordingly, more complex in terms of operations, logistics, and safety. This will increase the challenge of ensuring a fire-safe environment for the crew throughout the mission. Based on our fundamental uncertainty of the behavior of fires in low...... of the spacecraft fire safety risk. The activity of this project is supported by an international topical team of fire experts from other space agencies who conduct research that is integrated into the overall experiment design. The large-scale space flight experiment will be conducted in an Orbital Sciences...
Valuing trade-offs of river ecosystem services in large hydropower development in Tibet, China
Yu, B.; Xu, L.
2015-12-01
Hydropower development can be considered as a kind of trade-offs of ecosystem services generated by human activity for their economic and energy demand, because it can increase some river ecosystem services but decrease others. In this context, an ecosystem service trade-off framework in hydropower development was proposed in this paper. It aims to identify the ecological cost of river ecosystem and serve for the ecological compensation during hydropower development, for the hydropower services cannot completely replace the regulating services of river ecosystem. The valuing trade-offs framework was integrated by the influenced ecosystem services identification and ecosystem services valuation, through ecological monitoring and ecological economic methods, respectively. With a case study of Pondo hydropower project in Tibet, China, the valuing trade-offs of river ecosystem services in large hydropower development was illustrated. The typical ecological factors including water, sediment and soil were analyzed in this study to identify the altered river ecosystem services by Pondo hydropower project. Through the field monitoring and valuation, the results showed that the Lhasa River ecosystem services value could be changed annually by Pondo hydropower project with the increment of 5.7E+8CNY, and decrement of 5.1E+7CNY. The ecological compensation for river ecosystem should be focus on water and soil conservation, reservoir dredging and tributaries habitat protection.
Seman, Ali; Sapawi, Azizian Mohd; Salleh, Mohd Zaki
2015-06-01
Y-chromosome short tandem repeats (Y-STRs) are genetic markers with practical applications in human identification. However, where mass identification is required (e.g., in the aftermath of disasters with significant fatalities), the efficiency of the process could be improved with new statistical approaches. Clustering applications are relatively new tools for large-scale comparative genotyping, and the k-Approximate Modal Haplotype (k-AMH), an efficient algorithm for clustering large-scale Y-STR data, represents a promising method for developing these tools. In this study we improved the k-AMH and produced three new algorithms: the Nk-AMH I (including a new initial cluster center selection), the Nk-AMH II (including a new dominant weighting value), and the Nk-AMH III (combining I and II). The Nk-AMH III was the superior algorithm, with mean clustering accuracy that increased in four out of six datasets and remained at 100% in the other two. Additionally, the Nk-AMH III achieved a 2% higher overall mean clustering accuracy score than the k-AMH, as well as optimal accuracy for all datasets (0.84-1.00). With inclusion of the two new methods, the Nk-AMH III produced an optimal solution for clustering Y-STR data; thus, the algorithm has potential for further development towards fully automatic clustering of any large-scale genotypic data.
Development and application of a computer model for large-scale flame acceleration experiments
International Nuclear Information System (INIS)
Marx, K.D.
1987-07-01
A new computational model for large-scale premixed flames is developed and applied to the simulation of flame acceleration experiments. The primary objective is to circumvent the necessity for resolving turbulent flame fronts; this is imperative because of the relatively coarse computational grids which must be used in engineering calculations. The essence of the model is to artificially thicken the flame by increasing the appropriate diffusivities and decreasing the combustion rate, but to do this in such a way that the burn velocity varies with pressure, temperature, and turbulence intensity according to prespecified phenomenological characteristics. The model is particularly aimed at implementation in computer codes which simulate compressible flows. To this end, it is applied to the two-dimensional simulation of hydrogen-air flame acceleration experiments in which the flame speeds and gas flow velocities attain or exceed the speed of sound in the gas. It is shown that many of the features of the flame trajectories and pressure histories in the experiments are simulated quite well by the model. Using the comparison of experimental and computational results as a guide, some insight is developed into the processes which occur in such experiments. 34 refs., 25 figs., 4 tabs
Bamford, Simeon A; Murray, Alan F; Willshaw, David J
2010-02-01
A distributed and locally reprogrammable address-event receiver has been designed, in which incoming address-events are monitored simultaneously by all synapses, allowing for arbitrarily large axonal fan-out without reducing channel capacity. Synapses can change the address of their presynaptic neuron, allowing the distributed implementation of a biologically realistic learning rule, with both synapse formation and elimination (synaptic rewiring). Probabilistic synapse formation leads to topographic map development, made possible by a cross-chip current-mode calculation of Euclidean distance. As well as synaptic plasticity in rewiring, synapses change weights using a competitive Hebbian learning rule (spike-timing-dependent plasticity). The weight plasticity allows receptive fields to be modified based on spatio-temporal correlations in the inputs, and the rewiring plasticity allows these modifications to become embedded in the network topology.
Energy Technology Data Exchange (ETDEWEB)
Van Handenhove, Carl; Breban, Domnica; Creusot, Christophe [International Atomic Energy Agency, Vienna (Austria); Dransart, Pascal; Dechamp, Luc [Joint Research Centre, European Commission, Ispra, Varese, (Italy); Jarde, Eric [Euriware, Equeurdreville (France)
2011-12-15
The implementation of an effective and efficient IAEA safeguards approach at large scale reprocessing facilities with large throughput and continuous flow of nuclear material requires the introduction of enhanced safeguards measures to provide added assurance about the absence of diversion of nuclear material and confirmation that the facility is operated as declared. One of the enhanced safeguards measures, a Solution Monitoring and Measurement System (SMMS), comprising data collection instruments, data transmission equipment and an advanced Solution Monitoring Software (SMS), is being implemented at a large scale reprocessing plant in Japan. SMS is designed as a tool to enable automatic calculations of volumes, densities and flow-rates in selected process vessels, including most of the vessels of the main nuclear material stream. This software also includes automatic features to support the inspectorate in verifying inventories and inventory changes. The software also enables one to analyze the flows of nuclear material within the process and of specified 'cycles' of operation, and, in order to provide assurance that the facility is being operated as declared to compare these with those expected (reference signatures). The configuration and parameterization work (especially the analytical and comparative work) for the implementation and configuration of the SMS has been carried out jointly between the IAEA, Euriware-France (the software developer) and the Joint Research Centre (JRC)-Ispra. This paper describes the main features of the SMS, including the principles underlying the automatic analysis functionalities. It then focuses on the collaborative work performed by the JRC-Ispra, Euriware and the IAEA for the parameterization of the software (vessels and cycles of operation), including the current status and the future challenges.
Investing in a Large Stretch Press
Choate, M.; Nealson, W.; Jay, G.; Buss, W.
1986-01-01
Press for forming large aluminum parts from plates provides substantial economies. Study assessed advantages and disadvantages of investing in large stretch-forming press, and also developed procurement specification for press.
The large-s field-reversed configuration experiment
International Nuclear Information System (INIS)
Hoffman, A.L.; Carey, L.N.; Crawford, E.A.; Harding, D.G.; DeHart, T.E.; McDonald, K.F.; McNeil, J.L.; Milroy, R.D.; Slough, J.T.; Maqueda, R.; Wurden, G.A.
1993-01-01
The Large-s Experiment (LSX) was built to study the formation and equilibrium properties of field-reversed configurations (FRCs) as the scale size increases. The dynamic, field-reversed theta-pinch method of FRC creation produces axial and azimuthal deformations and makes formation difficult, especially in large devices with large s (number of internal gyroradii) where it is difficult to achieve initial plasma uniformity. However, with the proper technique, these formation distortions can be minimized and are then observed to decay with time. This suggests that the basic stability and robustness of FRCs formed, and in some cases translated, in smaller devices may also characterize larger FRCs. Elaborate formation controls were included on LSX to provide the initial uniformity and symmetry necessary to minimize formation disturbances, and stable FRCs could be formed up to the design goal of s = 8. For x ≤ 4, the formation distortions decayed away completely, resulting in symmetric equilibrium FRCs with record confinement times up to 0.5 ms, agreeing with previous empirical scaling laws (τ∝sR). Above s = 4, reasonably long-lived (up to 0.3 ms) configurations could still be formed, but the initial formation distortions were so large that they never completely decayed away, and the equilibrium confinement was degraded from the empirical expectations. The LSX was only operational for 1 yr, and it is not known whether s = 4 represents a fundamental limit for good confinement in simple (no ion beam stabilization) FRCs or whether it simply reflects a limit of present formation technology. Ideally, s could be increased through flux buildup from neutral beams. Since the addition of kinetic or beam ions will probably be desirable for heating, sustainment, and further stabilization of magnetohydrodynamic modes at reactor-level s values, neutral beam injection is the next logical step in FRC development. 24 refs., 21 figs., 2 tabs
Assessment of the water quality in a large reservoir in semiarid region of Brazil
Directory of Open Access Journals (Sweden)
Fernando B. Lopes
2014-04-01
Full Text Available The aim of this study was to identify spatial and temporal variations in water quality of Orós reservoir, Ceará, Brazil, as well as the sources of contamination. To get this information the Principal Component Analysis (PCA and Cluster Analysis (CA was used. Water samples were collected at seven (geo-referenced points, from April 2008 to March 2011, totalling 4,032 samples. The following attributes of the waters were analysed: temperature, pH, CE, Ca2+, Mg2+, Na+, K+, Cl-, HCO3-, SO4--, turbidity, colour, Sechi transparency, TS, TVS, TFS, TSS, VSS, FSS, TDS, DO, BO5D, total phosphorus, soluble orthophosphate, EC, TTC, total ammonia, TKN, nitrate, SAR and chlorophyll-a. The PCA promoted the reduction from the 32 initial variables to 14, accounting for 84.39% of the total variance. The major factors responsible for water quality composition are: the natural weathering of geological soil components; the entrainment of suspended solids through surface runoff from agricultural areas; and anthropogenic action in the Upper Jaguaribe basin in Ceará. The similarity of the water of the Orós reservoir allows a reduction in the number of sampling points, which may result in significant cost savings without sacrificing the water quality monitoring. The similarity of the waters was influenced by anthropic activities being carried out near the reservoir and all along the watershed.
Mengshoel, Ole Jakob; Poll, Scott; Kurtoglu, Tolga
2009-01-01
In this paper, we investigate the use of Bayesian networks to construct large-scale diagnostic systems. In particular, we consider the development of large-scale Bayesian networks by composition. This compositional approach reflects how (often redundant) subsystems are architected to form systems such as electrical power systems. We develop high-level specifications, Bayesian networks, clique trees, and arithmetic circuits representing 24 different electrical power systems. The largest among these 24 Bayesian networks contains over 1,000 random variables. Another BN represents the real-world electrical power system ADAPT, which is representative of electrical power systems deployed in aerospace vehicles. In addition to demonstrating the scalability of the compositional approach, we briefly report on experimental results from the diagnostic competition DXC, where the ProADAPT team, using techniques discussed here, obtained the highest scores in both Tier 1 (among 9 international competitors) and Tier 2 (among 6 international competitors) of the industrial track. While we consider diagnosis of power systems specifically, we believe this work is relevant to other system health management problems, in particular in dependable systems such as aircraft and spacecraft. (See CASI ID 20100021910 for supplemental data disk.)
Autonomous Behavioral Health Countermeasures for Spaceflight
National Aeronautics and Space Administration — In this reporting year we have deployed the VSS to three space analog environments: The HI-SEAS Mars Analog for both the 8-month and 12-month missions, the Canada...
National Research Council Canada - National Science Library
Anderson, John
1998-01-01
...) and AFIT MXTOOLS toolboxes were used to produce the optimal, multiobjective designs. These designs were implemented for flight test on the Calspan VSS I Learjet, simulating the unstable longitudinal dynamics of an F-16 type aircraft...
Development of a large area thermal neutron detector based on a scintillator
International Nuclear Information System (INIS)
Engels, Ralf
2012-01-01
In the present work, the development and construction of a detector prototype based on wavelength shifting fiber in combination with a scintillator has been investigated and optimized. This development aims at an alternative for large area neutron detectors based on "3He detectors, which was the main construction in the past. After the study of the components and assemblies, such as: the scintillator, the wavelength-shifting-fibers and available photomultiplier tubes, the construction of the first prototype module begun. The neutron converter was selected as a "6LiF/ZnS scintillator, which produces a big light yield per absorbed neutron. The prototype itself is square and has an edge length of 30 cm in combination with two orthogonal layers of crossed wavelength-shifting-fibers. The top fiber layer, which is closer to the "6LiF/ZnS top scintillator produces the x-coordinates and the lower layer produces the y-coordinates for each event. In the prototype, MSJ-fibers from the company Kuraray were used with 1 mm diameter and spacing in the top layer of 1.5 mm and 1 mm in the lower layer. Due to the orthogonal arrangement of the wires in the two layers, one may identify where the neutron was absorbed in the scintillator and produced the light yield. In order to reduce the light loss of the absorbed photons inside the fibers, a bending radius of greater than 20 mm was used and achieved by warming up the fibers to 80 C during the bending process. The increased temperature reduces the crack formation in the fibers which increases the light loss. At this time it is expected that a photomultiplier from Hamamatsu with 256 individual pixels for readout will be used. This H9500 flat panel photomultiplier has the advantage of readout of all fibers of the prototype in one photomultiplier housing. In combination with integrated readout electronics one can minimize the homogeneity/gain differences of the photocathode pixels, the different light loss in each fiber, and the gain
Directory of Open Access Journals (Sweden)
Shaukat Ali
Full Text Available BACKGROUND: In humans, ethanol exposure during pregnancy causes a spectrum of developmental defects (fetal alcohol syndrome or FAS. Individuals vary in phenotypic expression. Zebrafish embryos develop FAS-like features after ethanol exposure. In this study, we ask whether stage-specific effects of ethanol can be identified in the zebrafish, and if so, whether they allow the pinpointing of sensitive developmental mechanisms. We have therefore conducted the first large-scale (>1500 embryos analysis of acute, stage-specific drug effects on zebrafish development, with a large panel of readouts. METHODOLOGY/PRINCIPAL FINDINGS: Zebrafish embryos were raised in 96-well plates. Range-finding indicated that 10% ethanol for 1 h was suitable for an acute exposure regime. High-resolution magic-angle spinning proton magnetic resonance spectroscopy showed that this produced a transient pulse of 0.86% concentration of ethanol in the embryo within the chorion. Survivors at 5 days postfertilisation were analysed. Phenotypes ranged from normal (resilient to severely malformed. Ethanol exposure at early stages caused high mortality (≥88%. At later stages of exposure, mortality declined and malformations developed. Pharyngeal arch hypoplasia and behavioral impairment were most common after prim-6 and prim-16 exposure. By contrast, microphthalmia and growth retardation were stage-independent. CONCLUSIONS: Our findings show that some ethanol effects are strongly stage-dependent. The phenotypes mimic key aspects of FAS including craniofacial abnormality, microphthalmia, growth retardation and behavioral impairment. We also identify a critical time window (prim-6 and prim-16 for ethanol sensitivity. Finally, our identification of a wide phenotypic spectrum is reminiscent of human FAS, and may provide a useful model for studying disease resilience.
Automating large-scale reactor systems
International Nuclear Information System (INIS)
Kisner, R.A.
1985-01-01
This paper conveys a philosophy for developing automated large-scale control systems that behave in an integrated, intelligent, flexible manner. Methods for operating large-scale systems under varying degrees of equipment degradation are discussed, and a design approach that separates the effort into phases is suggested. 5 refs., 1 fig
Cosmology Large Angular Scale Surveyor (CLASS) Focal Plane Development
Chuss, D. T.; Ali, A.; Amiri, M.; Appel, J.; Bennett, C. L.; Colazo, F.; Denis, K. L.; Dunner, R.; Essinger-Hileman, T.; Eimer, J.;
2015-01-01
The Cosmology Large Angular Scale Surveyor (CLASS) will measure the polarization of the Cosmic Microwave Background to search for and characterize the polarized signature of inflation. CLASS will operate from the Atacama Desert and observe approx.70% of the sky. A variable-delay polarization modulator provides modulation of the polarization at approx.10Hz to suppress the 1/f noise of the atmosphere and enable the measurement of the large angular scale polarization modes. The measurement of the inflationary signal across angular scales that spans both the recombination and reionization features allows a test of the predicted shape of the polarized angular power spectra in addition to a measurement of the energy scale of inflation. CLASS is an array of telescopes covering frequencies of 38, 93, 148, and 217 GHz. These frequencies straddle the foreground minimum and thus allow the extraction of foregrounds from the primordial signal. Each focal plane contains feedhorn-coupled transition-edge sensors that simultaneously detect two orthogonal linear polarizations. The use of single-crystal silicon as the dielectric for the on-chip transmission lines enables both high efficiency and uniformity in fabrication. Integrated band definition has been implemented that both controls the bandpass of the single-mode transmission on the chip and prevents stray light from coupling to the detectors.
International Nuclear Information System (INIS)
Leistritz, F.L.; Murdock, S.H.; Texas A and M Univ., College Station)
1982-01-01
This paper deals with the local economic and fiscal implications of siting high-level nuclear waste repositories in rural areas. The economic and fiscal effects of repository development fall into two categories: (1) standard impacts similar to those that would be associated with developing any large-scale industrial facility in an isolated area; (2) special impacts that result from the hazardous nature of the nuclear materials stored and from federal ownership of the facility. Standard economic and fiscal impacts include employment effects (direct and secondary), local income changes, alterations in community price structures, effects on community services, and changes in revenues and costs for local jurisdictions. Special impacts include the possibility of diminished activity in other basic economic sectors, negative effects on the area's long-term growth prospects and a consequent dampening of investment in the local trade an service sectors, additional costs for local jurisdictions (e.g., for preparing evacuation plans), and limited local tax revenues resulting from the tax-exempt status of the facility. These special effects are difficult to quantify and require additional analysis. 47 references, 1 figure, 4 tables
Development of a Sealing-Bolt for the safeguarding of large containers such as multielement bottles
International Nuclear Information System (INIS)
D'Agraives, B.C.; Toornvliet
1985-01-01
A preliminary study on the development of a ''Sealing-Bolt'' is currently being carried out at JRC-Ispra. It is required for the safeguarding of large containers. A ''Sealing-Bolt'' would replace one - or more - of the conventional bolts, normally used for tightening a container's cover. It could not be removed - or unscrewed - without the knowledge of Inspectors. Thus, it has to meet the requirements of an Underwater Verifiable Seal and of a Threaded Stud-Bolt. It is proposed to derive the sealing feature from the VAK III seal, a LWR Fuel Assembly Ultrasonic Seal which has been developed by JRC-Ispra and is field tested at the Kahl Reactor Facility (FRG) since October 1983, while under evaluation for use by IAEA. The mechanical part asks for a specific study of a reliable system able to evidence that the bolt has been unscrewed during an opening of the lid
International Nuclear Information System (INIS)
Campos, Leonardo C.; Tonezzer, Matteo; Ferlauto, Andre S.; Magalhaes-Paniago, Rogerio; Oliveira, Sergio; Ladeira, Luiz O.; Lacerda, Rodrigo G.
2008-01-01
Nowadays, the growth of nano materials, like nano wires and nano tubes, is one of the key research areas of nano technology. However, a full picture of the growth mechanism of these quasi-one dimensional systems still needs to be achieved if these materials are to be applied electronics, biology and medicinal fields. Nevertheless, in spite of considerable advances on the growth of numerous nano wires, a clear understanding of the growth mechanism is still controversial and highly discussed. The present work provides a comprehensive picture of the precise mechanism of Zn O vapor-solid-solid (VSS) nano wire growth at low temperatures and gives the fundamental reasons responsible. We demonstrate by using a combination of synchrotron XRD and high resolution TEM that the growth dynamics at low temperatures is not governed by the well-known vapor-liquid solid (VLS) mechanisms. A critical new insight on the driving factor of VSS growth is proposed in which the VSS process occurs by a solid diffusion mechanism that is driven by a preferential oxidation process of the Zn inside the alloy catalyst induced by an epitaxial match between the Zn O(10-10) plane and the γ-Au Zn(222) plane. We believe that these results are not only important for the understanding of Zn O nano wire growth but could also have significant impact on the understanding of growth mechanisms of other nano wire systems. (author)
Tank 241-C-101 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank C-101 headspace gas and vapor samples were collected and analyzed to help determine the potential risks of fugitive emissions to tank farm workers. Gas and vapor samples from the Tank C-101 headspace were collected on July 7, 1994 using the in situ sampling (ISS) method, and again on September 1, 1994 using the more robust vapor sampling system (VSS). Gas and vapor concentrations in Tank C-101 are influenced by its connections to other tanks and its ventilation pathways. At issue is whether the organic vapors in Tank C-101 are from the waste in that tank, or from Tanks C-102 or C-103. Tank C-103 is on the Organic Watch List; the other two are not. Air from the Tank C-101 headspace was withdrawn via a 7.9-m long heated sampling probe mounted in riser 8, and transferred via heated tubing to the VSS sampling manifold. The tank headspace temperature was determined to be 34.0 C, and all heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, Pacific Northwest Laboratories, and Oregon Graduate Institute of Science and Technology through a contract with Sandia National Laboratories. The 39 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks provided by the laboratories
Gianibelli, J. C.; Quaglino, N. M.
2007-05-01
The South Atlantic Magnetic Anomaly (SAMA) Region presents evolutive characteristics very important as were observed by a variety of satelital sensors. Important Magnetic Observatories with digital record monitor the effects of the Sun-Earth interaction, such as San Juan de Puerto Rico (SJG), Kourou (KOU), Vassouras (VSS), Las Acacias (LAS), Trelew (TRW), Vernadsky (AIA), Hermanus (HER) and Huancayo (HUA). In the present work we present the features registered during the geomagnetic storm in January 21, 2005, produced by a geoeffective Coronal Mass Ejection (CME) whose Interplanetary Coronal Mass Ejection (ICME) was detected by the instrumental onboard the Advanced Composition Explorer (ACE) Sonde. We analize how the Magnetic Total Intensity records at VSS, TRW and LAS Observatories shows the effect of the entering particles to ionospherical dephts producing a field enhancement following the first Interplanetary Shock (IP) arrival of the ICME. This process manifest in the digital record as an increment over the magnetospheric Ring Current field effect and superinpossed effects over the Antarctic Auroral Electrojet. The analysis and comparison of the records demonstrate that the Ring Current effects are important in SJG and KOU but not in VSS, LAS and TRW observatories, concluding that SAMA region shows a enhancement of the ionospherical currents oposed to those generated at magnetospheric heighs. Moreover in TRW, 5 hours after the ICME shock arrival, shows the effect of the Antarctic Auroral Electrojet counteracting to fields generated by the Ring Current.
Energy Technology Data Exchange (ETDEWEB)
Menapace, J A
2010-10-27
Over the last eight years we have been developing advanced MRF tools and techniques to manufacture meter-scale optics for use in Megajoule class laser systems. These systems call for optics having unique characteristics that can complicate their fabrication using conventional polishing methods. First, exposure to the high-power nanosecond and sub-nanosecond pulsed laser environment in the infrared (>27 J/cm{sup 2} at 1053 nm), visible (>18 J/cm{sup 2} at 527 nm), and ultraviolet (>10 J/cm{sup 2} at 351 nm) demands ultra-precise control of optical figure and finish to avoid intensity modulation and scatter that can result in damage to the optics chain or system hardware. Second, the optics must be super-polished and virtually free of surface and subsurface flaws that can limit optic lifetime through laser-induced damage initiation and growth at the flaw sites, particularly at 351 nm. Lastly, ultra-precise optics for beam conditioning are required to control laser beam quality. These optics contain customized surface topographical structures that cannot be made using traditional fabrication processes. In this review, we will present the development and implementation of large-aperture MRF tools and techniques specifically designed to meet the demanding optical performance challenges required in large-aperture high-power laser systems. In particular, we will discuss the advances made by using MRF technology to expose and remove surface and subsurface flaws in optics during final polishing to yield optics with improve laser damage resistance, the novel application of MRF deterministic polishing to imprint complex topographical information and wavefront correction patterns onto optical surfaces, and our efforts to advance the technology to manufacture large-aperture damage resistant optics.
Song, Ah Young; Choi, Ha Young; Lee, Eun Song; Han, Jaejoon; Min, Sea C
2018-04-01
Films containing microencapsulated cinnamon oil (CO) were developed using a large-scale production system to protect against the Indian meal moth (Plodia interpunctella). CO at concentrations of 0%, 0.8%, or 1.7% (w/w ink mixture) was microencapsulated with polyvinyl alcohol. The microencapsulated CO emulsion was mixed with ink (47% or 59%, w/w) and thinner (20% or 25%, w/w) and coated on polypropylene (PP) films. The PP film was then laminated with a low-density polyethylene (LDPE) film on the coated side. The film with microencapsulated CO at 1.7% repelled P. interpunctella most effectively. Microencapsulation did not negatively affect insect repelling activity. The release rate of cinnamaldehyde, an active repellent, was lower when CO was microencapsulated than that in the absence of microencapsulation. Thermogravimetric analysis exhibited that microencapsulation prevented the volatilization of CO. The tensile strength, percentage elongation at break, elastic modulus, and water vapor permeability of the films indicated that microencapsulation did not affect the tensile and moisture barrier properties (P > 0.05). The results of this study suggest that effective films for the prevention of Indian meal moth invasion can be produced by the microencapsulation of CO using a large-scale film production system. Low-density polyethylene-laminated polypropylene films printed with ink incorporating microencapsulated cinnamon oil using a large-scale film production system effectively repelled Indian meal moth larvae. Without altering the tensile and moisture barrier properties of the film, microencapsulation resulted in the release of an active repellent for extended periods with a high thermal stability of cinnamon oil, enabling commercial film production at high temperatures. This anti-insect film system may have applications to other food-packaging films that use the same ink-printing platform. © 2018 Institute of Food Technologists®.
Development of Best Practices for Large-scale Data Management Infrastructure
S. Stadtmüller; H.F. Mühleisen (Hannes); C. Bizer; M.L. Kersten (Martin); J.A. de Rijke (Arjen); F.E. Groffen (Fabian); Y. Zhang (Ying); G. Ladwig; A. Harth; M Trampus
2012-01-01
htmlabstractThe amount of available data for processing is constantly increasing and becomes more diverse. We collect our experiences on deploying large-scale data management tools on local-area clusters or cloud infrastructures and provide guidance to use these computing and storage
Preamplifier development for high count-rate, large dynamic range readout of inorganic scintillators
Energy Technology Data Exchange (ETDEWEB)
Keshelashvili, Irakli; Erni, Werner; Steinacher, Michael; Krusche, Bernd; Collaboration: PANDA-Collaboration
2013-07-01
Electromagnetic calorimeter are central component of many experiments in nuclear and particle physics. Modern ''trigger less'' detectors run with very high count-rates, require good time and energy resolution, and large dynamic range. In addition photosensors and preamplifiers must work in hostile environments (magnetic fields). Due to later constraints mainly Avalanche Photo Diodes (APD's), Vacuum Photo Triodes (VPT's), and Vacuum Photo Tetrodes (VPTT's) are used. A disadvantage is their low gain which together with other requirements is a challenge for the preamplifier design. Our group has developed special Low Noise / Low Power (LNP) preamplifier for this purpose. They will be used to equip PANDA EMC forward end-cap (dynamic range 15'000, rate 1MHz), where the PWO II crystals and preamplifier have to run in an environment cooled down to -25{sup o}C. Further application is the upgrade of the Crystal Barrel detector at the Bonn ELSA accelerator with APD readout for which special temperature comparison of the APD gain and good time resolution is necessary. Development and all test procedures after the mass production done by our group during past several years in Basel University will be reported.
International Nuclear Information System (INIS)
Keck, O.
1981-01-01
Proceeding from Anglo-Saxon opinions which, from a liberal point of view, criticize the German practice of research policy - state centres of large-scale research and state subventions for research and development in industry - to be inefficient, the author empirically verified these statements taking the German fast breeder project as an example. If the case of the German fast breeder can be generalized, this had consequences for the research political practice and for other technologies. Supporters as well as opponents of large-scale technology today proceed from the assumption that almost every technology can be made commercially viable when using sufficient amounts of money and persons. This is a migth which owes its existence to the technical success of great projects in non-commercial fields. The German fast breeder project confirms the opinion that the recipes for success of these non-commercial projects cannot be applied to the field of commercial technology. The results of this study suggest that practice and theory of technology policy can be misdirected if they are uncritically oriented according to the form of state intervention so far used in large-scale technology. (orig./HSCH) [de
Large deviations and idempotent probability
Puhalskii, Anatolii
2001-01-01
In the view of many probabilists, author Anatolii Puhalskii''s research results stand among the most significant achievements in the modern theory of large deviations. In fact, his work marked a turning point in the depth of our understanding of the connections between the large deviation principle (LDP) and well-known methods for establishing weak convergence results.Large Deviations and Idempotent Probability expounds upon the recent methodology of building large deviation theory along the lines of weak convergence theory. The author develops an idempotent (or maxitive) probability theory, introduces idempotent analogues of martingales (maxingales), Wiener and Poisson processes, and Ito differential equations, and studies their properties. The large deviation principle for stochastic processes is formulated as a certain type of convergence of stochastic processes to idempotent processes. The author calls this large deviation convergence.The approach to establishing large deviation convergence uses novel com...
International Nuclear Information System (INIS)
Puntambekar, A.M.; Karmarkar, M.G.
2003-01-01
Superconducting (Sc) spool correctors of different types namely Sextupole, (MCS) Decapole (MCD) and Octupole (MCO) are incorporated in each of the main dipole of Large Hadron Collider (LHC). In all 2464 MCS and 1232 MCDO magnets are required to equip all 1232 Dipoles of LHC. The coils wound from thin rectangular section Sc wires are the heart of magnet assembly and its performance for the field quality and cold quench training largely depends on the precise and robust construction of these coils. Under DAE-CERN collaboration CAT was entrusted with the responsibility of making these magnets for LHC. Starting with development of manual fixtures and prototyping using soldering, a more advances special Automatic Coils Winding and Ultrasonic Welding (USW) system for production of large no. of coils and magnets were built at CAT. The paper briefly describes the various developments in this area. (author)
Directory of Open Access Journals (Sweden)
RAIMON eDURAN-STRUUCK
2015-11-01
Full Text Available The lack of a large animal transplantable tumor model has limited the study of novel therapeutic strategies for the treatment of liquid cancers. Swine as a species provide a natural option based on their similarities with humans and their already extensive use in biomedical research. Specifically, the MGH miniature swine herd retains unique genetic characteristics that facilitate the study of hematopoietic cell and solid organ transplantation. Spontaneously arising liquid cancers in these swine, specifically myeloid leukemias and B cell lymphomas, closely resemble human malignancies. The ability to establish aggressive tumor cell lines in vitro from these naturally occurring malignancies makes a transplantable tumor model a close reality. Here, we discuss our experience with myeloid and lymphoid tumors in MHC characterized miniature swine and future approaches regarding the development of a large animal transplantable tumor model.
Large-scale methanol plants. [Based on Japanese-developed process
Energy Technology Data Exchange (ETDEWEB)
Tado, Y
1978-02-01
A study was made on how to produce methanol economically which is expected as a growth item for use as a material for pollution-free energy or for chemical use, centering on the following subjects: (1) Improvement of thermal economy, (2) Improvement of process, and (3) Problems of hardware attending the expansion of scale. The results of this study were already adopted in actual plants, obtaining good results, and large-scale methanol plants are going to be realized.
Development of a large-screen high-definition laser video projection system
Clynick, Tony J.
1991-08-01
A prototype laser video projector which uses electronic, optical, and mechanical means to project a television picture is described. With the primary goal of commercial viability, the price/performance ratio of the chosen means is critical. The fundamental requirement has been to achieve high brightness, high definition images of at least movie-theater size, at a cost comparable with other existing large-screen video projection technologies, while having the opportunity of developing and exploiting the unique properties of the laser projected image, such as its infinite depth-of-field. Two argon lasers are used in combination with a dye laser to achieve a range of colors which, despite not being identical to those of a CRT, prove to be subjectively acceptable. Acousto-optic modulation in combination with a rotary polygon scanner, digital video line stores, novel specialized electro-optics, and a galvanometric frame scanner form the basis of the projection technique achieving a 30 MHz video bandwidth, high- definition scan rates (1125/60 and 1250/50), high contrast ratio, and good optical efficiency. Auditorium projection of HDTV pictures wider than 20 meters are possible. Applications including 360 degree(s) projection and 3-D video provide further scope for exploitation of the HD laser video projector.
Spychała, Marcin; Nieć, Jakub; Pawlak, Maciej
2013-01-01
In this paper, the preliminary study on the impact of filamentous particles (FP) in the septic tank effluent (STE) on filter cake (FC) development was presented. The number, length and diameter (30 p./cm3, 451 and 121 microm, respectively, on average) of FPs were measured using microscope image analysis of STE samples condensed using a vacuum evaporation set. Results of this study showed, that 0.73% of volatile suspended solids (VSSs) mass from the STE occurs in the form of FPs. No correlation between FP total mass and VSS was found. An experiment with a layer of FPs simulated by ground toilet paper was conducted and showed the impact of this layer (4.89 mg/cm2) on wastewater hydraulic conductivity--for an FC with FPs (FC-FP), hydraulic conductivity was seven times lower than for the FC without the FP layer, and on outflow quality (lower concentration of organic matter expressed as chemical oxygen demand (COD) in effluent from the FC-FP filter than in the effluent from the FC filter: 618 and 732 gO2/m3, respectively). Despite a relatively small amount of FPs in STE solids (as volume fraction), they play an important role in FC development due to their relatively high length and low degradability. Probably relatively small pores of the FC containing FPs (FC-FP) caused a small particle blocking and a decrease in permeability.
Reynolds, L P; Borowicz, P P; Caton, J S; Vonnahme, K A; Luther, J S; Hammer, C J; Maddock Carlin, K R; Grazul-Bilska, A T; Redmer, D A
2010-04-01
Developmental programming refers to the programming of various bodily systems and processes by a stressor of the maternal system during pregnancy or during the neonatal period. Such stressors include nutritional stress, multiple pregnancy (i.e., increased numbers of fetuses in the gravid uterus), environmental stress (e.g., high environmental temperature, high altitude, prenatal steroid exposure), gynecological immaturity, and maternal or fetal genotype. Programming refers to impaired function of numerous bodily systems or processes, leading to poor growth, altered body composition, metabolic dysfunction, and poor productivity (e.g., poor growth, reproductive dysfunction) of the offspring throughout their lifespan and even across generations. A key component of developmental programming seems to be placental dysfunction, leading to altered fetal growth and development. We discuss various large animal models of developmental programming and how they have and will continue to contribute to our understanding of the mechanisms underlying altered placental function and developmental programming, and, further, how large animal models also will be critical to the identification and application of therapeutic strategies that will alleviate the negative consequences of developmental programming to improve offspring performance in livestock production and human medicine.
DEFF Research Database (Denmark)
Bache, Anja Margrethe
2010-01-01
OF SELECTED EXISTING BUILDINGS IN AND AROUND COPENHAGEN COVERED WITH MOSAIC TILES, UNGLAZED OR GLAZED CLAY TILES. ITS BUILDINGS WHICH HAVE QUALITIES THAT I WOULD LIKE APPLIED, PERHAPS TRANSFORMED OR MOST PREFERABLY, INTERPRETED ANEW, FOR THE LARGE GLAZED CONCRETE PANELS I AM DEVELOPING. KEYWORDS: COLOR, LIGHT...
Energy Technology Data Exchange (ETDEWEB)
Hahn, A., E-mail: ahahn@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Mazin, D., E-mail: mazin@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Institute for Cosmic Ray Research, The University of Tokyo, 5-1-5 Kashiwa-no-Ha, Kashiwa City, Chiba 277–8582 (Japan); Bangale, P., E-mail: priya@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Dettlaff, A., E-mail: todettl@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Fink, D., E-mail: fink@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Grundner, F., E-mail: grundner@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Haberer, W., E-mail: haberer@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); Maier, R., E-mail: rma@mpp.mpg.de [Max Planck Institute for Physics (Werner-Heisenberg-Institut), Föhringer Ring 6, 80805 München (Germany); and others
2017-02-11
The MAGIC collaboration operates two 17 m diameter Imaging Atmospheric Cherenkov Telescopes (IACTs) on the Canary Island of La Palma. Each of the two telescopes is currently equipped with a photomultiplier tube (PMT) based imaging camera. Due to the advances in the development of Silicon Photomultipliers (SiPMs), they are becoming a widely used alternative to PMTs in many research fields including gamma-ray astronomy. Within the Otto-Hahn group at the Max Planck Institute for Physics, Munich, we are developing a SiPM based detector module for a possible upgrade of the MAGIC cameras and also for future experiments as, e.g., the Large Size Telescopes (LST) of the Cherenkov Telescope Array (CTA). Because of the small size of individual SiPM sensors (6 mm×6 mm) with respect to the 1-inch diameter PMTs currently used in MAGIC, we use a custom-made matrix of SiPMs to cover the same detection area. We developed an electronic circuit to actively sum up and amplify the SiPM signals. Existing non-imaging hexagonal light concentrators (Winston cones) used in MAGIC have been modified for the angular acceptance of the SiPMs by using C++ based ray tracing simulations. The first prototype based detector module includes seven channels and was installed into the MAGIC camera in May 2015. We present the results of the first prototype and its performance as well as the status of the project and discuss its challenges. - Highlights: • The design of the first SiPM large-size IACT pixel is described. • The simulation of the light concentrators is presented. • The temperature stability of the detector module is demonstrated. • The calibration procedure of SiPM device in the field is described.
Advanced UVOIR Mirror Technology Development (AMTD) for Very Large Space Telescopes
Stahl, H. Philip; Smith, W. Scott; Mosier, Gary; Abplanalp, Laura; Arnold, William
2014-01-01
ASTRO2010 Decadal stated that an advanced large-aperture ultraviolet, optical, near-infrared (UVOIR) telescope is required to enable the next generation of compelling astrophysics and exoplanet science; and, that present technology is not mature enough to affordably build and launch any potential UVOIR mission concept. AMTD builds on the state of art (SOA) defined by over 30 years of monolithic & segmented ground & space-telescope mirror technology to mature six key technologies. AMTD is deliberately pursuing multiple design paths to provide the science community with op-tions to enable either large aperture monolithic or segmented mirrors with clear engineering metrics traceable to science requirements.
Beurel, Eléonore; Mines, Marjelo A; Song, Ling; Jope, Richard S
2012-01-01
Objectives Dysregulated glycogen synthase kinase-3 (GSK3) may contribute to the pathophysiology of mood disorders and other diseases, and appears to be a target of certain therapeutic drugs. The growing recognition of heightened vulnerability during development to many psychiatric diseases, including mood disorders, led us to test if there are developmental changes in mouse brain GSK3 and its regulation by phosphorylation and by therapeutic drugs. Methods GSK3 levels and phosphorylation were measured at seven ages of development in mouse cerebral cortex and hippocampus. Results Two periods of rapid transitions in GSK3 levels were identified, a large rise between postnatal day 1 and two to three weeks of age, where GSK3 levels were as high as four-fold adult mouse brain levels, and a rapid decline between two to four and eight weeks of age, when adult levels were reached. Inhibitory serine-phosphorylation of GSK3, particularly GSK3β, was extremely high in one-day postnatal mouse brain, and rapidly declined thereafter. These developmental changes in GSK3 were equivalent in male and female cerebral cortex, and differed from other signaling kinases, including Akt, ERK1/2, JNK, and p38 levels and phosphorylation. In contrast to adult mouse brain, where administration of lithium or fluoxetine rapidly and robustly increased serine-phosphorylation of GSK3, in young mice these responses were blunted or absent. Conclusions High brain levels of GSK3 and large fluctuations in its levels and phosphorylation in juvenile and adolescent mouse brain raise the possibility that they may contribute to destabilized mood regulation induced by environmental and genetic factors. PMID:23167932
National Research Council Canada - National Science Library
Waltham, N. R; Prydderch, M; Mapson-Menard, H; Morrissey, Q; Turchetta, R; Pool, P; Harris, A
2005-01-01
We describe our programme to develop a large-format science-grade CMOS active pixel sensor for future space science missions, and in particular an extreme ultra-violet spectrograph for solar physics...
Computing in Large-Scale Dynamic Systems
Pruteanu, A.S.
2013-01-01
Software applications developed for large-scale systems have always been difficult to de- velop due to problems caused by the large number of computing devices involved. Above a certain network size (roughly one hundred), necessary services such as code updating, topol- ogy discovery and data
International Nuclear Information System (INIS)
Malcolm, Andrew A.; Liu, Tong; Ng, Ivan Kee Beng; Teng, Wei Yuen; Yap, Tsi Tung; Wan, Siew Ping; Kong, Chun Jeng
2013-01-01
X-ray Computed Tomography (CT) allows visualisation of the physical structures in the interior of an object without physically opening or cutting it. This technology supports a wide range of applications in the non-destructive testing, failure analysis or performance evaluation of industrial products and components. Of the numerous factors that influence the performance characteristics of an X-ray CT system the energy level in the X-ray spectrum to be used is one of the most significant. The ability of the X-ray beam to penetrate a given thickness of a specific material is directly related to the maximum available energy level in the beam. Higher energy levels allow penetration of thicker components made of more dense materials. In response to local industry demand and in support of on-going research activity in the area of 3D X-ray imaging for industrial inspection the Singapore Institute of Manufacturing Technology (SIMTech) engaged in the design, development and integration of large scale multiple source X-ray computed tomography system based on X-ray sources operating at higher energies than previously available in the Institute. The system consists of a large area direct digital X-ray detector (410 x 410 mm), a multiple-axis manipulator system, a 225 kV open tube microfocus X-ray source and a 450 kV closed tube millifocus X-ray source. The 225 kV X-ray source can be operated in either transmission or reflection mode. The body of the 6-axis manipulator system is fabricated from heavy-duty steel onto which high precision linear and rotary motors have been mounted in order to achieve high accuracy, stability and repeatability. A source-detector distance of up to 2.5 m can be achieved. The system is controlled by a proprietary X-ray CT operating system developed by SIMTech. The system currently can accommodate samples up to 0.5 x 0.5 x 0.5 m in size with weight up to 50 kg. These specifications will be increased to 1.0 x 1.0 x 1.0 m and 100 kg in future
Large nuclear steam turbine plants
International Nuclear Information System (INIS)
Urushidani, Haruo; Moriya, Shin-ichi; Tsuji, Kunio; Fujita, Isao; Ebata, Sakae; Nagai, Yoji.
1986-01-01
The technical development of the large capacity steam turbines for ABWR plants was partially completed, and that in progress is expected to be completed soon. In this report, the outline of those new technologies is described. As the technologies for increasing the capacity and heightening the efficiency, 52 in long blades and moisture separating heaters are explained. Besides, in the large bore butterfly valves developed for making the layout compact, the effect of thermal efficiency rise due to the reduction of pressure loss can be expected. As the new technology on the system side, the simplification of the turbine system and the effect of heightening the thermal efficiency by high pressure and low pressure drain pumping-up method based on the recent improvement of feed water quality are discussed. As for nuclear steam turbines, the actual records of performance of 1100 MW class, the largest output at present, have been obtained, and as a next large capacity machine, the development of a steam turbine of 1300 MWe class for an ABWR plant is in progress. It can be expected that by the introduction of those new technologies, the plants having high economical efficiency are realized. (Kako, I.)
Status: Large-scale subatmospheric cryogenic systems
International Nuclear Information System (INIS)
Peterson, T.
1989-01-01
In the late 1960's and early 1970's an interest in testing and operating RF cavities at 1.8K motivated the development and construction of four large (300 Watt) 1.8K refrigeration systems. in the past decade, development of successful superconducting RF cavities and interest in obtaining higher magnetic fields with the improved Niobium-Titanium superconductors has once again created interest in large-scale 1.8K refrigeration systems. The L'Air Liquide plant for Tore Supra is a recently commissioned 300 Watt 1.8K system which incorporates new technology, cold compressors, to obtain the low vapor pressure for low temperature cooling. CEBAF proposes to use cold compressors to obtain 5KW at 2.0K. Magnetic refrigerators of 10 Watt capacity or higher at 1.8K are now being developed. The state of the art of large-scale refrigeration in the range under 4K will be reviewed. 28 refs., 4 figs., 7 tabs
Directory of Open Access Journals (Sweden)
Oskar Modin
Full Text Available New activated sludge processes that utilize sorption as a major mechanism for organics removal are being developed to maximize energy recovery from wastewater organics, or as enhanced primary treatment technologies. To model and optimize sorption-based activated sludge processes, further knowledge about sorption of organics onto sludge is needed. This study compared primary-, anaerobic-, and aerobic activated sludge as sorbents, determined sorption capacity and kinetics, and investigated some characteristics of the organics being sorbed. Batch sorption assays were carried out without aeration at a mixing velocity of 200 rpm. Only aerobic activated sludge showed net sorption of organics. Sorption of dissolved organics occurred by a near-instantaneous sorption event followed by a slower process that obeyed 1st order kinetics. Sorption of particulates also followed 1st order kinetics but there was no instantaneous sorption event; instead there was a release of particles upon mixing. The 5-min sorption capacity of activated sludge was 6.5±10.8 mg total organic carbon (TOC per g volatile suspend solids (VSS for particulate organics and 5.0±4.7 mgTOC/gVSS for dissolved organics. The observed instantaneous sorption appeared to be mainly due to organics larger than 20 kDa in size being sorbed, although molecules with a size of about 200 Da with strong UV absorbance at 215-230 nm were also rapidly removed.
Working memory in early Alzheimer's disease: a neuropsychological review.
Huntley, J D; Howard, R J
2010-02-01
Reports of the extent of working memory (WM) impairment in early Alzheimer's disease (AD) have been inconsistent. Using the model of WM proposed by Baddeley, neuropsychological evidence for the impairment of WM in early AD is evaluated. Literature searches were performed using Medline, PsycINFO and Embase databases. Individual papers were then examined for additional references not revealed by computerised searches. Phonological loop function is intact at the preclinical and early stages of AD, becoming more impaired as the disease progresses. In mild AD, there is impairment on tasks assessing visuospatial sketchpad (VSS) function; however, these tasks also require executive processing by the central executive system (CES). There is evidence that the CES is impaired in mild AD and may be affected in the earlier preclinical stage of the disease. Episodic buffer function may be impaired but further research is required. Future research into central executive functioning at the earliest stages of the disease, combined with further longitudinal studies, needs to be carried out. Tasks to assess the proposed functions of the episodic buffer and specific tests of the VSS suitable for AD subjects need to be developed and validated. Learning more about these processes and how they are affected in AD is important in understanding and managing the cognitive deficits seen in the early stages of AD.
Jiao, Jialong; Ren, Huilong; Adenya, Christiaan Adika; Chen, Chaohe
2017-10-29
Wave-induced motion and load responses are important criteria for ship performance evaluation. Physical experiments have long been an indispensable tool in the predictions of ship's navigation state, speed, motions, accelerations, sectional loads and wave impact pressure. Currently, majority of the experiments are conducted in laboratory tank environment, where the wave environments are different from the realistic sea waves. In this paper, a laboratory tank testing system for ship motions and loads measurement is reviewed and reported first. Then, a novel large-scale model measurement technique is developed based on the laboratory testing foundations to obtain accurate motion and load responses of ships in realistic sea conditions. For this purpose, a suite of advanced remote control and telemetry experimental system was developed in-house to allow for the implementation of large-scale model seakeeping measurement at sea. The experimental system includes a series of technique sensors, e.g., the Global Position System/Inertial Navigation System (GPS/INS) module, course top, optical fiber sensors, strain gauges, pressure sensors and accelerometers. The developed measurement system was tested by field experiments in coastal seas, which indicates that the proposed large-scale model testing scheme is capable and feasible. Meaningful data including ocean environment parameters, ship navigation state, motions and loads were obtained through the sea trial campaign.
Directory of Open Access Journals (Sweden)
Timur V. Kramin
2015-12-01
Full Text Available Objective to determine the directions of increasing the innovative potential of a region through the development of innovative technologies and competences in the process of preparation and implementation of large investment projects in the Republic of Tatarstan. Methods methodology of project management institutional approach. Results it is proved that the main largescale directions of innovative potential development in the Republic of Tatarstan as a result of preparation and implementing of Universiade 2013 in Kazan are knowledge management information technologies risk management. It is shown that in the framework of the considered innovative areas a complete system was formed of competences of employees and managers in the fields of education trade hospitality and service. Scientific novelty the key directions were defined of increasing the innovative potential of a region through the development of innovative technologies and competences in the process of preparation and implementation of large investment projects by the example of the World Summer Student Games in Kazan in 2013. Practical significance on the basis of specific examples the authors illustrate the practiceoriented mechanism of innovative potential development of a region as a result of implementation of large investment projects. nbsp
Developing and evaluating Quilts for the depiction of large layered graphs.
Bae, Juhee; Watson, Ben
2011-12-01
Traditional layered graph depictions such as flow charts are in wide use. Yet as graphs grow more complex, these depictions can become difficult to understand. Quilts are matrix-based depictions for layered graphs designed to address this problem. In this research, we first improve Quilts by developing three design alternatives, and then compare the best of these alternatives to better-known node-link and matrix depictions. A primary weakness in Quilts is their depiction of skip links, links that do not simply connect to a succeeding layer. Therefore in our first study, we compare Quilts using color-only, text-only, and mixed (color and text) skip link depictions, finding that path finding with the color-only depiction is significantly slower and less accurate, and that in certain cases, the mixed depiction offers an advantage over the text-only depiction. In our second study, we compare Quilts using the mixed depiction to node-link diagrams and centered matrices. Overall results show that users can find paths through graphs significantly faster with Quilts (46.6 secs) than with node-link (58.3 secs) or matrix (71.2 secs) diagrams. This speed advantage is still greater in large graphs (e.g. in 200 node graphs, 55.4 secs vs. 71.1 secs for node-link and 84.2 secs for matrix depictions). © 2011 IEEE
On alternative approach for verifiable secret sharing
Kulesza, Kamil; Kotulski, Zbigniew; Pieprzyk, Joseph
2002-01-01
Secret sharing allows split/distributed control over the secret (e.g. master key). Verifiable secret sharing (VSS) is the secret sharing extended by verification capacity. Usually verification comes at the price. We propose "free lunch", the approach that allows to overcome this inconvenience.
African Journals Online (AJOL)
A retrial queueing-inventory system with J-additional options for service and nite source · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VSS Yadavalli, K Jeganathan, T Venkatesan, S Padmasekaran, S Jehoashan Kingsly, 105-135 ...
Gola, M.; Wordecha, M.; Marchewka, A.; Sescousse, G.T.
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain
Treatment of acid and sulphate-rich effluents in an integrated biological/chemical process
CSIR Research Space (South Africa)
Maree, JP
2004-04-01
Full Text Available .4 g SO4/(l.d). The rate of biological sulphate removal was found to be directly related to the square root of sulphate, COD and VSS concentrations respectively, and inversely proportional to sulphide concentration. The practical value of simultaneous...
Irles, Adrián
2017-01-01
High precision physics at future colliders requires unprecedented highly granular calorimeters for the application of the Particle Flow (PF) algorithm. The physical proof of concept was given in the previous campaign of beam tests of physic prototypes within the CALICE collaboration. We present here the latest beam and laboratory test results and R&D developments for the Silicon-Tungsten Electromagnetic Calorimeter technological prototype with fully embedded very front-end (VFE) electronics for the International Large Detector at the International Linear Collider project.
Redmon, John W.; Shirley, Michael C.; Kinard, Paul S.
2012-01-01
This paper presents a method for performing large-scale design integration, taking a classical 2D drawing envelope and interface approach and applying it to modern three dimensional computer aided design (3D CAD) systems. Today, the paradigm often used when performing design integration with 3D models involves a digital mockup of an overall vehicle, in the form of a massive, fully detailed, CAD assembly; therefore, adding unnecessary burden and overhead to design and product data management processes. While fully detailed data may yield a broad depth of design detail, pertinent integration features are often obscured under the excessive amounts of information, making them difficult to discern. In contrast, the envelope and interface method results in a reduction in both the amount and complexity of information necessary for design integration while yielding significant savings in time and effort when applied to today's complex design integration projects. This approach, combining classical and modern methods, proved advantageous during the complex design integration activities of the Ares I vehicle. Downstream processes, benefiting from this approach by reducing development and design cycle time, include: Creation of analysis models for the Aerodynamic discipline; Vehicle to ground interface development; Documentation development for the vehicle assembly.
DEFF Research Database (Denmark)
Domingo Felez, Carlos; Mutlu, A. Gizem; Jensen, Marlene Mark
2014-01-01
Autotrophic nitrogen removal is regarded as a resource efficient process to manage nitrogen-rich residual streams. However, nitrous oxide emissions of these processes are poorly documented and strategies to mitigate emissions unknown. In this study, two sequencing batch reactors performing single...... was noted when the duration of aeration was increased while decreasing air flow rate (10.9 +/- 3.2% Delta N2O/Delta TN). The extant ammonium oxidation activity (mgNH(4)(+)-N/gVSS.min) positively correlated with the specific N2O production rate (mgN(2)O-N/gVSS.min) of the systems. Operating under conditions......-stage nitritation/anammox were operated under different aeration strategies, gradually adjusted over six months. At constant but limiting oxygen loading, synthetic reject water was fed (0.75g-N/L.d) and high nitrogen removal efficiencies (83 +/- 5 and 88 +/- 2%) obtained. Dynamics of liquid phase nitrous (N2O...
Distributed large-scale dimensional metrology new insights
Franceschini, Fiorenzo; Maisano, Domenico
2011-01-01
Focuses on the latest insights into and challenges of distributed large scale dimensional metrology Enables practitioners to study distributed large scale dimensional metrology independently Includes specific examples of the development of new system prototypes
Large area, low cost solar cell development and production readiness
Michaels, D.
1982-01-01
A process sequence for a large area ( or = 25 sq. cm) silicon solar cell was investigated. Generic cell choice was guided by the expected electron fluence, by the packing factors of various cell envelope designs onto each panel to provide needed voltage as well as current, by the weight constraints on the system, and by the cost goals of the contract.
Design and construction of large capacitor banks
International Nuclear Information System (INIS)
Whitham, K.; Gritton, D.G.; Holloway, R.W.; Merritt, B.T.
1983-01-01
Over the past 12 years, the Laser Program at LLNL has actively pursued laser fusion, using a series of large, solid-state lasers to develop target data leading to reactor designs using the concept of inertial confinement fusion. These lasers are all linear chains of flashlamp driven, Nd-doped glass amplifiers with a master oscillator at the front end. Techniques have been developed during this time to scale the lasers to an arbitrarily large size. A table shows the series of lasers and their parameters that have been developed to date
International Nuclear Information System (INIS)
Unno, Y.; Edwards, S.O.; Pyatt, S.; Thomas, J.P.; Wilson, J.A.; Kierstead, J.; Lynn, D.; Carter, J.R.; Hommels, L.B.A.; Robinson, D.; Bloch, I.; Gregor, I.M.; Tackmann, K.; Betancourt, C.; Jakobs, K.; Kuehn, S.; Mori, R.; Parzefall, U.; Wiik-Fucks, L.; Clark, A.
2014-01-01
We have been developing a novel radiation-tolerant n + -in-p silicon microstrip sensor for very high radiation environments, aiming for application in the high luminosity large hadron collider. The sensors are fabricated in 6 in., p-type, float-zone wafers, where large-area strip sensor designs are laid out together with a number of miniature sensors. Radiation tolerance has been studied with ATLAS07 sensors and with independent structures. The ATLAS07 design was developed into new ATLAS12 designs. The ATLAS12A large-area sensor is made towards an axial strip sensor and the ATLAS12M towards a stereo strip sensor. New features to the ATLAS12 sensors are two dicing lines: standard edge space of 910 μm and slim edge space of 450 μm, a gated punch-through protection structure, and connection of orphan strips in a triangular corner of stereo strips. We report the design of the ATLAS12 layouts and initial measurements of the leakage current after dicing and the resistivity of the wafers
Reflections on Teaching a Large Class.
Miner, Rick
1992-01-01
Uses an analysis of small- and large-class differences as a framework for planning for and teaching a large class. Analyzes the process of developing and offering an organizational behavior class to 141 college students. Suggests ways to improve teaching effectiveness by minimizing psychological and physical distances, redistributing resources,…
Large-scale matrix-handling subroutines 'ATLAS'
International Nuclear Information System (INIS)
Tsunematsu, Toshihide; Takeda, Tatsuoki; Fujita, Keiichi; Matsuura, Toshihiko; Tahara, Nobuo
1978-03-01
Subroutine package ''ATLAS'' has been developed for handling large-scale matrices. The package is composed of four kinds of subroutines, i.e., basic arithmetic routines, routines for solving linear simultaneous equations and for solving general eigenvalue problems and utility routines. The subroutines are useful in large scale plasma-fluid simulations. (auth.)
Saikrishnan, Neelakantan; Mirabella, Lucia; Yoganathan, Ajit P
2015-06-01
Congenital bicuspid aortic valves (BAVs) are associated with accelerated disease progression, such as leaflet calcification and ascending aorta dilatation. Although common underlying genetic factors have been implicated in accelerated disease in BAV patients, several studies have suggested that altered hemodynamics also play a role in this disease process. The present study compares turbulence and wall shear stress (WSS) measurements between various BAV and trileaflet aortic valve (TAV) models to provide information for mechanobiological models of BAV disease. BAV and TAV models were constructed from excised porcine aortic valves to simulate parametric variations in BAV stenosis, hemodynamics and geometry. Particle image velocimetry experiments were conducted at physiological pressure conditions to characterize velocity fields in the ascending aorta. The velocity fields were post-processed to calculate turbulence, viscous and wall shear stresses in the ascending aorta. Stenosed BAV models showed the presence of eccentric systolic jets, causing increased WSS. Lower cardiac output resulted in a narrower jet, lower turbulence and lower viscous shear stress (VSS). The specific severe stenosis BAV model studied here showed reduced WSS due to reduction in non-fused leaflet mobility. Dilation of the aorta did not affect any turbulence or VSS, but reduced the WSS. In comparison with BAVs, TAVs have similar VSS values, but much smaller WSS and turbulence levels. These increased turbulence and WSS levels in BAVs may play a key role in amplifying the biological responses of the ascending aorta wall and valvular leaflets, and support the hemodynamic underpinnings of BAV disease processes.
Elastin Is Differentially Regulated by Pressure Therapy in a Porcine Model of Hypertrophic Scar.
Carney, Bonnie C; Liu, Zekun; Alkhalil, Abdulnaser; Travis, Taryn E; Ramella-Roman, Jessica; Moffatt, Lauren T; Shupp, Jeffrey W
Beneficial effects of pressure therapy for hypertrophic scars have been reported, but the mechanisms of action are not fully understood. This study evaluated elastin and its contribution to scar pliability. The relationship between changes in Vancouver Scar Scale (VSS) scores of pressure-treated scars and differential regulation of elastin was assessed. Hypertrophic scars were created and assessed weekly using VSS and biopsy procurement. Pressure treatment began on day 70 postinjury. Treated scars were compared with untreated shams. Treatment lasted 2 weeks, through day 84, and scars were assessed weekly through day 126. Transcript and protein levels of elastin were quantified. Pressure treatment resulted in lower VSS scores compared with sham-treated scars. Pliability (VSSP) was a key contributor to this difference. At day 70 pretreatment, VSSP = 2. Without treatment, sham-treated scars became less pliable, while pressure-treated scars became more pliable. The percentage of elastin in scars at day 70 was higher than in uninjured skin. Following treatment, the percentage of elastin increased and continued to increase through day 126. Untreated sham scars did not show a similar increase. Quantification of Verhoeff-Van Gieson staining corroborated the findings and immunofluorescence revealed the alignment of elastin fibers. Pressure treatment results in increased protein level expression of elastin compared with sham-untreated scars. These findings further characterize the extracellular matrix's response to the application of pressure as a scar treatment, which will contribute to the refinement of rehabilitation practices and ultimately improvements in functional and psychosocial outcomes for patients.
Jiang, Liren
2017-01-01
Background The aim was to develop scalable Whole Slide Imaging (sWSI), a WSI system based on mainstream smartphones coupled with regular optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry objective lenses of different magnifications, and reasonably high throughput. These performance metrics should be evaluated by expert pathologists and match those of high-end scanners. Objective The aim was to develop scalable Whole Slide Imaging (sWSI), a whole slide imaging system based on smartphones coupled with optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry object lens of different magnification. All performance metrics should be evaluated by expert pathologists and match those of high-end scanners. Methods In the sWSI design, the digitization process is split asynchronously between light-weight clients on smartphones and powerful cloud servers. The client apps automatically capture FoVs at up to 12-megapixel resolution and process them in real-time to track the operation of users, then give instant feedback of guidance. The servers first restitch each pair of FoVs, then automatically correct the unknown nonlinear distortion introduced by the lens of the smartphone on the fly, based on pair-wise stitching, before finally combining all FoVs into one gigapixel VS for each scan. These VSs can be viewed using Internet browsers anywhere. In the evaluation experiment, 100 frozen section slides from patients randomly selected among in-patients of the participating hospital were scanned by both a high-end Leica scanner and sWSI. All VSs were examined by senior pathologists whose diagnoses were compared against those made using optical microscopy as ground truth to evaluate the image quality. Results The sWSI system is developed for both Android and iPhone smartphones and
Yu, Hong; Gao, Feng; Jiang, Liren; Ma, Shuoxin
2017-09-15
The aim was to develop scalable Whole Slide Imaging (sWSI), a WSI system based on mainstream smartphones coupled with regular optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry objective lenses of different magnifications, and reasonably high throughput. These performance metrics should be evaluated by expert pathologists and match those of high-end scanners. The aim was to develop scalable Whole Slide Imaging (sWSI), a whole slide imaging system based on smartphones coupled with optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry object lens of different magnification. All performance metrics should be evaluated by expert pathologists and match those of high-end scanners. In the sWSI design, the digitization process is split asynchronously between light-weight clients on smartphones and powerful cloud servers. The client apps automatically capture FoVs at up to 12-megapixel resolution and process them in real-time to track the operation of users, then give instant feedback of guidance. The servers first restitch each pair of FoVs, then automatically correct the unknown nonlinear distortion introduced by the lens of the smartphone on the fly, based on pair-wise stitching, before finally combining all FoVs into one gigapixel VS for each scan. These VSs can be viewed using Internet browsers anywhere. In the evaluation experiment, 100 frozen section slides from patients randomly selected among in-patients of the participating hospital were scanned by both a high-end Leica scanner and sWSI. All VSs were examined by senior pathologists whose diagnoses were compared against those made using optical microscopy as ground truth to evaluate the image quality. The sWSI system is developed for both Android and iPhone smartphones and is currently being offered to the
Development of a large-solid-angle and multi-device detection system for elemental analysis
International Nuclear Information System (INIS)
Satoh, T.; Ishii, K.; Kamiya, T.; Sakai, T.; Oikawa, M.; Arakawa, K.; Matsuyama, S.; Yamazaki, H.
2003-01-01
A new detection apparatus for both low energy X-rays like 1 keV and back scattered protons of MeV energy was developed. The detection apparatus consists of a large-solid-angle multi-device Si detector and a data acquisition system. The detector has 45 detection devices which are arranged in the shape of a pentagonal pyramid and fully cover a sample. A micro-beam irradiates the sample through the center of the pentagonal pyramid and X-rays emitted from the sample are detected in a solid angle of about 1.0 sr. This novel detection setup has about five times higher sensitivity than a conventional micro-PIXE camera. In addition, not only X-rays but back scattered protons can be detected, since the counting rate of back scattered protons per detection device is small despite lack of a passive absorber
Morgan, L.A.; Shanks, W.C. Pat; Pierce, K.L.
2009-01-01
and vein-fi lling; and (5) areal dimensions of many large hydrothermal explosion craters in Yellowstone are similar to those of its active geyser basins and thermal areas. For Yellowstone, our knowledge of hydrothermal craters and ejecta is generally limited to after the Yellowstone Plateau emerged from beneath a late Pleistocene icecap that was roughly a kilometer thick. Large hydrothermal explosions may have occurred earlier as indicated by multiple episodes of cementation and brecciation commonly observed in hydrothermal ejecta clasts. Critical components for large, explosive hydrothermal systems include a watersaturated system at or near boiling temperatures and an interconnected system of well-developed joints and fractures along which hydrothermal fluids flow. Active deformation of the Yellowstone caldera, active faulting and moderate local seismicity, high heat flow, rapid changes in climate, and regional stresses are factors that have strong infl uences on the type of hydrothermal system developed. Ascending hydrothermal fluids flow along fractures that have developed in response to active caldera deformation and along edges of low-permeability rhyolitic lava flows. Alteration of the area affected, self-sealing leading to development of a caprock for the hydrothermal system, and dissolution of silica-rich rocks are additional factors that may constrain the distribution and development of hydrothermal fields. A partial lowpermeability layer that acts as a cap to the hydrothermal system may produce some over-pressurization, thought to be small in most systems. Any abrupt drop in pressure initiates steam fl ashing and is rapidly transmitted through interconnected fractures that result in a series of multiple large-scale explosions contributing to the excavation of a larger explosion crater. Similarities between the size and dimensions of large hydrothermal explosion craters and thermal fields in Yellowstone may indicate that catastrophic events which result in l
International Nuclear Information System (INIS)
Velikoseltsev, A A; Luk'yanov, D P; Vinogradov, V I; Shreiber, K U
2014-01-01
A brief survey of the history of the invention and development of super-large laser gyroscopes (SLLGs) is presented. The basic results achieved using SLLGs in geodesy, seismology, fundamental physics and other fields are summarised. The concept of SLLG design, specific features of construction and implementation are considered, as well as the prospects of applying the present-day optical technologies to laser gyroscope engineering. The possibilities of using fibre-optical gyroscopes in seismologic studies are analysed and the results of preliminary experimental studies are presented. (laser gyroscopes)
Energy Technology Data Exchange (ETDEWEB)
Velikoseltsev, A A; Luk' yanov, D P [St. Petersburg Electrotechnical University ' ' LETI' ' , St. Petersburg (Russian Federation); Vinogradov, V I [OJSC Tambov factory Elektropribor (Russian Federation); Shreiber, K U [Forschungseinrichtung Satellitengeodaesie, Technosche Universitaet Muenchen, Geodaetisches Observatorium Wettzell, Sackenrieder str. 25, 93444 Bad Koetzting (Germany)
2014-12-31
A brief survey of the history of the invention and development of super-large laser gyroscopes (SLLGs) is presented. The basic results achieved using SLLGs in geodesy, seismology, fundamental physics and other fields are summarised. The concept of SLLG design, specific features of construction and implementation are considered, as well as the prospects of applying the present-day optical technologies to laser gyroscope engineering. The possibilities of using fibre-optical gyroscopes in seismologic studies are analysed and the results of preliminary experimental studies are presented. (laser gyroscopes)
Development of high sensitivity and high speed large size blank inspection system LBIS
Ohara, Shinobu; Yoshida, Akinori; Hirai, Mitsuo; Kato, Takenori; Moriizumi, Koichi; Kusunose, Haruhiko
2017-07-01
The production of high-resolution flat panel displays (FPDs) for mobile phones today requires the use of high-quality large-size photomasks (LSPMs). Organic light emitting diode (OLED) displays use several transistors on each pixel for precise current control and, as such, the mask patterns for OLED displays are denser and finer than the patterns for the previous generation displays throughout the entire mask surface. It is therefore strongly demanded that mask patterns be produced with high fidelity and free of defect. To enable the production of a high quality LSPM in a short lead time, the manufacturers need a high-sensitivity high-speed mask blank inspection system that meets the requirement of advanced LSPMs. Lasertec has developed a large-size blank inspection system called LBIS, which achieves high sensitivity based on a laser-scattering technique. LBIS employs a high power laser as its inspection light source. LBIS's delivery optics, including a scanner and F-Theta scan lens, focus the light from the source linearly on the surface of the blank. Its specially-designed optics collect the light scattered by particles and defects generated during the manufacturing process, such as scratches, on the surface and guide it to photo multiplier tubes (PMTs) with high efficiency. Multiple PMTs are used on LBIS for the stable detection of scattered light, which may be distributed at various angles due to irregular shapes of defects. LBIS captures 0.3mμ PSL at a detection rate of over 99.5% with uniform sensitivity. Its inspection time is 20 minutes for a G8 blank and 35 minutes for G10. The differential interference contrast (DIC) microscope on the inspection head of LBIS captures high-contrast review images after inspection. The images are classified automatically.
Utilization of AHWR critical facility for research and development work on large sample NAA
International Nuclear Information System (INIS)
Acharya, R.; Dasari, K.B.; Pujari, P.K.; Swain, K.K.; Reddy, A.V.R.; Verma, S.K.; De, S.K.
2014-01-01
The graphite reflector position of AHWR critical facility (CF) was utilized for analysis of large size (g-kg scale) samples using internal mono standard neutron activation analysis (IM-NAA). The reactor position was characterized by cadmium ratio method using In monitor for total flux and sub cadmium to epithermal flux ratio (f). Large sample neutron activation analysis (LSNAA) work was carried out for samples of stainless steel, ancient and new clay potteries and dross. Large as well as non-standard geometry samples (1 g - 0.5 kg) were irradiated. Radioactive assay was carried out using high resolution gamma ray spectrometry. Concentration ratios obtained by IM-NAA were used for provenance study of 30 clay potteries, obtained from excavated Buddhist sites of AP, India. Concentrations of Au and Ag were determined in not so homogeneous three large size samples of dross. An X-Z rotary scanning unit has been installed for counting large and not so homogeneous samples. (author)
DEFF Research Database (Denmark)
Jurowetzki, Roman
2016-01-01
in the transformation process. While they can contribute with resources, capabilities, and their connections to the development of the new grid infrastructure, they may also impede innovation given their ownership of and assumed interest in the established system. These insights should be considered in policy...... transformation of the energy grid infrastructure. The focus is set on how the interplay between established and new technologies and actors determines the direction and outcomes of innovation in large technological systems (such as the Danish smart grid). Results of several chapters indicate that in the Danish......Combining elements form the Science, Technology and Society (STS) tradition with the Technological Innovation System (TIS) framework and utilising unstructured and relational data as well as novel analysis tools, this thesis explores the development of the Danish smart grid and the associated...
Development of theoretical methodology for large molecules
International Nuclear Information System (INIS)
Maggiora, G.M.; Christoffersen, R.E.; Yoffe, J.A.; Petke, J.D.
1981-01-01
A major advantage of the use of floating spherical Gaussian or vitals (FSGO) is the extreme rapidity with which the necessary quantum mechanical integrals can be evaluated. This advantage has been exploited in several quantum mechanical procedures for molecular electronic structure calculations, as described below. Several other properties of these functions have also been exploited, and have led to the development of semiclassical point charge and harmonic oscillator models capable of describing first and second order electromagnetic properties and intermolecular forces with reasonable accuracy in all cases and with considerably better accuracy than much more elaborate theoretical procedures in some cases. These applications are also described below. The primary intent of the current paper is to present an overview of some of the uses of FSGOs in the study of molecular electronic structure and properties and to indicate possible directions for future applications. No attempt will be made to include all possible applications. Rather, those applications of interest to the authors have been stressed. Hopefully, this paper will further stimulate the development of additional uses of these remarkable functions
Control problems in very large accelerators
International Nuclear Information System (INIS)
Crowley-Milling, M.C.
1985-06-01
There is no fundamental difference of kind in the control requirements between a small and a large accelerator since they are built of the same types of components, which individually have similar control inputs and outputs. The main difference is one of scale; the large machine has many more components of each type, and the distances involved are much greater. Both of these factors must be taken into account in determining the optimum way of carrying out the control functions. Small machines should use standard equipment and software for control as much as possible, as special developments for small quantities cannot normally be justified if all costs are taken into account. On the other hand, the very great number of devices needed for a large machine means that, if special developments can result in simplification, they may make possible an appreciable reduction in the control equipment costs. It is the purpose of this report to look at the special control problems of large accelerators, which the author shall arbitarily define as those with a length of circumference in excess of 10 km, and point out where special developments, or the adoption of developments from outside the accelerator control field, can be of assistance in minimizing the cost of the control system. Most of the first part of this report was presented as a paper to the 1985 Particle Accelerator Conference. It has now been extended to include a discussion on the special case of the controls for the SSC
Gambicorti, Lisa; D'Amato, Francesco; Vettore, Christian; Duò, Fabrizio; Guercia, Alessio; Patauner, Christian; Biasi, Roberto; Lisi, Franco; Riccardi, Armando; Gallieni, Daniele; Lazzarini, Paolo; Tintori, Matteo; Zuccaro Marchi, Alessandro; Pereira do Carmo, Joao
2017-11-01
The aim of this work is to describe the latest results of new technological concepts for Large Aperture Telescopes Technology (LATT) using thin deployable lightweight active mirrors. This technology is developed under the European Space Agency (ESA) Technology Research Program and can be exploited in all the applications based on the use of primary mirrors of space telescopes with large aperture, segmented lightweight telescopes with wide Field of View (FOV) and low f/#, and LIDAR telescopes. The reference mission application is a potential future ESA mission, related to a space borne DIAL (Differential Absorption Lidar) instrument operating around 935.5 nm with the goal to measure water vapor profiles in atmosphere. An Optical BreadBoard (OBB) for LATT has been designed for investigating and testing two critical aspects of the technology: 1) control accuracy in the mirror surface shaping. 2) mirror survivability to launch. The aim is to evaluate the effective performances of the long stroke smart-actuators used for the mirror control and to demonstrate the effectiveness and the reliability of the electrostatic locking (EL) system to restraint the thin shell on the mirror backup structure during launch. The paper presents a comprehensive vision of the breadboard focusing on how the requirements have driven the design of the whole system and of the various subsystems. The manufacturing process of the thin shell is also presented.
International Nuclear Information System (INIS)
Puntambekar, A.M.; Karmarkar, M.G.
2003-01-01
Superconducting (Sc)-corrector magnets are one of the important Indian contributions to LHC under construction at Geneva, Switzerland. Under DAE-CERN collaboration we embarked on the development of these magnets at CAT. This involved making prototype to validate basic design, then incorporate engineering design features and develop all tooling, machines to suit large production lot. We started the work in close collaboration with LHC/ICP, CERN and developed necessary tooling and fixtures, machining methods for intricate shape coil supports, Sc coil winding machines, test-equipment for warm and cold testing etc and made several prototypes. These prototypes were tested at CAT and CERN at warm and at 4.2 and 1.8K for acceptance. This paper describes salient features of prototype development at CAT. (author)
Stabilization Algorithms for Large-Scale Problems
DEFF Research Database (Denmark)
Jensen, Toke Koldborg
2006-01-01
The focus of the project is on stabilization of large-scale inverse problems where structured models and iterative algorithms are necessary for computing approximate solutions. For this purpose, we study various iterative Krylov methods and their abilities to produce regularized solutions. Some......-curve. This heuristic is implemented as a part of a larger algorithm which is developed in collaboration with G. Rodriguez and P. C. Hansen. Last, but not least, a large part of the project has, in different ways, revolved around the object-oriented Matlab toolbox MOORe Tools developed by PhD Michael Jacobsen. New...
Large-aperture hybrid photo-detector
International Nuclear Information System (INIS)
Kawai, Y.; Nakayama, H.; Kusaka, A.; Kakuno, H.; Abe, T.; Iwasaki, M.; Aihara, H.; Tanaka, M.; Shiozawa, M.; Kyushima, H.; Suyama, M.
2007-01-01
We have developed the first complete large-aperture (13-inch diameter) hybrid photo-detector (HPD). The withstanding voltage problem has been overcome and we were able to attain an HPD operating voltage of +20 kV. Adoption of our newly developed backside illumination avalanche diode (AD) was also critical in successfully countering the additional problem of an increase in AD leakage after the activation process. We observed single photon signal timing jitter of under 450 ps in FWHM, electron transit time of ∼12 ns, and clear pulse height separation up to several photoelectron peaks, all greatly superior to the performance of any conventional large-aperture photomultiplier tubes (PMTs). In addition, our HPD has a much simpler structure than conventional large-aperture PMTs, which simplifies mass production and lowers manufacturing cost. We believe that these attributes position our HPD as the most suitable photo-detector for the next generation mega-ton class water-Cherenkov detector, which is expected to be more than 20x larger than the Super-Kamiokande (SK) detector
Energy Technology Data Exchange (ETDEWEB)
Harris, R
1978-08-01
Conventional cost/benefit or project analysis has generally not taken into account circumstances in which the project under consideration is large enough that its introduction to the economy would have significant general equilibrium effects. In this paper, rules are examined that would indicate whether such large projects should be accepted or rejected. The rules utilize information yielded by before-project and after-project equilibrium prices and production data. Rules are developed for the undistorted ''first-best'' case, the case in which the fixed costs of the project are covered by distortionary taxation, and for the case of projects producing public goods. 34 references.
Miranda, Leandro E.; Bettoli, Phillip William
2010-01-01
Large impoundments, defined as those with surface area of 200 ha or greater, are relatively new aquatic ecosystems in the global landscape. They represent important economic and environmental resources that provide benefits such as flood control, hydropower generation, navigation, water supply, commercial and recreational fisheries, and various other recreational and esthetic values. Construction of large impoundments was initially driven by economic needs, and ecological consequences received little consideration. However, in recent decades environmental issues have come to the forefront. In the closing decades of the 20th century societal values began to shift, especially in the developed world. Society is no longer willing to accept environmental damage as an inevitable consequence of human development, and it is now recognized that continued environmental degradation is unsustainable. Consequently, construction of large reservoirs has virtually stopped in North America. Nevertheless, in other parts of the world construction of large reservoirs continues. The emergence of systematic reservoir management in the early 20th century was guided by concepts developed for natural lakes (Miranda 1996). However, we now recognize that reservoirs are different and that reservoirs are not independent aquatic systems inasmuch as they are connected to upstream rivers and streams, the downstream river, other reservoirs in the basin, and the watershed. Reservoir systems exhibit longitudinal patterns both within and among reservoirs. Reservoirs are typically arranged sequentially as elements of an interacting network, filter water collected throughout their watersheds, and form a mosaic of predictable patterns. Traditional approaches to fisheries management such as stocking, regulating harvest, and in-lake habitat management do not always produce desired effects in reservoirs. As a result, managers may expend resources with little benefit to either fish or fishing. Some locally
LSD: Large Survey Database framework
Juric, Mario
2012-09-01
The Large Survey Database (LSD) is a Python framework and DBMS for distributed storage, cross-matching and querying of large survey catalogs (>10^9 rows, >1 TB). The primary driver behind its development is the analysis of Pan-STARRS PS1 data. It is specifically optimized for fast queries and parallel sweeps of positionally and temporally indexed datasets. It transparently scales to more than >10^2 nodes, and can be made to function in "shared nothing" architectures.
African Journals Online (AJOL)
A single product perishing inventory model with demand interaction · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VSS Yadavalli, CdeW van Schoor, JJ Strasheim, S Udayabaskaran, 109-124. http://dx.doi.org/10.5784/20-2-10 ...
Biological phosphorus removal from dairy wastewater by alternating ...
African Journals Online (AJOL)
cl
2012-06-07
Jun 7, 2012 ... HRT from 1 to 2 h and decreases to 1.28 mgP/g VSS for a time of 3 h using acetic acid. Similarly, this .... a maximum obtained after 4 h of anaerobic reaction, using acetic .... removal during short term experiments, whereas.
Xue, Jianliang; Wu, Yanan; Liu, Zhixiu; Li, Menglu; Sun, Xiyu; Wang, Huajun; Liu, Bing
2017-08-17
Oil spill has led to severe environmental and ecological problems. Due to the harsh environmental conditions, the bioremediation technology is not successfully used to remedy the oil spill in marine environment. In this study, immobilization technology was used to immobilize bacteria on natural organic carriers (i.e., wood chips and maize straw). The higher surface area of in wood chips leads to larger biomass density (0.0242 gVSS/g) than that of maize straw of 0.0097 gVSS/g carrier. Compared with biodegradation efficiency of free bacteria (44.79%), the immobilized bacteria on wood chips and maize straw reached to 73.39% and 52.28%, respectively. The high biological activity of the immobilized bacteria can be also explained by nutrients, such as TN (total nitrogen) and TP (total phosphorus), released from wood chips and maize straw, which was 8.83 mg/g and 5.53 mg/g, 0.0624 mg/g and 0.0099 mg/g, respectively.
Akobi, Chinaza; Hafez, Hisham; Nakhla, George
2016-12-01
This study evaluated the impact of furfural (a furan derivative) on hydrogen production rates and yields at initial substrate-to-microorganism ratios (S°/X°) of 4, 2, 1, and 0.5gCOD/gVSS and furfural concentrations of 4, 2, 1, and 0.5g/L. Fermentation studies were carried out in batches using synthetic lignocellulosic hydrolysate as substrate and mesophilic anaerobic digester sludge as seed. Contrary to other literature studies where furfural was inhibitory, this study showed that furfural concentrations of up to 1g/L enhanced hydrogen production with yields as high as 19% from the control (batch without furfural). Plots of hydrogen yields against gfurfural/gsugars and hydrogen yields versus gfurfural/gbiomass showed negative linear correlation indicating that these parameters influence biohydrogen production. Regression analysis indicated that gfurfural/gsugars initial exerted a greater effect on the degree of inhibition of hydrogen production than gfurfural/gVSS final . Copyright © 2016 Elsevier Ltd. All rights reserved.
A novel lost packets recovery scheme based on visual secret sharing
Lu, Kun; Shan, Hong; Li, Zhi; Niu, Zhao
2017-08-01
In this paper, a novel lost packets recovery scheme which encrypts the effective parts of an original packet into two shadow packets based on (2, 2)-threshold XOR-based visual Secret Sharing (VSS) is proposed. The two shadow packets used as watermarks would be embedded into two normal data packets with digital watermarking embedding technology and then sent from one sensor node to another. Each shadow packet would reveal no information of the original packet, which can improve the security of original packet delivery greatly. The two shadow packets which can be extracted from the received two normal data packets delivered from a sensor node can recover the original packet lossless based on XOR-based VSS. The Performance analysis present that the proposed scheme provides essential services as long as possible in the presence of selective forwarding attack. The proposed scheme would not increase the amount of additional traffic, namely, lower energy consumption, which is suitable for Wireless Sensor Network (WSN).
Rules of song development and their use in vocal interactions by birds with large repertoires
Directory of Open Access Journals (Sweden)
Nicole Geberzahn
2004-06-01
Full Text Available Songbirds are well known for settling their disputes by vocal signals, and their singing plays a dominant role. Most studies on this issue have concentrated on bird species that develop and use small vocal repertoires. In this article we will go farther and focus on examples of how species with large song repertoires make use of their vocal competence. In particular, we will outline the study of interaction rules which have been elucidated by examining time- and pattern-specific relationships between signals exchanged by territorial neighbors. First we present an inquiry into the rules of song learning and development. In birds with large song repertoires, the ontogeny of such rules proceeds along a number of trajectories which help in understanding the often remarkable accomplishments of adult birds. In both approaches, our model species will be the Common Nightingale Luscinia megarhynchos that has been investigated intensively in the field and in the laboratory.Pássaros canoros são bem conhecidos por resolver suas brigas através de sinais vocais e seu canto tem um papel dominante. A maioria dos estudos sobre este assunto focalizou espécies de aves que desenvolvem e usam repertórios vocais pequenos. Neste artigo iremos mais longe, examinando como espécies com grandes repertórios fazem uso de suas capacidades. Descreveremos particularmente o estudo das regras de interação que foram desvendadas pelo exame das relações temporais e estruturais entre os sinais trocados por vizinhos. Inicialmente, investigamos as regras de aprendizagem e desenvolvimento do canto. Nas aves com grande repertório vocal, a ontogênese dessas regras segue certas trajetórias que ajudam a entender o desempenho dos adultos, geralmente notável. Em ambas abordagens, nossa espécie-modelo será o Rouxinol-comum Luscinia megarhynchos, que foi pesquisado intensamente no campo e no laboratório.
Development of large scale fusion plasma simulation and storage grid on JAERI Origin3800 system
International Nuclear Information System (INIS)
Idomura, Yasuhiro; Wang, Xin
2003-01-01
Under the Numerical EXperiment of Tokamak (NEXT) research project, various fluid, particle, and hybrid codes have been developed. These codes require a computational environment which consists of high performance processors, high speed storage system, and high speed parallelized visualization system. In this paper, the performance of the JAERI Origin3800 system is examined from a point of view of these requests. In the performance tests, it is shown that the representative particle and fluid codes operate with 15 - 40% of processing efficiency up to 512 processors. A storage area network (SAN) provides high speed parallel data transfer. A parallel visualization system enables order to magnitude faster visualization of a large scale simulation data compared with the previous graphic workstations. Accordingly, an extremely advanced simulation environment is realized on the JAERI Origin3800 system. Recently, development of a storage grid is underway in order to improve a computational environment of remote users. The storage grid is constructed by a combination of SAN and a wavelength division multiplexer (WDM). The preliminary tests show that compared with the existing data transfer methods, it enables dramatically high speed data transfer ∼100 Gbps over a wide area network. (author)
Large Data Visualization with Open-Source Tools
CERN. Geneva
2015-01-01
Visualization and post-processing of large data have become increasingly challenging and require more and more tools to support the diversity of data to process. In this seminar, we will present a suite of open-source tools supported and developed by Kitware to perform large-scale data visualization and analysis. In particular, we will present ParaView, an open-source tool for parallel visualization of massive datasets, the Visualization Toolkit (VTK), an open-source toolkit for scientific visualization, and Tangelohub, a suite of tools for large data analytics. About the speaker Julien Jomier is directing Kitware's European subsidiary in Lyon, France, where he focuses on European business development. Julien works on a variety of projects in the areas of parallel and distributed computing, mobile computing, image processing, and visualization. He is one of the developers of the Insight Toolkit (ITK), the Visualization Toolkit (VTK), and ParaView. Julien is also leading the CDash project, an open-source co...
Development of a vacuum leak test method for large-scale superconducting magnet test facilities
International Nuclear Information System (INIS)
Kawano, Katsumi; Hamada, Kazuya; Okuno, Kiyoshi; Kato, Takashi
2006-01-01
Japan Atomic Energy Agency (JAEA) has developed leak detection technology for liquid helium temperature experiments in large-scale superconducting magnet test facilities. In JAEA, a cryosorption pump that uses an absorbent cooled by liquid nitrogen with a conventional helium leak detector, is used to detect helium gas that is leaking from pressurized welded joints of pipes and valves in a vacuum chamber. The cryosorption pump plays the role of decreasing aerial components, such as water, nitrogen and oxygen, to increase the sensitivity of helium leak detection. The established detection sensitivity for helium leak testing is 10 -10 to 10 -9 Pam 3 /s. A total of 850 welded and mechanical joints inside the cryogenic test facility for the ITER Central Solenoid Model Coil (CSMC) experiments have been tested. In the test facility, 73 units of glass fiber-reinforced plastic (GFRP) insulation break are used. The amount of helium permeation through the GFRP was recorded during helium leak testing. To distinguish helium leaks from insulation-break permeation, the helium permeation characteristic of the GFRP part was measured as a function of the time of helium charging. Helium permeation was absorbed at 6 h after helium charging, and the detected permeation is around 10 -7 Pam 3 /s. Using the helium leak test method developed, CSMC experiments have been successfully completed. (author)
Noise in large cities in Brazil
Gerges, Samir N. Y.
2004-05-01
Large cities' noise is considered by the World Health Organization to be the third most hazardous pollution, preceded by air and water pollution. In urban centers, in general, and especially in developing countries such as Brazil, large populations are affected by excessive noise due mainly to traffic flow. The Brazilian Federal Government specifies noise limits, but each state can enforce its own set of noise limits, providing they are lower. The rapid economic growth, together with large migration of northern Brazilians to the developing southern urban areas in search of more lucrative jobs in construction and industrial sectors, resulted in a fast increase in activities such as vehicle and bus traffic, home construction, and development of all necessary infrastructures to support this growth. Urban noise in Brazil has been receiving the attention of national authorities only since 1990, when the Federal Government approved the first ``Program of Community Silence,'' based on ISO R 1996-1971. This paper highlights the noise situation in the five largest and most populated cities in Brazil: Sao Paulo, Rio de Janeiro, Belo Horizonte, Porto Alegre and Curitiba [Zannin et al., Appl. Acoust. 63, 351-358 (2002)].
Large natural geophysical events: planetary planning
International Nuclear Information System (INIS)
Knox, J.B.; Smith, J.V.
1984-09-01
Geological and geophysical data suggest that during the evolution of the earth and its species, that there have been many mass extinctions due to large impacts from comets and large asteroids, and major volcanic events. Today, technology has developed to the stage where we can begin to consider protective measures for the planet. Evidence of the ecological disruption and frequency of these major events is presented. Surveillance and warning systems are most critical to develop wherein sufficient lead times for warnings exist so that appropriate interventions could be designed. The long term research undergirding these warning systems, implementation, and proof testing is rich in opportunities for collaboration for peace
Development of N+ in P pixel sensors for a high-luminosity large hadron collider
Kamada, Shintaro; Yamamura, Kazuhisa; Unno, Yoshinobu; Ikegami, Yoichi
2014-11-01
Hamamatsu Photonics K. K. is developing an N+ in a p planar pixel sensor with high radiation tolerance for the high-luminosity large hadron collider (HL-LHC). The N+ in the p planar pixel sensor is a candidate for the HL-LHC and offers the advantages of high radiation tolerance at a reasonable price compared with the N+ in an n planar sensor, the three-dimensional sensor, and the diamond sensor. However, the N+ in the p planar pixel sensor still presents some problems that need to be solved, such as its slim edge and the danger of sparks between the sensor and readout integrated circuit. We are now attempting to solve these problems with wafer-level processes, which is important for mass production. To date, we have obtained a 250-μm edge with an applied bias voltage of 1000 V. To protect against high-voltage sparks from the edge, we suggest some possible designs for the N+ edge.
Kinetic and stoichiometric modelling of acidogenic fermentation of glucose and fructose
International Nuclear Information System (INIS)
Fernandez, F.J.; Villasenor, J.; Infantes, D.
2011-01-01
In this work, a model based on Monod equation for the description of the acidogenic fermentation of glucose and fructose as the main substrates contained in the winery wastewater was developed. The data used for calibration and validation of the model parameters were obtained from an acidogenic mixed culture fermenting glucose and fructose in a batch reactor at 35 o C and pH 5. The calibrated model accurately describes the experimental results from biomass growth, substrate consumption and fermentation products generation. The results showed that the microorganisms growth rate and biomass yield were higher when glucose was used as substrate: μ max-Glucose = 0.163 h -1 , μ max-Fructose = 0.108 h -1 , Y x-Glucose = 0.027 g VSS per mmol Glucose and Y x-Fructose 0.017 g VSS per mmol Fructose. Regarding to the fermentation products, the acetic acid was the main fermentation product obtained in both fermentations, followed by lactic and butyric acid. Comparing glucose and fructose fermentations, the main difference was the yield of butyric acid in both fermentations, 0.249 mol per mol Glucose and 0.131 mol per mol Fructose since the other acids concentration were quite similar. In the case of the H 2 production, it was 0.76 mol H 2 per mol Glucose while 0.85 was the yield in fructose fermentation. -- Highlights: → Acidogenic fermentation of glucose and fructose was studied. → A model describing the kinetics and stoichiometry of the fermentation was developed. → The model developed predicted accurately the substrate, products and biomass profiles along the fermentation process. → The microorganisms growth rate was higher in the glucose fermentation. → The fructose fermentation presented higher hydrogen yields.
Physiologically Based Pharmacokinetic Model for Terbinafine in Rats and Humans
Hosseini-Yeganeh, Mahboubeh; McLachlan, Andrew J.
2002-01-01
The aim of this study was to develop a physiologically based pharmacokinetic (PB-PK) model capable of describing and predicting terbinafine concentrations in plasma and tissues in rats and humans. A PB-PK model consisting of 12 tissue and 2 blood compartments was developed using concentration-time data for tissues from rats (n = 33) after intravenous bolus administration of terbinafine (6 mg/kg of body weight). It was assumed that all tissues except skin and testis tissues were well-stirred compartments with perfusion rate limitations. The uptake of terbinafine into skin and testis tissues was described by a PB-PK model which incorporates a membrane permeability rate limitation. The concentration-time data for terbinafine in human plasma and tissues were predicted by use of a scaled-up PB-PK model, which took oral absorption into consideration. The predictions obtained from the global PB-PK model for the concentration-time profile of terbinafine in human plasma and tissues were in close agreement with the observed concentration data for rats. The scaled-up PB-PK model provided an excellent prediction of published terbinafine concentration-time data obtained after the administration of single and multiple oral doses in humans. The estimated volume of distribution at steady state (Vss) obtained from the PB-PK model agreed with the reported value of 11 liters/kg. The apparent volume of distribution of terbinafine in skin and adipose tissues accounted for 41 and 52%, respectively, of the Vss for humans, indicating that uptake into and redistribution from these tissues dominate the pharmacokinetic profile of terbinafine. The PB-PK model developed in this study was capable of accurately predicting the plasma and tissue terbinafine concentrations in both rats and humans and provides insight into the physiological factors that determine terbinafine disposition. PMID:12069977
Large-D gravity and low-D strings.
Emparan, Roberto; Grumiller, Daniel; Tanabe, Kentaro
2013-06-21
We show that in the limit of a large number of dimensions a wide class of nonextremal neutral black holes has a universal near-horizon limit. The limiting geometry is the two-dimensional black hole of string theory with a two-dimensional target space. Its conformal symmetry explains the properties of massless scalars found recently in the large-D limit. For black branes with string charges, the near-horizon geometry is that of the three-dimensional black strings of Horne and Horowitz. The analogies between the α' expansion in string theory and the large-D expansion in gravity suggest a possible effective string description of the large-D limit of black holes. We comment on applications to several subjects, in particular to the problem of critical collapse.
Large-scale multimedia modeling applications
International Nuclear Information System (INIS)
Droppo, J.G. Jr.; Buck, J.W.; Whelan, G.; Strenge, D.L.; Castleton, K.J.; Gelston, G.M.
1995-08-01
Over the past decade, the US Department of Energy (DOE) and other agencies have faced increasing scrutiny for a wide range of environmental issues related to past and current practices. A number of large-scale applications have been undertaken that required analysis of large numbers of potential environmental issues over a wide range of environmental conditions and contaminants. Several of these applications, referred to here as large-scale applications, have addressed long-term public health risks using a holistic approach for assessing impacts from potential waterborne and airborne transport pathways. Multimedia models such as the Multimedia Environmental Pollutant Assessment System (MEPAS) were designed for use in such applications. MEPAS integrates radioactive and hazardous contaminants impact computations for major exposure routes via air, surface water, ground water, and overland flow transport. A number of large-scale applications of MEPAS have been conducted to assess various endpoints for environmental and human health impacts. These applications are described in terms of lessons learned in the development of an effective approach for large-scale applications
Large-scale cryopumping for controlled fusion
International Nuclear Information System (INIS)
Pittenger, L.C.
1977-01-01
Vacuum pumping by freezing out or otherwise immobilizing the pumped gas is an old concept. In several plasma physics experiments for controlled fusion research, cryopumping has been used to provide clean, ultrahigh vacua. Present day fusion research devices, which rely almost universally upon neutral beams for heating, are high gas throughput systems, the pumping of which is best accomplished by cryopumping in the high mass-flow, moderate-to-high vacuum regime. Cryopumping systems have been developed for neutral beam injection systems on several fusion experiments (HVTS, TFTR) and are being developed for the overall pumping of a large, high-throughput mirror containment experiment (MFTF). In operation, these large cryopumps will require periodic defrosting, some schemes for which are discussed, along with other operational considerations. The development of cryopumps for fusion reactors is begun with the TFTR and MFTF systems. Likely paths for necessary further development for power-producing reactors are also discussed
Large-scale cryopumping for controlled fusion
Energy Technology Data Exchange (ETDEWEB)
Pittenger, L.C.
1977-07-25
Vacuum pumping by freezing out or otherwise immobilizing the pumped gas is an old concept. In several plasma physics experiments for controlled fusion research, cryopumping has been used to provide clean, ultrahigh vacua. Present day fusion research devices, which rely almost universally upon neutral beams for heating, are high gas throughput systems, the pumping of which is best accomplished by cryopumping in the high mass-flow, moderate-to-high vacuum regime. Cryopumping systems have been developed for neutral beam injection systems on several fusion experiments (HVTS, TFTR) and are being developed for the overall pumping of a large, high-throughput mirror containment experiment (MFTF). In operation, these large cryopumps will require periodic defrosting, some schemes for which are discussed, along with other operational considerations. The development of cryopumps for fusion reactors is begun with the TFTR and MFTF systems. Likely paths for necessary further development for power-producing reactors are also discussed.
Workflow management in large distributed systems
International Nuclear Information System (INIS)
Legrand, I; Newman, H; Voicu, R; Dobre, C; Grigoras, C
2011-01-01
The MonALISA (Monitoring Agents using a Large Integrated Services Architecture) framework provides a distributed service system capable of controlling and optimizing large-scale, data-intensive applications. An essential part of managing large-scale, distributed data-processing facilities is a monitoring system for computing facilities, storage, networks, and the very large number of applications running on these systems in near realtime. All this monitoring information gathered for all the subsystems is essential for developing the required higher-level services—the components that provide decision support and some degree of automated decisions—and for maintaining and optimizing workflow in large-scale distributed systems. These management and global optimization functions are performed by higher-level agent-based services. We present several applications of MonALISA's higher-level services including optimized dynamic routing, control, data-transfer scheduling, distributed job scheduling, dynamic allocation of storage resource to running jobs and automated management of remote services among a large set of grid facilities.
Workflow management in large distributed systems
Legrand, I.; Newman, H.; Voicu, R.; Dobre, C.; Grigoras, C.
2011-12-01
The MonALISA (Monitoring Agents using a Large Integrated Services Architecture) framework provides a distributed service system capable of controlling and optimizing large-scale, data-intensive applications. An essential part of managing large-scale, distributed data-processing facilities is a monitoring system for computing facilities, storage, networks, and the very large number of applications running on these systems in near realtime. All this monitoring information gathered for all the subsystems is essential for developing the required higher-level services—the components that provide decision support and some degree of automated decisions—and for maintaining and optimizing workflow in large-scale distributed systems. These management and global optimization functions are performed by higher-level agent-based services. We present several applications of MonALISA's higher-level services including optimized dynamic routing, control, data-transfer scheduling, distributed job scheduling, dynamic allocation of storage resource to running jobs and automated management of remote services among a large set of grid facilities.
Directory of Open Access Journals (Sweden)
Jialong Jiao
2017-10-01
Full Text Available Wave-induced motion and load responses are important criteria for ship performance evaluation. Physical experiments have long been an indispensable tool in the predictions of ship’s navigation state, speed, motions, accelerations, sectional loads and wave impact pressure. Currently, majority of the experiments are conducted in laboratory tank environment, where the wave environments are different from the realistic sea waves. In this paper, a laboratory tank testing system for ship motions and loads measurement is reviewed and reported first. Then, a novel large-scale model measurement technique is developed based on the laboratory testing foundations to obtain accurate motion and load responses of ships in realistic sea conditions. For this purpose, a suite of advanced remote control and telemetry experimental system was developed in-house to allow for the implementation of large-scale model seakeeping measurement at sea. The experimental system includes a series of technique sensors, e.g., the Global Position System/Inertial Navigation System (GPS/INS module, course top, optical fiber sensors, strain gauges, pressure sensors and accelerometers. The developed measurement system was tested by field experiments in coastal seas, which indicates that the proposed large-scale model testing scheme is capable and feasible. Meaningful data including ocean environment parameters, ship navigation state, motions and loads were obtained through the sea trial campaign.
Hollow-fiber membrane bioreactor for the treatment of high-strength landfill leachate
Rizkallah, Marwan; El-Fadel, Mutasem E.; Saikaly, Pascal; Ayoub, George M.; Darwiche, Nadine D.; Hashisho, Jihan
2013-01-01
-fiber MBR. For this purpose, a laboratory-scale MBR was constructed and operated to treat leachate with a chemical oxygen demand (COD) of 9000-11,000 mg/l, a 5-day biochemical oxygen demand (BOD5) of 4000-6,000 mg/l, volatile suspended solids (VSS) of 300
Nickelson, Jen; Alfonso, Moya L.; McDermott, Robert J.; Bumpus, Elizabeth C.; Bryant, Carol A.; Baldwin, Julie A.
2011-01-01
Creating community-based opportunities for youth to be physically active is challenging for many municipalities. A Lexington, Kentucky community coalition designed and piloted a physical activity program, "VERB[TM] summer scorecard (VSS)", leveraging the brand equity of the national VERB[TM]--It's What You Do! campaign. Key elements of…
Probes of large-scale structure in the Universe
International Nuclear Information System (INIS)
Suto, Yasushi; Gorski, K.; Juszkiewicz, R.; Silk, J.
1988-01-01
Recent progress in observational techniques has made it possible to confront quantitatively various models for the large-scale structure of the Universe with detailed observational data. We develop a general formalism to show that the gravitational instability theory for the origin of large-scale structure is now capable of critically confronting observational results on cosmic microwave background radiation angular anisotropies, large-scale bulk motions and large-scale clumpiness in the galaxy counts. (author)
Hirche, C; Senghaas, A; Fischer, S; Hollenbeck, S T; Kremer, T; Kneser, U
2016-02-01
Long-term function following severe burns to the hand may be poor secondary to scar adhesions to the underlying tendons, webspaces, and joints. In this pilot study, we report the feasibility of applying a pasty dermal matrix combined with percutaneous cannula teno- and adhesiolysis. In this 6 month follow-up pilot study, we included eight hands in five patients with hand burns undergoing minimal-invasive, percutaneous cannula adhesiolysis and injection of INTEGRA™ Flowable Wound Matrix for a pilot study of this new concept. The flowable collagen-glycosaminoglycan wound matrix (FCGWM) was applied with a buttoned 2mm cannula to induce formation of a neo-gliding plane. Post treatment follow-up was performed to assess active range of motion (AROM), grip strength, Disabilities of the Arm, Shoulder and Hand (DASH) score, Vancouver Scar Scale (VSS) and quality of life Short-Form (SF)-36 questionnaire. No complications were detected associated with the treatment of FCGWM injection. The mean improvement (AROM) at 6 months was 30.6° for digits 2-5. The improvement in the DASH score was a mean of 9 points out of 100. The VSS improved by a mean of 2 points out of 14. The study demonstrates the feasibility and safety of percutaneous FCGWM for dermal augmentation after burn. Results from this pilot study show improvements in AROM for digits 2-5, functional scores from the patient's perspective (DASH) and scar quality (VSS). The flowable form of established INTEGRA™ wound matrix offers the advantage of minimal-invasive injection after scar release in the post-burned hand with a reduction in the risk of postsurgical re-scarring. Copyright © 2015 Elsevier Ltd and ISBI. All rights reserved.
Gao, Chunsheng; Xin, Pengfei; Cheng, Chaohua; Tang, Qing; Chen, Ping; Wang, Changbiao; Zang, Gonggu; Zhao, Lining
2014-01-01
Cannabis sativa L. is an important economic plant for the production of food, fiber, oils, and intoxicants. However, lack of sufficient simple sequence repeat (SSR) markers has limited the development of cannabis genetic research. Here, large-scale development of expressed sequence tag simple sequence repeat (EST-SSR) markers was performed to obtain more informative genetic markers, and to assess genetic diversity in cannabis (Cannabis sativa L.). Based on the cannabis transcriptome, 4,577 SSRs were identified from 3,624 ESTs. From there, a total of 3,442 complementary primer pairs were designed as SSR markers. Among these markers, trinucleotide repeat motifs (50.99%) were the most abundant, followed by hexanucleotide (25.13%), dinucleotide (16.34%), tetranucloetide (3.8%), and pentanucleotide (3.74%) repeat motifs, respectively. The AAG/CTT trinucleotide repeat (17.96%) was the most abundant motif detected in the SSRs. One hundred and seventeen EST-SSR markers were randomly selected to evaluate primer quality in 24 cannabis varieties. Among these 117 markers, 108 (92.31%) were successfully amplified and 87 (74.36%) were polymorphic. Forty-five polymorphic primer pairs were selected to evaluate genetic diversity and relatedness among the 115 cannabis genotypes. The results showed that 115 varieties could be divided into 4 groups primarily based on geography: Northern China, Europe, Central China, and Southern China. Moreover, the coefficient of similarity when comparing cannabis from Northern China with the European group cannabis was higher than that when comparing with cannabis from the other two groups, owing to a similar climate. This study outlines the first large-scale development of SSR markers for cannabis. These data may serve as a foundation for the development of genetic linkage, quantitative trait loci mapping, and marker-assisted breeding of cannabis.
Mohammed, Ali Ibrahim Ali
The understanding and treatment of brain disorders as well as the development of intelligent machines is hampered by the lack of knowledge of how the brain fundamentally functions. Over the past century, we have learned much about how individual neurons and neural networks behave, however new tools are critically needed to interrogate how neural networks give rise to complex brain processes and disease conditions. Recent innovations in molecular techniques, such as optogenetics, have enabled neuroscientists unprecedented precision to excite, inhibit and record defined neurons. The impressive sensitivity of currently available optogenetic sensors and actuators has now enabled the possibility of analyzing a large number of individual neurons in the brains of behaving animals. To promote the use of these optogenetic tools, this thesis integrates cutting edge optogenetic molecular sensors which is ultrasensitive for imaging neuronal activity with custom wide field optical microscope to analyze a large number of individual neurons in living brains. Wide-field microscopy provides a large field of view and better spatial resolution approaching the Abbe diffraction limit of fluorescent microscope. To demonstrate the advantages of this optical platform, we imaged a deep brain structure, the Hippocampus, and tracked hundreds of neurons over time while mouse was performing a memory task to investigate how those individual neurons related to behavior. In addition, we tested our optical platform in investigating transient neural network changes upon mechanical perturbation related to blast injuries. In this experiment, all blasted mice show a consistent change in neural network. A small portion of neurons showed a sustained calcium increase for an extended period of time, whereas the majority lost their activities. Finally, using optogenetic silencer to control selective motor cortex neurons, we examined their contributions to the network pathology of basal ganglia related to
Using Agent Base Models to Optimize Large Scale Network for Large System Inventories
Shameldin, Ramez Ahmed; Bowling, Shannon R.
2010-01-01
The aim of this paper is to use Agent Base Models (ABM) to optimize large scale network handling capabilities for large system inventories and to implement strategies for the purpose of reducing capital expenses. The models used in this paper either use computational algorithms or procedure implementations developed by Matlab to simulate agent based models in a principal programming language and mathematical theory using clusters, these clusters work as a high performance computational performance to run the program in parallel computational. In both cases, a model is defined as compilation of a set of structures and processes assumed to underlie the behavior of a network system.
Assessing the role of energy in development and climate policies in large developing countries
Energy Technology Data Exchange (ETDEWEB)
Garg, A.; Halsnaes, K. [UNEP Risoe Centre (Denmark)
2007-05-15
The paper discusses a number of key conceptual issues related to the role of energy in development and its potential synergies and tradeoffs with climate change. The relationship between economic development and energy over time is discussed and illustrated by data from Brazil, China, India and South Africa. It is concluded that energy plays an important role as a productivity enhancing factor in economic development and in human well being and several policy goals related to sustainable development (SD), energy and climate can be integrated. However, meeting all these policy goals requires a special effort and can imply costs. An analytical approach that can be used to assess development, energy and climate policies is introduced and empirical indicators of Sustainable development trends for the period 2000-2030 are presented. In a pragmatic way, it is proposed to use indicators of economic, social, and environmental SD dimensions such as costs, employment generation, energy access, local and global emissions, income distribution, and local participation in the evaluation of specific policies. The approach is developed and tested as part of the Development, Energy, and Climate project which is international project cooperation between the UNEP Risoe Centre and teams in Brazil, China, India and South Africa. The results demonstrate that there is a huge potential for energy efficiency improvements in the energy systems in these countries and thereby cost savings and reduced emissions intensity. However, the implied greenhouse gas emissions depend on fuel and technology compositions and reduction will imply that specific policies are put in place. (au)
Assessing the role of energy in development and climate policies in large developing countries
International Nuclear Information System (INIS)
Garg, A.; Halsnaes, K.
2007-01-01
The paper discusses a number of key conceptual issues related to the role of energy in development and its potential synergies and tradeoffs with climate change. The relationship between economic development and energy over time is discussed and illustrated by data from Brazil, China, India and South Africa. It is concluded that energy plays an important role as a productivity enhancing factor in economic development and in human well being and several policy goals related to sustainable development (SD), energy and climate can be integrated. However, meeting all these policy goals requires a special effort and can imply costs. An analytical approach that can be used to assess development, energy and climate policies is introduced and empirical indicators of Sustainable development trends for the period 2000-2030 are presented. In a pragmatic way, it is proposed to use indicators of economic, social, and environmental SD dimensions such as costs, employment generation, energy access, local and global emissions, income distribution, and local participation in the evaluation of specific policies. The approach is developed and tested as part of the Development, Energy, and Climate project which is international project cooperation between the UNEP Risoe Centre and teams in Brazil, China, India and South Africa. The results demonstrate that there is a huge potential for energy efficiency improvements in the energy systems in these countries and thereby cost savings and reduced emissions intensity. However, the implied greenhouse gas emissions depend on fuel and technology compositions and reduction will imply that specific policies are put in place. (au)
Large aperture optical switching devices
International Nuclear Information System (INIS)
Goldhar, J.; Henesian, M.A.
1983-01-01
We have developed a new approach to constructing large aperture optical switches for next generation inertial confinement fusion lasers. A transparent plasma electrode formed in low pressure ionized gas acts as a conductive coating to allow the uniform charging of the optical faces of an electro-optic material. In this manner large electric fields can be applied longitudinally to large aperture, high aspect ratio Pockels cells. We propose a four-electrode geometry to create the necessary high conductivity plasma sheets, and have demonstrated fast (less than 10 nsec) switching in a 5x5 cm aperture KD*P Pockels cell with such a design. Detaid modelling of Pockels cell performance with plasma electrodes has been carried out for 15 and 30 cm aperture designs
Development of a Wind Plant Large-Eddy Simulation with Measurement-Driven Atmospheric Inflow
Energy Technology Data Exchange (ETDEWEB)
Quon, Eliot W.; Churchfield, Matthew J.; Cheung, Lawrence; Kern, Stefan
2017-01-09
This paper details the development of an aeroelastic wind plant model with large-eddy simulation (LES). The chosen LES solver is the Simulator for Wind Farm Applications (SOWFA) based on the OpenFOAM framework, coupled to NREL's comprehensive aeroelastic analysis tool, FAST. An atmospheric boundary layer (ABL) precursor simulation was constructed based on assessments of meteorological tower, lidar, and radar data over a 3-hour window. This precursor was tuned to the specific atmospheric conditions that occurred both prior to and during the measurement campaign, enabling capture of a night-to-day transition in the turbulent ABL. In the absence of height-varying temperature measurements, spatially averaged radar data were sufficient to characterize the atmospheric stability of the wind plant in terms of the shear profile, and near-ground temperature sensors provided a reasonable estimate of the ground heating rate describing the morning transition. A full aeroelastic simulation was then performed for a subset of turbines within the wind plant, driven by the precursor. Analysis of two turbines within the array, one directly waked by the other, demonstrated good agreement with measured time-averaged loads.
Implementing Large Projects in Software Engineering Courses
Coppit, David
2006-01-01
In software engineering education, large projects are widely recognized as a useful way of exposing students to the real-world difficulties of team software development. But large projects are difficult to put into practice. First, educators rarely have additional time to manage software projects. Second, classrooms have inherent limitations that…
Tank Vapor Characterization Project: Annual status report for FY 1996
International Nuclear Information System (INIS)
Silvers, K.L.; Fruchter, J.S.; Huckaby, J.L.; Almeida, T.L.; Evans, J.C. Jr.; Pool, K.H.; Simonen, C.A.; Thornton, B.M.
1997-01-01
In Fiscal Year 1996, staff at the Vapor Analytical Laboratory at Pacific Northwest National Laboratory performed work in support of characterizing the vapor composition of the headspaces of radioactive waste tanks at the Hanford Site. Work performed included support for technical issues and sampling methodologies, upgrades for analytical equipment, analytical method development, preparation of unexposed samples, analyses of tank headspaces samples, preparation of data reports, and operation of the tank vapor database. Progress made in FY 1996 included completion and issuance of 50 analytical data reports. A sampling system comparison study was initiated and completed during the fiscal year. The comparison study involved the vapor sampling system (VSS), a truck-based system, and the in situ vapor sampling system (ISVS), a cart-based system. Samples collected during the study were characterized for inorganic, permanent gases, total non-methane organic compounds and organic speciation by SUMMA trademark and TST methods. The study showed comparable sampling results between the systems resulting in the program switching from the VSS to the less expensive ISVS methodology in late May 1996. A temporal study was initiated in January 1996 in order to understand the influences seasonal temperatures changes have on the vapors in the headspace of Hanford waste tanks. A holding time study was initiated in the fourth quarter of FY 1996. Samples were collected from tank S-102 and rushed to the laboratory for time zero analysis. Additional samples will be analyzed at 1, 2, 4, 8, 16, and 32 weeks
Foster-wittig, T. A.; Thoma, E.; Green, R.; Hater, G.; Swan, N.; Chanton, J.
2013-12-01
conditions). The trials tested a novel tracer gas (acetylene), chosen for its performance and cost characteristics. This presentation will summarize method development activities for the field test trials (107 test days, with repeat measurements at 14 separate landfill sites). In addition to a brief description of the measurement technology, the method performance will be described, and primary data quality indicators and use conditions will be explored. Because measurements were taken under daylight and a variety of atmospheric conditions, the range of distance and wind conditions allows us to make conclusions about the strengths and limitations of the method. This enables us to show when and where it is possible to make a quality measurement using this technique and therefore develop a standardized method for large area emission measurements. Green, R. et al (2010). 'Methane Emission Measured at Two California Landfills by OTM-10 and an Acetylene Tracer Method.' Global Waste Management Symposium. San Antonio, Texas. Scheutz, C. et al. (2011). 'Quantification of multiple methane emission sources at landfills using a double tracer technique." Waste Management 31(5): 1009-1017. Thoma, E., et al (2009). 'Development of EPA OTM 10 for landfill applications." Journal of Environmental Engineering 136(8): 769-776.
International Nuclear Information System (INIS)
Wetstein, Matthew
2011-01-01
Microchannel plate photomultiplier tubes (MCPs) are compact, imaging detectors, capable of micron-level spatial imaging and timing measurements with resolutions below 10 ps. Conventional fabrication methods are too expensive for making MCPs in the quantities and sizes necessary for typical HEP applications, such as time-of-flight ring-imaging Cherenkov detectors (TOF-RICH) or water Cherenkov-based neutrino experiments. The Large Area Picosecond Photodetector Collaboration (LAPPD) is developing new, commercializable methods to fabricate 20 cm 2 thin planar MCPs at costs comparable to those of traditional photo-multiplier tubes. Transmission-line readout with waveform sampling on both ends of each line allows the efficient coverage of large areas while maintaining excellent time and space resolution. Rather than fabricating channel plates from active, high secondary electron emission materials, we produce plates from passive substrates, and coat them using atomic layer deposition (ALD), a well established industrial batch process. In addition to possible reductions in cost and conditioning time, this allows greater control to optimize the composition of active materials for performance. We present details of the MCP fabrication method, preliminary results from testing and characterization facilities, and possible HEP applications.
Felgueiras, Rui; Magalhães, Rui; Correia, Manuel; Silva, Maria Carolina
2014-09-01
Vestibular symptoms (VSs) are frequent complaints in patients attending ambulatory care and the emergency room. They may represent a peripheral vestibular disorder or a stroke/transient ischemic attack (TIA), yet many patients have VSs that cannot be clearly classified at presentation. This study aims to characterize and determine the long-term prognosis of these patients. In a prospective community-based study involving 104,700 individuals registered at 4 health centers of Northern Portugal, patients with a first-ever-in-lifetime focal neurologic symptom (FNS) were ascertained using comprehensive methods, including referrals from physicians working in the study area and data retrieved from emergency/discharge records. Physicians were encouraged to report/notify any patient who might have experienced an FNS, including those with vertigo or vertigo-like symptoms, imbalance, presyncope, or nonspecific dizziness. After neurologic assessment patients were classified as having a peripheral vestibular symptom (pVS), a stroke/TIA, or an unclassified vestibular symptom (uVS). They were followed up 7 years after the index event at the outpatient clinic; predictors of survival free from stroke or vascular events were determined using Cox proportional hazards models. Of the 1163 patients with an FNS, 360 (31.0%) were included, 16.7% had a stroke/TIA, 57.8% had pVS, and 25.6% had uVS. Most patients presented only isolated VSs (62.8%); 63% were women and mean age was 60.1 years (standard deviation = 16); hypertension (47.8%), hypercholesterolemia (41.9%), and diabetes (19.2%) were the most prevalent vascular risk factors (VRFs). Cranial computed tomography (CT) scan was performed in 63.3%. Adjusting for age, sex, VRFs, and diagnosis (TIA, pVS and uVS), the long-term risk of stroke was higher when CT showed silent infarctions (hazard rate [HR] = 3.96; 95% confidence interval [CI], 1.63-9.60) and the risk of vascular events (stroke, myocardial infarction, or vascular death) was
International Nuclear Information System (INIS)
Wang, Jie; Li, Yongmei
2016-01-01
Highlights: • CaO_2/MW pretreatment synergistically enhanced WAS solubilization and CH_4 production. • MW irradiation facilitated more "·OH generation from CaO_2. • The optimal pretreatment condition for methane production was determined. • The growths of both hydrogenotrophic and acetate-utilizing methanogens were promoted. • The dewaterability of WAS was improved considerably by CaO_2/MW treatment. - Abstract: To investigate the effects of combined calcium peroxide (CaO_2) and microwave pretreatment on anaerobic digestion of waste activated sludge, lab-scale experiments were conducted to measure the solubilization, biodegradation, and dewaterability of the waste activated sludge. Additionally, the synergistic effects between CaO_2 and microwave were studied, and the microbial activity and methanogenic archaea community structure were analyzed. Combined pretreatment considerably facilitated the solubilization and subsequent anaerobic digestion of the waste activated sludge. The optimal pretreatment condition was CaO_2 (0.1 g/gVSS)/microwave (480 W, 2 min) for methane production during the subsequent anaerobic digestion process. Under this condition, 80.2% higher CH_4 accumulation yield was achieved after 16 d of anaerobic digestion when compared with the control. The synergistic effects of CaO_2/microwave pretreatment resulted from the different mechanisms of CaO_2 and microwave treatments. Further, microwave irradiation increased "·OH generation from CaO_2 and significantly alleviated the inhibitory effect of CaO_2 on methanogens. The activities of hydrolytic enzymes and acid-forming enzymes in the waste activated sludge were improved after CaO_2 (0.1 g/gVSS)/microwave (480 W, 2 min) pretreatment. Methanogenesis enzyme activity was also higher after CaO_2 treatment (0.1 g/gVSS)/microwave (480 W, 2 min) following a lag period. Illumina MiSeq sequencing analysis indicated that acetate-utilizing methanogen (Methanosaeta sp.) and H_2/CO_2-utilizing
Johnson, C. M.
1980-12-01
The growth of 100 kg of silicon single crystal material, ten cm in diameter or greater, and 150 kg of silicon single crystal material 15 cm or greater utilizing one common silicon container material (one crucible) is investigated. A crystal grower that is recharged with a new supply of polysilicon material while still under vacuum and at temperatures above the melting point of silicon is developed. It accepts large polysilicon charges up to 30 kg, grows large crystal ingots (to 15 cm diameter and 25 kg in weight), and holds polysilicon material for recharging (rod or lump) while, at the same time, growing crystal ingots. Special equipment is designed to recharge polysilicon rods, recharge polysilicon lumps, and handle and store large, hot silicon crystal ingots. Many continuous crystal growth runs were performed lasting as long as 109 hours and producing as many as ten crystal ingots, 15 cm with weights progressing to 27 kg.
Commercial applications of large-scale Research and Development computer simulation technologies
International Nuclear Information System (INIS)
Kuok Mee Ling; Pascal Chen; Wen Ho Lee
1998-01-01
The potential commercial applications of two large-scale R and D computer simulation technologies are presented. One such technology is based on the numerical solution of the hydrodynamics equations, and is embodied in the two-dimensional Eulerian code EULE2D, which solves the hydrodynamic equations with various models for the equation of state (EOS), constitutive relations and fracture mechanics. EULE2D is an R and D code originally developed to design and analyze conventional munitions for anti-armor penetrations such as shaped charges, explosive formed projectiles, and kinetic energy rods. Simulated results agree very well with actual experiments. A commercial application presented here is the design and simulation of shaped charges for oil and gas well bore perforation. The other R and D simulation technology is based on the numerical solution of Maxwell's partial differential equations of electromagnetics in space and time, and is implemented in the three-dimensional code FDTD-SPICE, which solves Maxwell's equations in the time domain with finite-differences in the three spatial dimensions and calls SPICE for information when nonlinear active devices are involved. The FDTD method has been used in the radar cross-section modeling of military aircrafts and many other electromagnetic phenomena. The coupling of FDTD method with SPICE, a popular circuit and device simulation program, provides a powerful tool for the simulation and design of microwave and millimeter-wave circuits containing nonlinear active semiconductor devices. A commercial application of FDTD-SPICE presented here is the simulation of a two-element active antenna system. The simulation results and the experimental measurements are in excellent agreement. (Author)
International Nuclear Information System (INIS)
Waal, H.S. de.
1989-05-01
The public acceptability of large technological developments was studied. A socio-economic baseline profile of the community was compiled in an attempt to measure the inherent ability of a community to adjust to changes brought about by large developments. The framework within which the study was conducted included the demographic composition, the economic activity, the infrastructure of the private and public sectors, the organisational composition of the community, the expectations members of the community had in respect of the possible developments, the attitudes of the community towards itself, as well as towards outsiders and finally, the degree of solidarity that exists amongst them in respect of these attitudes. With information regarding the intended developments, certain extrapolations were made in respect of possible tendencies and changes that may come about in the demographic composition of the community. In the light of these predictions certain potential future problems were identified and pre-emptive recommendations were made accordingly. Of the most important observations that can be made is the fact that the methods used were adequate to achieve a detailed baseline profile of the community, its qualities, attitudes and expectations. The detail was sufficient to enable the researcher to compare the communities living in the different residential areas. Information gathered from interviews with leading figures turned out to be a useful tool in the verification of data gathered by way of questionnaires. 71 figs., 110 tabs., 176 refs
International Nuclear Information System (INIS)
Beau, J.C.
1993-01-01
France offers particularly favourable conditions for the further development and the market introduction of electric vehicles: On account of the electricity production with almost no exhaust emission and due to the concentrated population structure stemming from the historical background in densely populated historical towns up to the innovational, electrochemical and electrotechnical industries and last but not least the automotive industry itself. The article is structured as follows: A) Political measures, large scale experiments in France; B) Strategy of PSA Peugeot Citroen; C) Activities by Peugeot in Germany. (orig.) [de
Directory of Open Access Journals (Sweden)
Tiago Santana Balbuena
2012-06-01
Full Text Available Equisetum hyemale is a widespread vascular plant species, whose reproduction is mainly dependent on the growth and development of the rhizomes. Due to its key evolutionary position, the identification of factors that could be involved in the existence of the rhizomatous trait may contribute to a better understanding of the role of this underground organ for the successful propagation of this and other plant species. In the present work, we characterized the proteome of E. hyemale rhizomes using a GeLC-MS spectral-counting proteomics strategy. A total of 1,911 and 1,860 non-redundant proteins were identified in the rhizomes apical tip and elongation zone, respectively. Rhizome- characteristic proteins were determined by comparisons of the developing rhizome tissues to developing roots. A total of 87 proteins were found to be up-regulated in both E. hyemale rhizome tissues in relation to developing roots. Hierarchical clustering indicated a vast dynamic range in the expression of the 87 characteristic proteins and revealed, based on the expression profile, the existence of 9 major protein groups. Gene ontology analyses suggested an over-representation of the terms involved in macromolecular and protein biosynthetic processes, gene expression and nucleotide and protein binding functions. Spatial differences analysis between the rhizome apical tip and the elongation zone revealed that only eight proteins were up-regulated in the apical tip including RNA-binding proteins and an acyl carrier protein, as well as a KH-domain protein and a T-complex subunit; while only seven proteins were up-regulated in the elongation zone including phosphomannomutase, galactomannan galactosyltransferase, endoglucanase 10 and 25 and mannose-1-phosphate guanyltransferase subunits alpha and beta. This is the first large scale characterization of the proteome of a plant rhizome. Implications of the findings were discussed in relation to other underground organs and related
Larson, Gregg S; Carey, Cate; Grarup, Jesper; Hudson, Fleur; Sachi, Karen; Vjecha, Michael J; Gordin, Fred
2016-04-01
Randomized clinical trials are widely recognized as essential to address worldwide clinical and public health research questions. However, their size and duration can overwhelm available public and private resources. To remain competitive in international research settings, advocates and practitioners of clinical trials must implement practices that reduce their cost. We identify approaches and practices for large, publicly funded, international trials that reduce cost without compromising data integrity and recommend an approach to cost reporting that permits comparison of clinical trials. We describe the organizational and financial characteristics of The International Network for Strategic Initiatives in Global HIV Trials, an infectious disease research network that conducts multiple, large, long-term, international trials, and examine challenges associated with simple and streamlined governance and an infrastructure and financial management model that is based on performance, transparency, and accountability. It is possible to reduce costs of participants' follow-up and not compromise clinical trial quality or integrity. The International Network for Strategic Initiatives in Global HIV Trials network has successfully completed three large HIV trials using cost-efficient practices that have not adversely affected investigator enthusiasm, accrual rates, loss-to-follow-up, adherence to the protocol, and completion of data collection. This experience is relevant to the conduct of large, publicly funded trials in other disease areas, particularly trials dependent on international collaborations. New approaches, or creative adaption of traditional clinical trial infrastructure and financial management tools, can render large, international clinical trials more cost-efficient by emphasizing structural simplicity, minimal up-front costs, payments for performance, and uniform algorithms and fees-for-service, irrespective of location. However, challenges remain. They
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-03-01
Based on the result of `Survey on the feasibility of large-scale methanol engine power generation plant` in fiscal 1992, concrete technological development issues were studied for its practical use, and the technological R & D scheme was prepared for large-scale methanol engine power plant featured by low NOx and high efficiency. Technological development issues of this plant were as follows: improvement of thermal efficiency, reduction of NOx emission, improvement of the reliability and durability of ignition and fuel injection systems, and reduction of vibration. As the economical effect of the technological development, the profitability of NOx control measures was compared between this methanol engine and conventional heavy oil diesel engines or gas engines. As a result, this engine was more economical than conventional engines. It was suggested that development of the equipment will be completed in nearly 4 years through every component study, single-cylinder model experiment and real engine test. 21 refs., 43 figs., 19 tabs.
International Nuclear Information System (INIS)
Dasgupta-Schubert, N.; Reyes, M. A.; Tamez, V. A.
2009-01-01
Alpha decay is one of the two main decay modes of the heaviest nuclei, (SHE), and constitutes one of the dominant decay modes of highly neutron deficient medium mass nuclei ('exotics'). Thus identifying and characterizing the alpha decay chains form a crucial part of the identification of SHE. We report the extension of the previously developed method for the detailed and systematic investigation of the reliability of the three main extant analytical formulae of alpha decay half-lives: the generalized liquid drop model based formula of Royer et al. (FR), the Sobiczewski modified semi-empirical Viola-Seaborg formula (VSS) and the recent phenomenological formula of Sobiczewski and Parkhomenko (SP).
Precision Optical Coatings for Large Space Telescope Mirrors
Sheikh, David
This proposal “Precision Optical Coatings for Large Space Telescope Mirrors” addresses the need to develop and advance the state-of-the-art in optical coating technology. NASA is considering large monolithic mirrors 1 to 8-meters in diameter for future telescopes such as HabEx and LUVOIR. Improved large area coating processes are needed to meet the future requirements of large astronomical mirrors. In this project, we will demonstrate a broadband reflective coating process for achieving high reflectivity from 90-nm to 2500-nm over a 2.3-meter diameter coating area. The coating process is scalable to larger mirrors, 6+ meters in diameter. We will use a battery-driven coating process to make an aluminum reflector, and a motion-controlled coating technology for depositing protective layers. We will advance the state-of-the-art for coating technology and manufacturing infrastructure, to meet the reflectance and wavefront requirements of both HabEx and LUVOIR. Specifically, we will combine the broadband reflective coating designs and processes developed at GSFC and JPL with large area manufacturing technologies developed at ZeCoat Corporation. Our primary objectives are to: Demonstrate an aluminum coating process to create uniform coatings over large areas with near-theoretical aluminum reflectance Demonstrate a motion-controlled coating process to apply very precise 2-nm to 5- nm thick protective/interference layers to large areas, Demonstrate a broadband coating system (90-nm to 2500-nm) over a 2.3-meter coating area and test it against the current coating specifications for LUVOIR/HabEx. We will perform simulated space-environment testing, and we expect to advance the TRL from 3 to >5 in 3-years.
Large power electron tubes for high frequency heating
International Nuclear Information System (INIS)
Okamoto, Tadashi; Sato, Hisaaki.
1988-01-01
On the large power electron tubes used for electron cyclotron heating, lower hybrid resonance frequency heating, and ion cyclotron range of frequency heating, namely gyrotron, klystron and quadrupole tube, the features, the present status of development, the construction, the principle and so on are explained. The research and development of gyrotrons are most advanced in USSR, the inventor. The course of the development of gyrotrons in foreign countries and in Japan is described. There are many variants of gyrotrons, for example whispering gallery mode, klystron type, backward wave oscillator type, gyro-peniotron and others. The principle of gyrotrons is explained, and about the examples of the developed gyrotrons, the design parameters are shown. For the purpose of using for the LHRF heating in JT-60, a superlarge power klystron of 1 MW output at 2 GHz frequency, which is the largest class in the world, has been developed. Its total length is 2.7 m, and weight is 1.5 t. It features, construction, function and performance are reported. The trend of large power quadrupole tubes is toward stable action with large power in VHF zone, and the typical products in USA and Europe are shown. (Kako, I.)
Design evolution of large wind turbine generators
Spera, D. A.
1979-01-01
During the past five years, the goals of economy and reliability have led to a significant evolution in the basic design--both external and internal--of large wind turbine systems. To show the scope and nature of recent changes in wind turbine designs, development of three types are described: (1) system configuration developments; (2) computer code developments; and (3) blade technology developments.
International Nuclear Information System (INIS)
Kimura, S.; Imazono, S.; Yaji, Y.
1999-01-01
1) Preparation for large large paddy fields and utilization of direct rice seeding cultivation are expected to be the key technologies for the low cost and labor saving large farm rice cultivation. To achieve this, the technique of land leveling for field operations have to be developed. A precise land leveling operation by a wheel tractor with laser-beam emitter and recover in a wet paddy field are developed. 2) The automatic measurement system of a rice paddy field surface level by a tractor that we developed was highly practical. After measured data ate stored in a memory of hand-held computer the standard deviation of a field height value is shown on the display. Also, measured data are exported to the personal computer and by RC232C, the contour map of the paddy field is draw quickly, which is useful for the land leveling work. 3) Considering the relation between rice seed germination and water depth in the field, the preciseness of the field leveling for direct rice seeding is required to be under 1.5cm of standard deviation (s.d.). To realize this preciseness, a prototype leveling aparatus consisting a laser emitter, a laser receiver and dry land leveler pulled by a tracter, was developed and was tested the performance. The results of land leveling test at a field of 1 ha indicated that the elevation difference of the field of 16cm was improved to that of 92% of +- 2.5cm (1.58cm s.d.) after leveling work. The working efficiency was 0.57hour/10a. For a precise leveling work, the of the soil water content should be under the plastic limitation, under which less amount of soil adoheres to the blade of the leveler. The performance tests of the laser assisted leveling apparatus for a paddy harrowing work revealed that for an accurate operation only a blade should be controlled by a hydraulic cylinder according to a laser beam. Since large amount of soil can not be handled by the apparatus, the leveling for a paddy harrowing work is recommended for a fine leveling
Chang, Kyungsik; Hughes, Thomas Jr R; Calo, Victor M.
2012-01-01
We report on the isogeometric residual-based variational multiscale (VMS) large eddy simulation of a fully developed turbulent flow over a wavy wall. To assess the predictive capability of the VMS modeling framework, we compare its predictions against the results from direct numerical simulation (DNS) and large eddy simulation (LES) and, when available, against experimental measurements. We use C 1 quadratic B-spline basis functions to represent the smooth geometry of the sinusoidal lower wall and the solution variables. The Reynolds numbers of the flows considered are 6760 and 30,000 based on the bulk velocity and average channel height. The ratio of amplitude to wavelength (α/λ) of the sinusoidal wavy surface is set to 0.05. The computational domain is 2λ×1.05λ×λ in the streamwise, wall-normal and spanwise directions, respectively. For the Re=6760 case, mean averaged quantities, including velocity and pressure profiles, and the separation/reattachment points in the recirculation region, are compared with DNS and experimental data. The turbulent kinetic energy and Reynolds stress are in good agreement with benchmark data. Coherent structures over the wavy wall are observed in isosurfaces of the Q-criterion and show similar features to those previously reported in the literature. Comparable accuracy to DNS solutions is obtained with at least one order of magnitude fewer degrees of freedom. For the Re=30,000 case, good agreement was obtained for mean wall shear stress and velocity profiles compared with available LES results reported in the literature. © 2012 Elsevier Ltd.
Chang, Kyungsik
2012-09-01
We report on the isogeometric residual-based variational multiscale (VMS) large eddy simulation of a fully developed turbulent flow over a wavy wall. To assess the predictive capability of the VMS modeling framework, we compare its predictions against the results from direct numerical simulation (DNS) and large eddy simulation (LES) and, when available, against experimental measurements. We use C 1 quadratic B-spline basis functions to represent the smooth geometry of the sinusoidal lower wall and the solution variables. The Reynolds numbers of the flows considered are 6760 and 30,000 based on the bulk velocity and average channel height. The ratio of amplitude to wavelength (α/λ) of the sinusoidal wavy surface is set to 0.05. The computational domain is 2λ×1.05λ×λ in the streamwise, wall-normal and spanwise directions, respectively. For the Re=6760 case, mean averaged quantities, including velocity and pressure profiles, and the separation/reattachment points in the recirculation region, are compared with DNS and experimental data. The turbulent kinetic energy and Reynolds stress are in good agreement with benchmark data. Coherent structures over the wavy wall are observed in isosurfaces of the Q-criterion and show similar features to those previously reported in the literature. Comparable accuracy to DNS solutions is obtained with at least one order of magnitude fewer degrees of freedom. For the Re=30,000 case, good agreement was obtained for mean wall shear stress and velocity profiles compared with available LES results reported in the literature. © 2012 Elsevier Ltd.
Chiang, Mao-Hsiung
2010-01-01
This study aims to develop a X-Y dual-axial intelligent servo pneumatic-piezoelectric hybrid actuator for position control with high response, large stroke (250 mm, 200 mm) and nanometer accuracy (20 nm). In each axis, the rodless pneumatic actuator serves to position in coarse stroke and the piezoelectric actuator compensates in fine stroke. Thus, the overall control systems of the single axis become a dual-input single-output (DISO) system. Although the rodless pneumatic actuator has relatively larger friction force, it has the advantage of mechanism for multi-axial development. Thus, the X-Y dual-axial positioning system is developed based on the servo pneumatic-piezoelectric hybrid actuator. In addition, the decoupling self-organizing fuzzy sliding mode control is developed as the intelligent control strategies. Finally, the proposed novel intelligent X-Y dual-axial servo pneumatic-piezoelectric hybrid actuators are implemented and verified experimentally.
Directory of Open Access Journals (Sweden)
Mao-Hsiung Chiang
2010-03-01
Full Text Available This study aims to develop a X-Y dual-axial intelligent servo pneumatic-piezoelectric hybrid actuator for position control with high response, large stroke (250 mm, 200 mm and nanometer accuracy (20 nm. In each axis, the rodless pneumatic actuator serves to position in coarse stroke and the piezoelectric actuator compensates in fine stroke. Thus, the overall control systems of the single axis become a dual-input single-output (DISO system. Although the rodless pneumatic actuator has relatively larger friction force, it has the advantage of mechanism for multi-axial development. Thus, the X-Y dual-axial positioning system is developed based on the servo pneumatic-piezoelectric hybrid actuator. In addition, the decoupling self-organizing fuzzy sliding mode control is developed as the intelligent control strategies. Finally, the proposed novel intelligent X-Y dual-axial servo pneumatic-piezoelectric hybrid actuators are implemented and verified experimentally.
Winands, G.J.J.; Liu, Zhen; Pemen, A.J.M.; Heesch, van E.J.M.; Yan, K.; Veldhuizen, van E.M.
2006-01-01
In this paper a large-scale pulsed corona system is described in which pulse parameters such as pulse rise-time, peak voltage, pulse width and energy per pulse can be varied. The chemical efficiency of the system is determined by measuring ozone production. The temporal and spatial development of
Economically viable large-scale hydrogen liquefaction
Cardella, U.; Decker, L.; Klein, H.
2017-02-01
The liquid hydrogen demand, particularly driven by clean energy applications, will rise in the near future. As industrial large scale liquefiers will play a major role within the hydrogen supply chain, production capacity will have to increase by a multiple of today’s typical sizes. The main goal is to reduce the total cost of ownership for these plants by increasing energy efficiency with innovative and simple process designs, optimized in capital expenditure. New concepts must ensure a manageable plant complexity and flexible operability. In the phase of process development and selection, a dimensioning of key equipment for large scale liquefiers, such as turbines and compressors as well as heat exchangers, must be performed iteratively to ensure technological feasibility and maturity. Further critical aspects related to hydrogen liquefaction, e.g. fluid properties, ortho-para hydrogen conversion, and coldbox configuration, must be analysed in detail. This paper provides an overview on the approach, challenges and preliminary results in the development of efficient as well as economically viable concepts for large-scale hydrogen liquefaction.
International Nuclear Information System (INIS)
Beard, D.S.; Klose, W.; Shimamoto, S.; Vecsey, G.
1988-01-01
A multinational program of cooperative research, development, demonstrations, and exchanges of information on superconducting magnets for fusion was initiated in 1977 under an IEA agreement. The first major step in the development of TF magnets was called the Large Coil Task. Participants in LCT were the U.S. DOE, EURATOM, JAERI, and the Departement Federal de l'Interieur of Switzerland. The goals of LCT were to obtain experimental data, to demonstrate reliable operation of large superconducting coils, and to prove design principles and fabrication techniques being considered for the toroidal magnets of thermonuclear reactors. These goals were to be accomplished through coordinated but largely independent design, development, and construction of six test coils, followed by collaborative testing in a compact toroidal test array at fields of 8 T and higher. Under the terms of the IEA Agreement, the United States built and operated the test facility at Oak Ridge and provided three test coils. The other participants provided one coil each. Information on design and manufacturing and all test data were shared by all. The LCT team of each participant included a government laboratory and industrial partners or contractors. The last coil was completed in 1985, and the test assembly was completed in October of that year. Over the next 23 months, the six-coil array was cooled down and extensive testing was performed. Results were gratifying, as tests achieved design-point performance and well beyond. (Each coil reached a peak field of 9 T.) Experiments elucidated coil behavior, delineated limits of operability, and demonstrated coil safety. (orig./KP)
Biofuel Development and Large-Scale Land Deals in Sub-Saharan Africa
Giorgia Giovannetti; Elisa Ticci
2013-01-01
Africa's biofuel potential over the last ten years has increasingly attracted foreign investors’ attention. We estimate the determinants of foreign investors land demand for biofuel production in SSA, using Poisson specifications of the gravity model. Our estimates suggest that land availability, abundance of water resources and weak land governance are significant determinants of large-scale land acquisitions for biofuel production. This in turn suggests that this type of investment is mainl...
Malsy, Marcus; Reder, Klara; Flörke, Martina
2014-05-01
Decreasing water quality is one of the main global issues which poses risks to food security, economy, and public health and is consequently crucial for ensuring environmental sustainability. During the last decades access to clean drinking water increased, but 2.5 billion people still do not have access to basic sanitation, especially in Africa and parts of Asia. In this context not only connection to sewage system is of high importance, but also treatment, as an increasing connection rate will lead to higher loadings and therefore higher pressure on water resources. Furthermore, poor people in developing countries use local surface waters for daily activities, e.g. bathing and washing. It is thus clear that water utilization and water sewerage are indispensable connected. In this study, large scale water quality modelling is used to point out hotspots of water pollution to get an insight on potential environmental impacts, in particular, in regions with a low observation density and data gaps in measured water quality parameters. We applied the global water quality model WorldQual to calculate biological oxygen demand (BOD) loadings from point and diffuse sources, as well as in-stream concentrations. Regional focus in this study is on developing countries i.e. Africa, Asia, and South America, as they are most affected by water pollution. Hereby, model runs were conducted for the year 2010 to draw a picture of recent status of surface waters quality and to figure out hotspots and main causes of pollution. First results show that hotspots mainly occur in highly agglomerated regions where population density is high. Large urban areas are initially loading hotspots and pollution prevention and control become increasingly important as point sources are subject to connection rates and treatment levels. Furthermore, river discharge plays a crucial role due to dilution potential, especially in terms of seasonal variability. Highly varying shares of BOD sources across
Turel, Vehbi; Calik, Sinan; Doganer, Adem
2015-01-01
The purpose of vocational schools (VSs) in Turkey, which offer two-year degree courses, is to provide the students who have completed a high school programme successfully with practical introductory experience in skilled trades such as computing, electronics, mechanics, carpentry, construction, field crops, and so on. Those who complete a two-year…
International Nuclear Information System (INIS)
Gopi, N.; Bapna, R.C.; Murali, C.G.; Narayan, B.S.; Dhareshwar, L.J.
1992-01-01
Laser-plasma interaction studies and experiments related to laser driven shocks as well as laser induced inertially confined thermonuclear fusion have resulted in an ever increasing demand for high brightness lasers capable of producing nanosecond pulse with energy of hundreds of kilo joules. High power Nd-glass laser chains with a master oscillator followed by a number of amplifier stages made up of rods, disks, slabs etc. are in operation in many leading laboratories in the world. This report describes the design, development and characterisation studies of a large aperture Nd:glass laser amplifier which is to be incorporated on line with the existing 40 J, 5 ns high power laser chain built for laser-plasma interaction and laser driven shock wave studies in the Laser and Plasma Technology Division. The development work described in this report discusses the design based on optimum material selection, optimisation of various sub components, ease of maintenance and smooth operation. The necessary operational electronics has also been described. The characterization studies mainly include measurement of spatial gain uniformity, thermally induced depolarization effects, and thermal relaxation studies. (author). 37 refs., 14 figs., 5 tabs
The interaction problems between large and small business in modern conditions
Directory of Open Access Journals (Sweden)
Belyaev Mikhail
2017-01-01
Full Text Available The development of market relations, changes of the conditions in the business environment encourage the enterprises to look for new management methods and to improve forms of interaction. In this regard, the identification of the interaction of large and small businesses, as well as the evaluation of their relation development seems important and urgent problem in modern conditions. The purpose of the survey – the study of the interaction of large and small businesses, as well as the evaluation of the relations between them. The study was conducted on the basis of a comprehensive and systematic approach in which methods of comparative, retrospective, statistical, mathematical analysis are used. In accordance with the purpose there are identified the prerequisites for the development of large and small businesses, features and their functioning problems, and the links between them. The most common form of interaction of large and small enterprises were identified - outsourcing, franchising, leasing, subcontracting, venture financing, the establishment of regional cooperation forms of large and small businesses. However, the cooperative processes of large and small business in Russia developed are not enough today.The authors identified factors that impede the growth of Russian production, offered recommendations for the development of large and small businesses, justified the state's role in this process. In addition, they described the mechanism of state support of small business, including organizational, financial, information and consulting components.
Large ceramics for fusion applications
International Nuclear Information System (INIS)
Hauth, W.E.; Stoddard, S.D.
1979-01-01
Prominent ceramic raw materials and products manufacturers were surveyed to determine the state of the art for alumina ceramic fabrication. This survey emphasized current capabilities and limitations for fabrication of large, high-density, high-purity, complex shapes. Some directions are suggested for future needs and development. Ceramic-to-ceramic sealing has applications for several technologies that require large and/or complex vacuum-tight ceramic shapes. Information is provided concerning the assembly of complex monolithic ceramic shapes by bonding of subassemblies at temperatures ranging from 450 to 1500 0 C. Future applications and fabrication techniques for various materials are presented
Recent developments for the Large Binocular Telescope Guiding Control Subsystem
Golota, T.; De La Peña, M. D.; Biddick, C.; Lesser, M.; Leibold, T.; Miller, D.; Meeks, R.; Hahn, T.; Storm, J.; Sargent, T.; Summers, D.; Hill, J.; Kraus, J.; Hooper, S.; Fisher, D.
2014-07-01
The Large Binocular Telescope (LBT) has eight Acquisition, Guiding, and wavefront Sensing Units (AGw units). They provide guiding and wavefront sensing capability at eight different locations at both direct and bent Gregorian focal stations. Recent additions of focal stations for PEPSI and MODS instruments doubled the number of focal stations in use including respective motion, camera controller server computers, and software infrastructure communicating with Guiding Control Subsystem (GCS). This paper describes the improvements made to the LBT GCS and explains how these changes have led to better maintainability and contributed to increased reliability. This paper also discusses the current GCS status and reviews potential upgrades to further improve its performance.
Jenkins, Luther N.; Yao, Chung-Sheng; Bartram, Scott M.; Harris, Jerome; Allan, Brian; Wong, Oliver; Mace, W. Derry
2009-01-01
A Large Field-of-View Particle Image Velocimetry (LFPIV) system has been developed for rotor wake diagnostics in the 14-by 22-Foot Subsonic Tunnel. The system has been used to measure three components of velocity in a plane as large as 1.524 meters by 0.914 meters in both forward flight and hover tests. Overall, the system performance has exceeded design expectations in terms of accuracy and efficiency. Measurements synchronized with the rotor position during forward flight and hover tests have shown that the system is able to capture the complex interaction of the body and rotor wakes as well as basic details of the blade tip vortex at several wake ages. Measurements obtained with traditional techniques such as multi-hole pressure probes, Laser Doppler Velocimetry (LDV), and 2D Particle Image Velocimetry (PIV) show good agreement with LFPIV measurements.
Large herbivores as a driving force of woodland-grassland cycles
Cornelissen, Perry
2017-01-01
This thesis examines the mutual interactions between the population dynamics of large herbivores and wood-pasture cycles in eutrophic wetlands. Therefore, habitat use and population dynamics of large herbivores, the effects of large herbivores on vegetation development, and the mutual
Energy Technology Data Exchange (ETDEWEB)
Nakamura, T.; Kondo, Y.
2016-06-01
Large acceptance spectrometers at in-flight RI separators have played significant roles in investigating the structure of exotic nuclei. Such spectrometers are in particular useful for probing unbound states of exotic nuclei, using invariant mass spectroscopy with reactions at intermediate and high energies. We discuss here the key characteristic features of such spectrometers, by introducing the recently commissioned SAMURAI facility at the RIBF, RIKEN. We also investigate the issue of cross talk in the detection of multiple neutrons, which has become crucial for exploring further unbound states and nuclei beyond the neutron drip line. Finally we discuss future perspectives for large acceptance spectrometers at the new-generation RI-beam facilities.
Another way of managing large amounts of data
2009-01-01
Jeff Hammerbacher is Vice President of Products and Chief Scientist at Cloudera, a US software company that provides solutions for managing and analysing very large data sets. His invited talk on 21 August was a good opportunity to exchange views with the CERN experts who face similar problems. Although still relatively young, Jeff has considerable experience in developing tools for storing and processing large amounts of data. Before Cloudera Jeff conceived, built and led the Data team at Facebook. He has also worked as a quantitative analyst on Wall Street. Jeff holds a Bachelor’s Degree in mathematics from Harvard University. At CERN, handling large amounts of data is the job of the Grid; Hadoop, the software Cloudera is developing, is intended for the same scope but has different technical features and implementations. "The Grid software products are designed for many organisations to collaborate on large-scale data analysis across many data centres. In contrast, Had...
International Nuclear Information System (INIS)
Zhao Zhenyu; Wang Shicheng
2003-01-01
By the general theory and method of mineral resources prognosis of synthetic information, the locative and quantitative prediction of the large and super-large sized mineral deposits of solid resources of 1 : 5,000,000 are developed in china. The deposit concentrated regions is model unit, the anomaly concentrated regions is prediction unit. The mineral prognosis of synthetic information is developed on GIS platform. The technical route and work method of looking for the large and super-large sized mineral resources and basic principle of compiling attribute table of the variables and the response variables are mentioned. In research of prediction of resources quantity, the locative and quantitative prediction are processed by separately the quantification theory Ⅲ and the corresponding characteristic analysis, two methods are compared. It is very important for resources prediction of western ten provinces in china, it is helpful. (authors)
International Nuclear Information System (INIS)
Hooper, J.D.
1984-01-01
Experimental studies of developed axial single-phase flow through closely spaced rod arrays have shown, with reducing p/d ratio, the development of high axial and azimuthal turbulence intensities in the rod gap region. Associated with this is the existence of very high levels of the azimuthal Reynolds shear stress component either side of the rod gap centre. Spatial correlation analysis of the three turbulent velocity components has shown a large scale coherent and almost periodic structure in the rod gap region. The structure is markedly different to the currently accepted secondary flow model. 14 references
Primary cutaneous anaplastic large-cell lymphoma.
Perry, Edward; Karajgikar, Jay; Tabbara, Imad A
2013-10-01
Since the recognition of the anaplastic large-cell lymphomas in the 1980s, much has been learned about the diagnosis, clinical presentation, and treatment of these malignant conditions. The systemic and primary cutaneous types of anaplastic large cell lymphomas have been differentiated on clinical and immunophenotypical findings, but further research is required to elucidate their exact etiologies and pathogeneses. Primary cutaneous anaplastic large-cell lymphoma has a 95% disease-specific 5-year survival, owing partly to the relatively benign course of the disease and partly to the variety of effective treatments that are available. As with many other oncological diseases, new drugs are continually being tested and developed, with immunotherapy and biological response modifiers showing promise.
International Nuclear Information System (INIS)
Jones, C.M.
1976-01-01
The increasing importance of energetic heavy ion beams in the study of atomic physics, nuclear physics, and materials science has partially or wholly motivated the construction of a new generation of tandem accelerators designed to operate at maximum terminal potentials in the range 14 to 30 MV. In addition, a number of older tandem accelerators are now being significantly upgraded to improve their heavy ion performance. Both of these developments have reemphasized the importance of negative heavy ion sources. The new large tandem accelerators are described, and the requirements placed on negative heavy ion source technology by these and other tandem accelerators used for the acceleration of heavy ions are discussed. First, a brief description is given of the large tandem accelerators which have been completed recently, are under construction, or are funded for construction, second, the motivation for construction of these accelerators is discussed, and last, criteria for negative ion sources for use with these accelerators are presented
Energy Technology Data Exchange (ETDEWEB)
Collen, Christine, E-mail: ccollen@uzbrussel.be [Department of Radiation Oncology, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); Ampe, Ben [Department of Neurosurgery, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); Gevaert, Thierry [Department of Radiation Oncology, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); Moens, Maarten [Department of Neurosurgery, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); Linthout, Nadine; De Ridder, Mark; Verellen, Dirk [Department of Radiation Oncology, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); D' Haens, Jean [Department of Neurosurgery, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium); Storme, Guy [Department of Radiation Oncology, UZ Brussel, Vrije Universiteit Brussel (VUB), Laarbeeklaan 101, 1090 Brussels (Belgium)
2011-11-15
Purpose: To evaluate and compare outcomes for patients with vestibular schwannoma (VS) treated in a single institution with linac-based stereotactic radiosurgery (SRS) or by fractionated stereotactic radiotherapy (SRT). Methods and Materials: One hundred and nineteen patients (SRS = 78, SRT = 41) were treated. For both SRS and SRT, beam shaping is performed by a mini-multileaf collimator. For SRS, a median single dose of 12.5 Gy (range, 11-14 Gy), prescribed to the 80% isodose line encompassing the target, was applied. Of the 42 SRT treatments, 32 treatments consisted of 10 fractions of 3-4 Gy, and 10 patients received 25 sessions of 2 Gy, prescribed to the 100% with the 95% isodose line encompassing the planning target volume. Mean largest tumor diameter was 16.6 mm in the SRS and 24.6 mm in the SRT group. Local tumor control, cranial nerve toxicity, and preservation of useful hearing were recorded. Any new treatment-induced cranial nerve neuropathy was scored as a complication. Results: Median follow-up was 62 months (range, 6-136 months), 5 patients progressed, resulting in an overall 5-year local tumor control of 95%. The overall 5-year facial nerve preservation probability was 88% and facial nerve neuropathy was statistically significantly higher after SRS, after prior surgery, for larger tumors, and in Koos Grade {>=}3. The overall 5-year trigeminal nerve preservation probability was 96%, not significantly influenced by any of the risk factors. The overall 4-year probability of preservation of useful hearing (Gardner-Robertson score 1 or 2) was 68%, not significantly different between SRS or SRT (59% vs. 82%, p = 0.089, log rank). Conclusion: Linac-based RT results in good local control and acceptable clinical outcome in small to medium-sized vestibular schwannomas (VSs). Radiosurgery for large VSs (Koos Grade {>=}3) remains a challenge because of increased facial nerve neuropathy.
Directory of Open Access Journals (Sweden)
Ravi F Sood
Full Text Available Hypertrophic scarring (HTS is hypothesized to have a genetic mechanism, yet its genetic determinants are largely unknown. The mitogen-activated protein kinase (MAPK pathways are important mediators of inflammatory signaling, and experimental evidence implicates MAPKs in HTS formation. We hypothesized that single-nucleotide polymorphisms (SNPs in MAPK-pathway genes would be associated with severity of post-burn HTS.We analyzed data from a prospective-cohort genome-wide association study of post-burn HTS. We included subjects with deep-partial-thickness burns admitted to our center who provided blood for genotyping and had at least one Vancouver Scar Scale (VSS assessment. After adjusting for HTS risk factors and population stratification, we tested MAPK-pathway gene SNPs for association with the four VSS variables in a joint regression model. In addition to individual-SNP analysis, we performed gene-based association testing.Our study population consisted of 538 adults (median age 40 years who were predominantly White (76% males (71% admitted to our center from 2007-2014 with small-to-moderate-sized burns (median burn size 6% total body surface area. Of 2,146 SNPs tested, a rare missense variant in the PTPN5 gene (rs56234898; minor allele frequency 1.5% was significantly associated with decreased severity of post-burn HTS (P = 1.3×10-6. In gene-based analysis, PTPN5 (P = 1.2×10-5 showed a significant association and BDNF (P = 9.5×10-4 a borderline-significant association with HTS severity.We report PTPN5 as a novel genetic locus associated with HTS severity. PTPN5 is a MAPK inhibitor expressed in neurons, suggesting a potential role for neurotrophic factors and neuroinflammatory signaling in HTS pathophysiology.
Directory of Open Access Journals (Sweden)
María Andrea Van Zele
2010-06-01
Full Text Available En el viento solar existen burbujas con cambios significativos de la presión dinámica; si una de ellas con mayor velocidad y densidad, y con Bz(IMF>0 enfrenta a la magnetosfera, ésta es comprimida; la corriente en la magnetopausa, que equilibra la presión del viento solar respecto del campo geomagnético, se incrementa entonces. En observatorios de latitudes bajas, medias y subaurorales los magnetogramas registran esta compresión como un súbito crecimiento (sc de la componente norte (X y horizontal (H del campo geomagnético. La región de la anomalía magnética del Atlántico Sur (SAMA es un sumidero de las partículas cargadas que se encuentran atrapadas en el cinturón de radiación interior, tanto durante períodos quietos como perturbados. De la precipitación de estas partículas ocurrida sobre las regiones D y E de la ionosfera del SAMA durante una compresión magnetosférica resulta un mayor incremento de los sc a la noche, respecto del registrado en regiones exteriores a la SAMA. El objetivo de este trabajo es determinar si la amplitud de un súbito crecimiento (sc del campo geomagnético en bajas latitudes de la superficie terrestre varía según la intensidad del campo magnético en ese lugar, en particular en la zona de la anomalía del Atlántico sur. Se propone entonces estudiar la respuesta geomagnética a diferentes variaciones de intensidad de la presión de viento solar que se producen a distintas horas en observatorios de bajas latitudes, siendo uno de ellos Vassouras (VSS, en el SAMA. Se encuentra que la amplitud de los sc dependen de diferentes factores: la presión y la variación de la velocidad del viento solar, la época del ano, la hora local, y posiblemente el estado previo de la magnetosfera o el sentido de campo magnético interplanetario; sin embargo la amplitud de los sc registrados en VSS suele ser en general superior a la de observatorios equivalentes a él por latitud geomagnética o inclinación: i VSS
Digital Archiving of People Flow by Recycling Large-Scale Social Survey Data of Developing Cities
Sekimoto, Y.; Watanabe, A.; Nakamura, T.; Horanont, T.
2012-07-01
Data on people flow has become increasingly important in the field of business, including the areas of marketing and public services. Although mobile phones enable a person's position to be located to a certain degree, it is a challenge to acquire sufficient data from people with mobile phones. In order to grasp people flow in its entirety, it is important to establish a practical method of reconstructing people flow from various kinds of existing fragmentary spatio-temporal data such as social survey data. For example, despite typical Person Trip Survey Data collected by the public sector showing the fragmentary spatio-temporal positions accessed, the data are attractive given the sufficiently large sample size to estimate the entire flow of people. In this study, we apply our proposed basic method to Japan International Cooperation Agency (JICA) PT data pertaining to developing cities around the world, and we propose some correction methods to resolve the difficulties in applying it to many cities and stably to infrastructure data.
Effects of mud supply on large-scale estuary morphology and development over centuries to millennia
Directory of Open Access Journals (Sweden)
L. Braat
2017-10-01
Full Text Available Alluvial river estuaries consist largely of sand but are typically flanked by mudflats and salt marshes. The analogy with meandering rivers that are kept narrower than braided rivers by cohesive floodplain formation raises the question of how large-scale estuarine morphology and the late Holocene development of estuaries are affected by cohesive sediment. In this study we combine sand and mud transport processes and study their interaction effects on morphologically modelled estuaries on centennial to millennial timescales. The numerical modelling package Delft3D was applied in 2-DH starting from an idealised convergent estuary. The mixed sediment was modelled with an active layer and storage module with fluxes predicted by the Partheniades–Krone relations for mud and Engelund–Hansen for sand. The model was subjected to a range of idealised boundary conditions of tidal range, river discharge, waves and mud input. The model results show that mud is predominantly stored in mudflats on the side of the estuary. Marine mud supply only influences the mouth of the estuary, whereas fluvial mud is distributed along the whole estuary. Coastal waves stir up mud and remove the tendency to form muddy coastlines and the formation of mudflats in the downstream part of the estuary. Widening continues in estuaries with only sand, while mud supply leads to a narrower constant width and reduced channel and bar dynamics. This self-confinement eventually leads to a dynamic equilibrium in which lateral channel migration and mudflat expansion are balanced on average. However, for higher mud concentrations, higher discharge and low tidal amplitude, the estuary narrows and fills to become a tidal delta.
Hahn, A.; Mazin, D.; Bangale, P.; Dettlaff, A.; Fink, D.; Grundner, F.; Haberer, W.; Maier, R.; Mirzoyan, R.; Podkladkin, S.; Teshima, M.; Wetteskind, H.
2017-02-01
The MAGIC collaboration operates two 17 m diameter Imaging Atmospheric Cherenkov Telescopes (IACTs) on the Canary Island of La Palma. Each of the two telescopes is currently equipped with a photomultiplier tube (PMT) based imaging camera. Due to the advances in the development of Silicon Photomultipliers (SiPMs), they are becoming a widely used alternative to PMTs in many research fields including gamma-ray astronomy. Within the Otto-Hahn group at the Max Planck Institute for Physics, Munich, we are developing a SiPM based detector module for a possible upgrade of the MAGIC cameras and also for future experiments as, e.g., the Large Size Telescopes (LST) of the Cherenkov Telescope Array (CTA). Because of the small size of individual SiPM sensors (6 mm×6 mm) with respect to the 1-inch diameter PMTs currently used in MAGIC, we use a custom-made matrix of SiPMs to cover the same detection area. We developed an electronic circuit to actively sum up and amplify the SiPM signals. Existing non-imaging hexagonal light concentrators (Winston cones) used in MAGIC have been modified for the angular acceptance of the SiPMs by using C++ based ray tracing simulations. The first prototype based detector module includes seven channels and was installed into the MAGIC camera in May 2015. We present the results of the first prototype and its performance as well as the status of the project and discuss its challenges.
Systematic control of large computer programs
International Nuclear Information System (INIS)
Goedbloed, J.P.; Klieb, L.
1986-07-01
A package of CCL, UPDATE, and FORTRAN procedures is described which facilitates the systematic control and development of large scientific computer programs. The package provides a general tool box for this purpose which contains many conveniences for the systematic administration of files, editing, reformating of line printer output files, etc. In addition, a small number of procedures is devoted to the problem of structured development of a large computer program which is used by a group of scientists. The essence of the method is contained in three procedures N, R, and X for the creation of a new UPDATE program library, its revision, and execution, resp., and a procedure REVISE which provides a joint editor - UPDATE session which combines the advantages of the two systems, viz. speed and rigor. (Auth.)
Directory of Open Access Journals (Sweden)
Dave J Druce
Full Text Available BACKGROUND: Acquiring greater understanding of the factors causing changes in vegetation structure -- particularly with the potential to cause regime shifts -- is important in adaptively managed conservation areas. Large trees (> or =5 m in height play an important ecosystem function, and are associated with a stable ecological state in the African savanna. There is concern that large tree densities are declining in a number of protected areas, including the Kruger National Park, South Africa. In this paper the results of a field study designed to monitor change in a savanna system are presented and discussed. METHODOLOGY/PRINCIPAL FINDINGS: Developing the first phase of a monitoring protocol to measure the change in tree species composition, density and size distribution, whilst also identifying factors driving change. A central issue is the discrete spatial distribution of large trees in the landscape, making point sampling approaches relatively ineffective. Accordingly, fourteen 10 m wide transects were aligned perpendicular to large rivers (3.0-6.6 km in length and eight transects were located at fixed-point photographic locations (1.0-1.6 km in length. Using accumulation curves, we established that the majority of tree species were sampled within 3 km. Furthermore, the key ecological drivers (e.g. fire, herbivory, drought and disease which influence large tree use and impact were also recorded within 3 km. CONCLUSIONS/SIGNIFICANCE: The technique presented provides an effective method for monitoring changes in large tree abundance, size distribution and use by the main ecological drivers across the savanna landscape. However, the monitoring of rare tree species would require individual marking approaches due to their low densities and specific habitat requirements. Repeat sampling intervals would vary depending on the factor of concern and proposed management mitigation. Once a monitoring protocol has been identified and evaluated, the next
Effects of mud supply on large-scale estuary morphology and development over centuries to millennia
Braat, L.; van Kessel, Thijs; Leuven, J.R.F.W.; Kleinhans, M.G.
2017-01-01
Alluvial river estuaries consist largely of sand but are typically flanked by mudflats and salt marshes. The analogy with meandering rivers that are kept narrower than braided rivers by cohesive floodplain formation raises the question of how large-scale estuarine morphology and the late Holocene
Large Eddy Simulation of turbulence
International Nuclear Information System (INIS)
Poullet, P.; Sancandi, M.
1994-12-01
Results of Large Eddy Simulation of 3D isotropic homogeneous turbulent flows are presented. A computer code developed on Connexion Machine (CM5) has allowed to compare two turbulent viscosity models (Smagorinsky and structure function). The numerical scheme influence on the energy density spectrum is also studied [fr
Whang, Liang-Ming; Liu, Pao-Wen G; Ma, Chih-Chung; Cheng, Sheng-Shung
2008-02-28
This study investigated potential application of two biosurfactants, surfactin (SF) and rhamnolipid (RL), for enhanced biodegradation of diesel-contaminated water and soil with a series of bench-scale experiments. The rhamnolipid used in this study, a commonly isolated glycolipid biosurfactant, was produced by Pseudomonas aeruginosa J4, while the surfactin, a lipoprotein type biosurfactant, was produced by Bacillus subtilis ATCC 21332. Both biosurfactants were able to reduce surface tension to less than 30 dynes/cm from 72 dynes/cm with critical micelle concentration (CMC) values of 45 and 50 mg/L for surfactin and rhamnolipid, respectively. In addition, the results of diesel dissolution experiments also demonstrated their ability in increasing diesel solubility with increased biosurfactant addition. In diesel/water batch experiments, an addition of 40 mg/L of surfactin significantly enhanced biomass growth (2500 mg VSS/L) as well as increased diesel biodegradation percentage (94%), compared to batch experiments with no surfactin addition (1000 mg VSS/L and 40% biodegradation percentage). Addition of surfactin more than 40 mg/L, however, decreased both biomass growth and diesel biodegradation efficiency, with a worse diesel biodegradation percentage (0%) at 400 mg/L of SF addition. Similar trends were also observed for both specific rate constants of biomass growth and diesel degradation, as surfactin addition increased from 0 to 400 mg/L. Addition of rhamnolipid to diesel/water systems from 0 to 80 mg/L substantially increased biomass growth and diesel biodegradation percentage from 1000 to 2500 mg VSS/L and 40 to 100%, respectively. Rhamnolipid addition at a concentration of 160 mg/L provided similar results to those of an 80 mg/L addition. Finally, potential application of surfactin and rhamnolipid in stimulating indigenous microorganisms for enhanced bioremediation of diesel-contaminated soil was also examined. The results confirmed their enhancing capability
Babu, Ranjith; Sharma, Richa; Bagley, Jacob H; Hatef, Jeffrey; Friedman, Allan H; Adamson, Cory
2013-07-01
There are a variety of treatment options for the management of vestibular schwannomas (VSs), including microsurgical resection, radiotherapy, and observation. Although the choice of treatment is dependent on various patient factors, physician bias has been shown to significantly affect treatment choice for VS. In this study the authors describe the current epidemiology of VS and treatment trends in the US in the modern era. They also illustrate patient and tumor characteristics and elucidate their effect on tumor management. Patients diagnosed with VS were identified through the Surveillance, Epidemiology, and End Results database, spanning the years 2004-2009. Age-adjusted incidence rates were calculated and adjusted using the 2000 US standard population. The chi-square and Student t-tests were used to evaluate differences between patient and tumor characteristics. Multivariate logistic regression was performed to determine the effects of various patient and tumor characteristics on the choice of tumor treatment. A total of 6225 patients with VSs treated between 2004 and 2009 were identified. The overall incidence rate was 1.2 per 100,000 population per year. The median age of patients with VS was 55 years, with the majority of patients being Caucasian (83.16%). Of all patients, 3053 (49.04%) received surgery only, with 1466 (23.55%) receiving radiotherapy alone. Both surgery and radiation were only used in 123 patients (1.98%), with 1504 patients not undergoing any treatment (24.16%). Increasing age correlated with decreased use of surgery (OR 0.95, 95% CI 0.95-0.96; pmanagement (OR 1.04, 95% CI 1.04-1.05; pmanaged conservatively despite presenting with larger tumors. Further studies are needed to elucidate the reasons for treatment disparities and investigate the nationwide trend of resection for the treatment of small VSs.