The effect of lanthanum applications on drought tolerance in barley

International Nuclear Information System (INIS)

Buckingham, S.; Maheswaran, J.; Peverill, K.; Meehan, B.; Stokes, J.

1998-01-01

Full text: Glasshouse investigations carried out by the authors on both perlite and soil, have repeatedly shown that several plant species, when treated with lanthanum, retain greater amounts of moisture under water stressed conditions. Dry matter increases under water stress have been observed in some cases. Barley plants watered to 50% field capacity, and show-ing signs of water stress, yielded 18% more dry matter when treated with 5 kg/ha and 10 kg/ha of lanthanum than control plants (P<0.05). The results of these experiments suggest that increased dry matter production in crops under periods of water stress, is likely when previously treated with lanthanum. Consequently, it is conceivable that lanthanum may have potential as an agent that induces drought tolerance in grain crops, grown in low rainfall areas. Subsequent field trials using barley as a test crop at Walpeup, in the Mallee region of Victoria have shown that in a below average rainfall year, combined soil and foliar applications of lanthanum can significantly increase grain yield. This effect was not evident when barley grown on the same soil type was treated with lanthanum under above average rainfall conditions

Lanthanum trilactate: Vibrational spectroscopic study - infrared/Raman spectroscopy

Czech Academy of Sciences Publication Activity Database

Švecová, M.; Novák, Vít; Bartůněk, V.; Člupek, M.

2016-01-01

Roč. 87, Nov (2016), s. 123-128 ISSN 0924-2031 Institutional support: RVO:61388963 Keywords : lanthanum trilactate * tris(2-hydroxypropanoato-O1,O2) * lanthanum tris[2-(hydroxy-kappa O)propanoato-kappa O] * Raman spectra * infrared spectra * DFT Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.740, year: 2016

Hydrophilic block copolymer-directed growth of lanthanum hydroxide nano-particles

Energy Technology Data Exchange (ETDEWEB)

Bouyer, F.; Sanson, N.; Gerardin, C. [Laboratoire de Materiaux Catalytiques et Catalyse en Chimie Organique, UMR 5618 CNRS-ENSCM-UM1, FR 1878, Institut Gerhardt, 34 - Montpellier (France); Destarac, M. [Centre de Recherches Rhodia Aubervilliers, 93 - Aubervilliers (France)

2006-03-15

Stable hairy lanthanum hydroxide nano-particles were synthesized in water by performing hydrolysis and condensation reactions of lanthanum cations in the presence of double hydrophilic poly-acrylic acid-b-polyacrylamide block copolymers (PAA-b-PAM). In the first step, the addition of asymmetric PAA-b-PAM copolymers (M{sub w,PAA} {<=} M{sub w,PAM}) to lanthanum salt solutions, both at pH = 5.5, induces the formation of monodispersed micellar aggregates, which are predominantly isotropic. The core of the hybrid aggregates is constituted of a lanthanum polyacrylate complex whose formation is due to bidentate coordination bonding between La{sup 3+} and acrylate groups, as shown by ATR-FTIR experiments and pH measurements. The size of the micellar aggregates depends on the molecular weight of the copolymer but is independent of the copolymer to metal ratio in solution. In the second step, the hydrolysis of lanthanum ions is induced by addition of a strong base such as sodium hydroxide. Either flocculated suspensions or stable anisotropic or spherical nano-particles of lanthanum hydrolysis products were obtained depending on the metal complexation ratio [acrylate]/[La]. The variation of that parameter also enables the control of the size of the core-corona nano-particles obtained by lanthanum hydroxylation. The asymmetry degree of the copolymer was shown to influence both the size and the shape of the particles. Elongated particles with a high aspect ratio, up to 10, were obtained with very asymmetric copolymers (M{sub w,PAM}/M{sub w,PAA}{>=}10) while shorter rice grain-like particles were obtained with a less asymmetric copolymer. The asymmetry degree also influences the value of the critical metal complexation degree required to obtain stable colloidal suspensions of polymer-stabilized lanthanum hydroxide. (authors)

Cytocompatibility of a free machining titanium alloy containing lanthanum.

Science.gov (United States)

Feyerabend, Frank; Siemers, Carsten; Willumeit, Regine; Rösler, Joachim

2009-09-01

Titanium alloys like Ti6Al4V are widely used in medical engineering. However, the mechanical and chemical properties of titanium alloys lead to poor machinability, resulting in high production costs of medical products. To improve the machinability of Ti6Al4V, 0.9% of the rare earth element lanthanum (La) was added. The microstructure, the mechanical, and the corrosion properties were determined. Lanthanum containing alloys exhibited discrete particles of cubic lanthanum. The mechanical properties and corrosion resistance were slightly decreased but are still sufficient for many applications in the field of medical engineering. In vitro experiments with mouse macrophages (RAW 264.7) and human bone-derived cells (MG-63, HBDC) were performed and revealed that macrophages showed a dose response below and above a LaCl3 concentration of 200 microM, while MG-63 and HBDC tolerated three times higher concentrations without reduction of viability. The viability of cells cultured on disks of the materials showed no differences between the reference and the lanthanum containing alloy. We therefore propose that lanthanum containing alloy appears to be a good alternative for biomedical applications, where machining of parts is necessary.

Bio-accumulation of lanthanum from lanthanum modified bentonite treatments in lake restoration

NARCIS (Netherlands)

Waajen, G.; Van Oosterhout, F.; Lürling, M.

2017-01-01

Abstract Lanthanum (La) modified bentonite (LMB) is one of the available mitigating agents used for the reduction of the phosphorus (P) recycling in eutrophic lakes. The potential toxicity of the La from LMB to aquatic organisms is a matter of concern. In this study the accumulation of La was

Electrochemical reduction of lanthanum trichloride in a molten equimolar mixture of sodium and potassium chlorides

Energy Technology Data Exchange (ETDEWEB)

Glagolevskaya, A.L.; Kuznetsov, S.A.; Polyakov, E.G.; Stangrit, P.T.

1987-09-20

The authors used linear voltamperometry for the investigation of the mechanism for the cathodic reduction of lanthanum. The mechanism for the cathodic reduction of lanthanum chloride in molten equimolar NaCl-KCl may be seen as consisting of a slow irreversible electrode reaction with a subsequent rapid irreversible chemical reaction. Lanthanum ions in a lower oxidation state were not found upon the prolonged maintenance of metallic lanthanum in molten NaCl-KCl-LaCl/sub 3/. Only an increase in the concentration of lanthanum(III) chloride in the melt was noted. The appearance of oxygen anions in the melt does not lead to a change in the mechanism of the cathodic reduction of lanthanum chloride but reduces the concentration of this chloride due to the formation of lanthanum oxochloride which is insoluble in the melt.

Silica doped with lanthanum sol–gel thin films for corrosion protection

International Nuclear Information System (INIS)

Abuín, M.; Serrano, A.; Llopis, J.; García, M.A.; Carmona, N.

2012-01-01

We present here anticorrosive silica coatings doped with lanthanum ions for the protection of metallic surfaces as an alternative to chromate (VI)-based conversion coatings. The coatings were synthesized by the sol–gel method starting from silicon alkoxides and two different lanthanum precursors: La (III) acetate hydrate and La (III) isopropoxide. Artificial corrosion tests in acid and alkaline media showed their effectiveness for the corrosion protection of AA2024 aluminum alloy sheets for coating prepared with both precursors. The X-ray absorption Near Edge Structure and X-ray Absorption Fine Structure analysis of the coatings confirmed the key role of lanthanum in the structural properties of the coating determining its anticorrosive properties. - Highlights: ► Silica sol–gel films doped with lanthanum ions were synthesized. ► Films from lanthanum-acetate and La-alkoxide were prepared for comparison purposes. ► La-acetate is an affordable chemical reactive preferred for the industry. ► Films properties were explored by scanning electron microscopy and X-Ray absorption spectroscopy. ► An alternative to anticorrosive pre-treatments for metallic surfaces is suggested.

LANTHANUM STAINING OF THE SURFACE COAT OF CELLS

Science.gov (United States)

Shea, Stephen M.

1971-01-01

Among the techniques which have been reported to stain the surface coat of cells, for electron microscopy, is lanthanum staining en bloc. Similarly, the presence of the cationic dye, Alcian blue 8GX, in a primary glutaraldehyde fixative has been reported to improve the preservation of the surface coat of cells of many types; however, the preserved coat is not very electron opaque unless thin sections are counterstained. The present paper shows that for several rat tissues lanthanum staining en bloc is an effective electron stain for the cell surface, giving excellent contrast, if combined sequentially with prefixation in an aldehyde fixative containing Alcian blue. The cationic substance cetylpyridinium chloride was found to have a similar effect to that of Alcian blue in enhancing the lanthanum staining of the surface coat material of the brush border of intestinal epithelial cells. The patterns of lanthanum staining obtained for the tissues studied strikingly resemble those reported in the literature where tissues are stained by several standard methods for demonstrating mucosubstances at the ultrastructural level. This fact and the reproduction of the effect of Alcian blue by cetylpyridinium chloride constitute a persuasive empirical argument that the material visualized is a mucopolysaccharide or mucopolysaccharide-protein complex. PMID:4108476

Determination of main components in lanthanum titanates blend

International Nuclear Information System (INIS)

Sizonenko, T.N.; Timchenko, A.K.

1981-01-01

Conditions for complexonometric determination of lanthanum in the presence of titanium using the disguising of the latter are studied. A method is suggested for lanthanum and titanium determination in a blend of lanthanum titanate which is used to grow monocrystals. Sulfosalicylic acid is chosen as a disguising agent. La has been determined by complexonometric titration using EDTA with xylenol orange in urotropin. The total contents of La and Ti have been determined by titration of EDTA excess with standard solution of zinc sulfate. Ti content has been calculated from the difference between the first two determinations. Reproducibility of Ti and La determination in the blend (n=21) is characterized by the following: at 19.73% La and 57.21% Ti there are (19.72+-0.16)% La and (57.10+-0.22)% Ti, Sr equals 0.0071 and 0.0034, respectively

Evolution of the local environment of lanthanum during simplified SON68 glass leaching

International Nuclear Information System (INIS)

Jollivet, P.; Delaye, J.M.; Den Auwer, C.; Simoni, E.

2007-01-01

The evolution of the short- and medium-range local environment of lanthanum was determined by L-III-edge X-ray absorption spectroscopy (XAS) during leaching of simplified SON68-type glasses. In glass without phosphorus, lanthanum is found in a silicate environment, and its first coordination sphere comprises eight oxygen atoms at a mean distance of 2.51 angstrom. When this glass was leached at a high renewal rate, the lanthanum local environment was significantly modified: it was present at hydroxy-carbonate and silicate sites with a mean La-O distance of 2.56 angstrom, and the second neighbors consisted of La atoms instead of Si for the glass. Conversely, in the gel formed at low renewal rates, lanthanum was found in a silicate environment similar to that of the glass. In phosphorus-doped glass, lanthanum is found in a phosphate environment, although the Si/P atomic ratio is 20:1. Lanthanum is surrounded by seven oxygen atoms at a mean distance of 2.37 angstrom. When phosphorus-doped glass is leached, regardless of the leaching solution flow rate, the short- and medium-range lanthanum local environment remains almost constant; the most significant change is a 0.05 angstrom increase in the La-O distance. (authors)

Calcium and lanthanum solid base catalysts for transesterification

Science.gov (United States)

Ng, K. Y. Simon; Yan, Shuli; Salley, Steven O.

2015-07-28

In one aspect, a heterogeneous catalyst comprises calcium hydroxide and lanthanum hydroxide, wherein the catalyst has a specific surface area of more than about 10 m.sup.2/g. In another aspect, a heterogeneous catalyst comprises a calcium compound and a lanthanum compound, wherein the catalyst has a specific surface area of more than about 10 m.sup.2/g, and a total basicity of about 13.6 mmol/g. In further another aspect, a heterogeneous catalyst comprises calcium oxide and lanthanum oxide, wherein the catalyst has a specific surface area of more than about 10 m.sup.2/g. In still another aspect, a process for preparing a catalyst comprises introducing a base precipitant, a neutral precipitant, and an acid precipitant to a solution comprising a first metal ion and a second metal ion to form a precipitate. The process further comprises calcining the precipitate to provide the catalyst.

Silica doped with lanthanum sol-gel thin films for corrosion protection

Energy Technology Data Exchange (ETDEWEB)

Abuin, M. [Department of Materials Physics, Complutense University at Madrid, Avda. Complutense sn, 28004 Madrid (Spain); Serrano, A. [Glass and Ceramic Institute, CSIC, C. Kelsen 5, 28049 Madrid (Spain); Llopis, J. [Department of Materials Physics, Complutense University at Madrid, Avda. Complutense sn, 28004 Madrid (Spain); Garcia, M.A. [Glass and Ceramic Institute, CSIC, C. Kelsen 5, 28049 Madrid (Spain); IMDEA Nanoscience, Fco. Tomas y Valiente 7, 28049 Madrid (Spain); Carmona, N., E-mail: n.carmona@fis.ucm.es [Department of Materials Physics, Complutense University at Madrid, Avda. Complutense sn, 28004 Madrid (Spain)

2012-06-01

We present here anticorrosive silica coatings doped with lanthanum ions for the protection of metallic surfaces as an alternative to chromate (VI)-based conversion coatings. The coatings were synthesized by the sol-gel method starting from silicon alkoxides and two different lanthanum precursors: La (III) acetate hydrate and La (III) isopropoxide. Artificial corrosion tests in acid and alkaline media showed their effectiveness for the corrosion protection of AA2024 aluminum alloy sheets for coating prepared with both precursors. The X-ray absorption Near Edge Structure and X-ray Absorption Fine Structure analysis of the coatings confirmed the key role of lanthanum in the structural properties of the coating determining its anticorrosive properties. - Highlights: Black-Right-Pointing-Pointer Silica sol-gel films doped with lanthanum ions were synthesized. Black-Right-Pointing-Pointer Films from lanthanum-acetate and La-alkoxide were prepared for comparison purposes. Black-Right-Pointing-Pointer La-acetate is an affordable chemical reactive preferred for the industry. Black-Right-Pointing-Pointer Films properties were explored by scanning electron microscopy and X-Ray absorption spectroscopy. Black-Right-Pointing-Pointer An alternative to anticorrosive pre-treatments for metallic surfaces is suggested.

The evolution mechanism of the dislocation loops in irradiated lanthanum doped cerium oxide

International Nuclear Information System (INIS)

Miao, Yinbin; Aidhy, Dilpuneet; Chen, Wei-Ying; Mo, Kun; Oaks, Aaron; Wolf, Dieter; Stubbins, James F.

2014-01-01

Cerium dioxide, a non-radioactive surrogate of uranium dioxide, is useful for simulating the radiation responses of uranium dioxide and mixed oxide fuel (MOX). Controlled additions of lanthanum can also be used to form various levels of lattice oxide or anion vacancies. In previous transmission electron microscopy (TEM) experimental studies, the growth rate of dislocation loops in irradiated lanthanum doped ceria was reported to vary with lanthanum concentration. This work reports findings of the evolution mechanisms of the dislocation loops in cerium oxide with and without lanthanum dopants based on a combination of molecular statics and molecular dynamics simulations. These dislocation loops are found to be b=1/3〈111〉 interstitial type Frank loops. Calculations of the defect energy profiles of the dislocation loops with different structural configurations and radii reveal the basis for preference of nucleation as well as the driving force of growth. Frenkel pair evolution simulations and displacement cascade overlaps simulations were conducted for a variety of lanthanum doping conditions. The nucleation and growth processes of the Frank loop were found to be controlled by the mobility of cation interstitials, which is significantly influenced by the lanthanum doping concentration. Competition mechanisms coupled with the mobility of cation point defects were discovered, and can be used to explain the lanthanum effects observed in experiments

DISSOLUTION OF LANTHANUM FLUORIDE PRECIPITATES

Science.gov (United States)

Fries, B.A.

1959-11-10

A plutonium separatory ore concentration procedure involving the use of a fluoride type of carrier is presented. An improvement is given in the derivation step in the process for plutonium recovery by carrier precipitation of plutonium values from solution with a lanthanum fluoride carrier precipitate and subsequent derivation from the resulting plutonium bearing carrier precipitate of an aqueous acidic plutonium-containing solution. The carrier precipitate is contacted with a concentrated aqueous solution of potassium carbonate to effect dissolution therein of at least a part of the precipitate, including the plutonium values. Any remaining precipitate is separated from the resulting solution and dissolves in an aqueous solution containing at least 20% by weight of potassium carbonate. The reacting solutions are combined, and an alkali metal hydroxide added to a concentration of at least 2N to precipitate lanthanum hydroxide concomitantly carrying plutonium values.

Adsorption of lithium-lanthanum films on W (112) face

International Nuclear Information System (INIS)

Gupalo, M.S.; Smereka, T.P.; Palyukh, B.M.; Babkin, G.V.

1986-01-01

The method of contact potential difference is employed to study the electron adsorption properties (the work function phi and adsorption heat q) lithium films on a lanthanized W(112) surface. It is found that the work function of mixed lithium-lanthanum films is intermediate between phi of the summands. The presence of lanthanum on a W(112) face reduces the adsorption heat of lithium

Nanosized lead lanthanum titanate (PLT) ceramic powders synthesized by the oxidant peroxo method

Energy Technology Data Exchange (ETDEWEB)

Camargo, Emerson R. [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Department of Chemistry, UFSCar-Federal University of Sao Carlos, Rod.Washingtin Luis km 235, CP 676, Sao Carlos SP 13565-9905 (Brazil)], E-mail: camargo@ufscar.br; Barrado, Cristiano M. [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Department of Chemistry, UFSCar-Federal University of Sao Carlos, Rod.Washingtin Luis km 235, CP 676, Sao Carlos SP 13565-9905 (Brazil); Ribeiro, Caue [EMBRAPA Instrumentacao Agropecuaria, Rua XV de Novembro 1452, Sao Carlos SP 13560-970 (Brazil)], E-mail: caue@cnpdia.embrapa.br; Longo, Elson [Department of Biochemistry, Chemistry Institute of Araraquara, UNESP-Sao Paulo State University, Rua Francisco Degni, CP 355, Araraquara SP 14801-907 (Brazil)], E-mail: elson@iq.unesp.br; Leite, Edson R. [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Department of Chemistry, UFSCar-Federal University of Sao Carlos, Rod.Washingtin Luis km 235, CP 676, Sao Carlos SP 13565-9905 (Brazil)], E-mail: derl@power.ufscar.br

2009-05-05

For the first time it is reported the synthesis of lead titanate modified with rare earth by the oxidant-peroxo method (OPM). Lanthanum was added up to 20% in mol through the dissolution of lanthanum oxide in nitric acid, followed by the addition of a solution of lead and lanthanum nitrate into an aqueous solution of titanium peroxo complexes. The amorphous precipitate formed was heat-treated at different temperatures in the range from 400 to 900 deg. C for crystallization. Powders were characterized by Raman spectroscopy and X-ray diffraction. Tetragonal perovskite structure was observed for the samples up to 15% of lanthanum substitution and cubic perovskite for sample with 20% of lanthanum. Crystallographic domains calculated by Scherrer equation showing a probable suppression of the crystallite growth in function of lanthanum content. It was observed shifting to lower frequencies of Raman modes in the range between 100 and 400 cm{sup -1} and the vanishing of the A1(2TO) and E(1LO) modes could be attributed to transition phase from tetragonal to cubic. Electronic microscopy image revealed that the powders annealed at height temperature are spherical with sharp size distribution.

Nanosized lead lanthanum titanate (PLT) ceramic powders synthesized by the oxidant peroxo method

International Nuclear Information System (INIS)

Camargo, Emerson R.; Barrado, Cristiano M.; Ribeiro, Caue; Longo, Elson; Leite, Edson R.

2009-01-01

For the first time it is reported the synthesis of lead titanate modified with rare earth by the oxidant-peroxo method (OPM). Lanthanum was added up to 20% in mol through the dissolution of lanthanum oxide in nitric acid, followed by the addition of a solution of lead and lanthanum nitrate into an aqueous solution of titanium peroxo complexes. The amorphous precipitate formed was heat-treated at different temperatures in the range from 400 to 900 deg. C for crystallization. Powders were characterized by Raman spectroscopy and X-ray diffraction. Tetragonal perovskite structure was observed for the samples up to 15% of lanthanum substitution and cubic perovskite for sample with 20% of lanthanum. Crystallographic domains calculated by Scherrer equation showing a probable suppression of the crystallite growth in function of lanthanum content. It was observed shifting to lower frequencies of Raman modes in the range between 100 and 400 cm -1 and the vanishing of the A1(2TO) and E(1LO) modes could be attributed to transition phase from tetragonal to cubic. Electronic microscopy image revealed that the powders annealed at height temperature are spherical with sharp size distribution.

Distribution of lanthanum and neodymium in Di(2-ethlhexyl) phosphoric acid and tributylphosphate

International Nuclear Information System (INIS)

Kraikaew, J.; Suparith, N.; Pruantonsai, P.

1994-01-01

Lanthanum and neodymium are among the high quantity elements in mixed rare earth from monazite processing. The popular rare earth separation process is liquid-liquid extraction. This research was carried out to study lanthanum and neodymium distribution in two extractants, di(2-ethylhexyl) phosphoric acid and tributylphosphate. The experimental results show that neodymium distributes in both extractants better than lanthanum. The distribution of both elements are higher at low acidity than at high acidity. Quick and rough investigation by calculating the ratio of distribution coefficient of neodymium to lanthanum in each extractant indicated that La-nd separation efficiency of Di(2-ethylhexyl) phosphoric acid is higher than that of tributylphosphate

Pressure behaviour of the superconducting transition temperature of lanthanum

International Nuclear Information System (INIS)

Glocker, R.

1977-01-01

The dissertation has the following chapters: 1) Introduction, 2) Fundamentals of the microscopic theory of superconductivity, 3) Calculation of the first momentum of the Eliashberg function, 4) Determination of the average values of frequency, 5) The relativistic cellular method and its application to lanthanum, 6) Results of the calculation of the electron-phonon coupling cosntants for f.c.c. lanthanum, 7) Phonon dispersion and phonon state density. (orig.) [de

Functionalization of lanthanum hydroxide nanowires by atom transfer radical polymerization

International Nuclear Information System (INIS)

Zhou Mi; Yuan Jinying; Yuan Weizhong; Yin Yingwu; Hong Xiaoyin

2007-01-01

Atom transfer radical polymerization (ATRP) has been used to prepare a core-shell hybrid nanostructure successfully: a hard core of single-crystalline lanthanum hydroxide nanowires and a soft shell of polystyrene (PS) brushes. Transmission electron microscopy (TEM) images indicated that the resulting products presented special structures and different thicknesses of polymer layers. The chemical components and grafted PS quantities of the samples were measured by Fourier transform infrared (FT-IR) spectroscopy and thermogravimetric analysis (TGA). The polymers showed narrow polydispersity, which proved that the lanthanum hydroxide nanowires initiated the 'living'/controlled polymerization of styrene. With the modifiability of lanthanum hydroxide nanowires, the solubility increased, which affords a new way to functionalize nanowires

Spectrophotometric study of the complexation equilibria of lanthanum(III) with 1,4-bis(4'-methylanilino)anthraquinone and the determination of lanthanum(III)

International Nuclear Information System (INIS)

Idriss, K.A.-R; El-Shahawy, A.S.; Sedaira, H.; Harfoush, A.A.

1985-01-01

The complexation equilibria of lanthanum(III) with 1,4-bis(4'-methylanilino)anthraquinone (Quinizarin Green) were studied spectrophotometrically in 40% V/V dimethylformamide using graphical analysis of the absorbance curves. The reaction mechanism of lanthanum with the bisarylaminoanthraquinone dye within the pH range 6 to 9.25 was demonstrated. The thermodynamic stabilities and the molar absorptivities of the complexes formed were determined. The optimum conditions for the spectrophotometric determination of La(III) with this reagent were found. (author)

Fabrication of mesoporous and high specific surface area lanthanum carbide-carbon nanotube composites

International Nuclear Information System (INIS)

Biasetto, L.; Carturan, S.; Maggioni, G.; Zanonato, P.; Bernardo, P. Di; Colombo, P.; Andrighetto, A.; Prete, G.

2009-01-01

Mesoporous lanthanum carbide-carbon nanotube composites were produced by means of carbothermal reaction of lanthanum oxide, graphite and multi-walled carbon nanotube mixtures under high vacuum. Residual gas analysis revealed the higher reactivity of lanthanum oxide towards carbon nanotubes compared to graphite. After sintering, the composites revealed a specific surface area increasing with the amount of carbon nanotubes introduced. The meso-porosity of carbon nanotubes was maintained after thermal treatment.

Effects of the wet air on the properties of the lanthanum oxide and lanthanum aluminate thin films

International Nuclear Information System (INIS)

Jun, Jin Hyung; Choi, Doo Jin

2006-01-01

Lanthanum oxide and lanthanum aluminate thin films were deposited on Si substrates. The as-grown films were stored in wet ambient and dry ambient for days and annealed after storage and also the structural and the electrical properties of the films were investigated. As the storage time increased, the La 2 O 3 films stored in wet ambient showed rapid reaction with moisture and the properties degraded. In case of the LAO films, although the thickness of the film also increased during hydration, the properties of the film did not so much changed due to the role of the incorporated aluminum. The LAO films showed better hydration resistance characteristics and so more suitable for conventional wet cleaning process in semiconductor fabrication

Improvement of acid and base resistance of nickel phosphate pigment by the addition of lanthanum cation

International Nuclear Information System (INIS)

Onoda, Hiroaki; Matsui, Hironori; Tanaka, Isao

2007-01-01

Transition metal phosphates are used as inorganic pigments, however these materials had a weak point for acid and base resistance. Because lanthanum phosphate is insoluble in acidic and basic solution, the addition of lanthanum cation was tried for the improvement of the acid and base resistance of nickel phosphate pigment. The lanthanum-doped nickel phosphates were prepared from phosphoric acid, nickel nitrate, and lanthanum nitrate solution. The additional effects of lanthanum cation were studied on the chemical composition, particle shape and size distribution, specific surface area, color, acid and base resistance of the precipitations and their thermal products

Analyzing relation between the radioactivity in lanthanum products and the origins of RE chlorides

International Nuclear Information System (INIS)

Wan Rongsheng

2004-01-01

Objective: To analyze the relation between the radioactivity in Lanthanum products and the origins of RE Chlorides. Methods: Using JY-38 plus sequential ICP spectrometer to examine the content of the uranium in the RE Chlorides. Using FJ-2603 low background alpha, beta measurement apparatus to measure total alpha and total beta activities of Lanthanum products. Results: The content of the uranium in the RE Chlorides is much lower in Baotou's than Hunan's. The radioactivity in Lanthanum products are made from the RE Chlorides of Baotou is much lower than that in Hunan's too. The radioactivity in Lanthanum products depends on the origins of RE Chlorides. Conclusion: The basic data were provided for radioactivity in Lanthanum products which are made from RE Chlorides of different places of China. The mathematical model was founded for the reasonable use of resource RE Chlorides

Microwave-assisted synthesis of lanthanum conversion coating on Mg-Li alloy and its corrosion resistance

International Nuclear Information System (INIS)

Song Dalei; Jing Xiaoyan; Wang Jun; Lu Shanshan; Yang Piaoping; Wang Yanli; Zhang Milin

2011-01-01

Graphical abstract: Highlights: → The method of microwave is used to synthesize lanthanum conversion coating. → Lanthanum conversion coating on Mg-Li alloy was studied. → Different conditions between room temperature and microwave were compared. → The corrosion behavior of lanthanum conversion coatings was studied. → The corrosion mechanism of lanthanum conversion coatings was studied. - Abstract: Lanthanum-based conversion coating on Mg-Li alloy has been prepared by a microwave-assisted method. X-ray diffractions (XRD) indicate that the intermetallic compounds of lanthanum are formed on Mg-Li alloy surface. Scanning electron microscopy (SEM) images show that the coating has different morphologies and special structures. The corrosion resistance was assessed by means of potentiodynamic polarization curves and electrochemical impedance spectra (EIS). The results indicate that this coating significantly reduces the corrosion rate of Mg-Li alloy in NaCl solution. A comparing experiment indicates that the coating prepared by microwave-assisted process has superior corrosion resistance to the coating obtained at room temperature.

Electrical conductivity studies of nanocrystalline lanthanum silicate synthesized by sol-gel route

International Nuclear Information System (INIS)

Nallamuthu, N.; Prakash, I.; Satyanarayana, N.; Venkateswarlu, M.

2011-01-01

Research highlights: → Nanocrystalline La 10 Si 6 O 27 material was synthesized by sol-gel method. → TG/DTA curves predicted the thermal behavior of the material. → FTIR spectra confirmed the formation of SiO 4 and La-O network in the La 10 Si 6 O 27 . → XRD patterns confirmed the formation of pure crystalline La 10 Si 6 O 27 phase. → The grain interior and the grain boundary conductivities are evaluated. - Abstract: Nanocrystalline apatite type structured lanthanum silicate (La 10 Si 6 O 27 ) sample was synthesized by sol-gel process. Thermal behavior of the dried gel of lanthanum silicate sample was studied using TG/DTA. The structural coordination of the dried gel of lanthanum silicate, calcined at various temperatures, was identified from the observed FTIR spectral results. The observed XRD patterns of the calcined dried gel were compared with the ICDD data and confirmed the formation of crystalline lanthanum silicate phase. The average crystalline size of La 10 Si 6 O 27 was calculated using the Scherrer formula and it is found to be ∼80 nm. The observed SEM images of the lanthanum silicate indicate the formation of the spherical particles and the existence of O, Si and La in the lanthanum silicate are confirmed from the SEM-EDX spectrum. The grain and grain boundary conductivities are evaluated by analyzing the measured impedance data, using winfit software, obtained at different temperatures, of La 10 Si 6 O 27 sample. Also, the observed grain and grain boundary conductivity behaviors of the La 10 Si 6 O 27 sample are analysed using brick layer model. The electrical permittivity and electrical modulus were calculated from the measured impedance data and were analyzed by fitting through the Havriliak and Negami function to describe the dielectric relaxation behavior of the nanocrystalline lanthanum silicate.

Management of hyperphosphatemia in patients with end-stage renal disease: focus on lanthanum carbonate

Directory of Open Access Journals (Sweden)

Veerle P Persy

2009-04-01

Full Text Available Veerle P Persy, Geert J Behets, Marc E De Broe, Patrick C D’HaeseLaboratory of Pathophysiology, University of Antwerp, BelgiumAbstract: Elevated serum phosphate levels as a consequence of chronic kidney disease (CKD contribute to the increased cardiovascular risk observed in dialysis patients. Protein restriction and dialysis fail to adequately prevent hyperphosphatemia, and in general treatment with oral phosphate binding agents is necessary in patients with advanced CKD. Phosphate plays a pivotal role in the development of vascular calcification, one of the factors contributing to increased cardiovascular risk in CKD patients. Treatment of hyperphosphatemia with standard calcium-based phosphate binders and vitamin D compounds can induce hypercalcemic episodes, increase the Ca × PO4 product and thus add to the risk of ectopic mineralization. In this review, recent clinical as well as experimental data on lanthanum carbonate, a novel, non-calcium, non-resin phosphate binding agent are summarized. Although lanthanum is a metal cation no aluminium-like toxicity is observed since the bioavailability of lanthanum is extremely low and its metabolism differs from that of aluminium. Clinical studies now document the absence of toxic effects of lanthanum for up to 6 years of follow-up. The effects of lanthanum on bone, vasculature and brain are discussed and put in perspective with lanthanum pharmacokinetics.Keywords: lanthanum carbonate, phosphate binding, chronic kidney disease

Study of behaviour of lanthanum- and yttrium electrodes in chloride melts

International Nuclear Information System (INIS)

Shkol'nikov, S.I.; Tolypin, E.S.; Yur'ev, B.P.

1984-01-01

A study was made on the lanthanum- and yttrium behaviour in a mixture of molten potassium- and sodium chlorides at various temperatures. It is shown that the lanthanum- and yttrium behaviour in KCl-NaCl melt is similar to the behaviour of other metals. Their corrosion rate is much higher as compared to other metals and it grows rapidly with increasing melt temperature. The temperature growth by 200 deg C results in an increase in the corrosion rate almost by an order. The potentials of lanthanum- and yttrium electrodes at the instant they are immersed in the melt have more negative values than the potentials of alkali metals under similar conditions

Electrochemical Deposition of Lanthanum Telluride Thin Films and Nanowires

Science.gov (United States)

Chi, Su (Ike); Farias, Stephen; Cammarata, Robert

2013-03-01

Tellurium alloys are characterized by their high performance thermoelectric properties and recent research has shown nanostructured tellurium alloys display even greater performance than bulk equivalents. Increased thermoelectric efficiency of nanostructured materials have led to significant interests in developing thin film and nanowire structures. Here, we report on the first successful electrodeposition of lanthanum telluride thin films and nanowires. The electrodeposition of lanthanum telluride thin films is performed in ionic liquids at room temperature. The synthesis of nanowires involves electrodepositing lanthanum telluride arrays into anodic aluminum oxide (AAO) nanoporous membranes. These novel procedures can serve as an alternative means of simple, inexpensive and laboratory-environment friendly methods to synthesize nanostructured thermoelectric materials. The thermoelectric properties of thin films and nanowires will be presented to compare to current state-of-the-art thermoelectric materials. The morphologies and chemical compositions of the deposited films and nanowires are characterized using SEM and EDAX analysis.

Properties of gallium lanthanum sulphide glass

OpenAIRE

Bastock, P.; Craig, C.; Khan, K.; Weatherby, E.; Yao, J.; Hewak, D.W.

2015-01-01

A series of gallium lanthanum sulphide (GLS) glasses has been studied in order to ascertain properties across the entire glass forming region. This is the first comprehensive study of GLS glass over a wide compositional range.

DFT Studies on Interaction between Lanthanum and Hydroxyamide

Science.gov (United States)

Pati, Anindita; Kundu, T. K.; Pal, Snehanshu

2018-03-01

Extraction and separation of individual rare earth elements has been a challenge as they are chemically very similar. Solvent extraction is the most suitable way for extraction of rare earth elements. Acidic, basic, neutral, chelating are the major classes of extractants for solvent extraction of rare earth elements. The coordination complex of chelating extractants is very selective with positively charged metal ion. Hence they are widely used. Hydroxyamide is capable of forming chelates with metal cations. In this present study interactions of hydroxyamide ligand with lanthanum have been investigated using density functional theory (DFT). Two different functional such as raB97XD and B3LYP are applied along with 6-31+G(d,p) basis set for carbon, nitrogen, hydrogen and SDD basis set for lanthanum. Stability of formed complexes has been evaluated based on calculated interaction energies and solvation energies. Frontier orbital (highest occupied molecular orbital or HOMO and lowest unoccupied molecular orbital or LUMO) energies of the molecule have also been calculated. Electronegativity, chemical hardness, chemical softness and chemical potential are also determined for these complexes to get an idea about the reactivity. From the partial charge distribution it is seen that oxygen atoms in hydroxyamide have higher negative charge. The double bonded oxygen atom present in the hydroxyamide structure has higher electron density and so it forms bond with lanthanum but the singly bonded oxygen atom in the hydroxyamide structure is weaker donor atom and so it is less available for interaction with lanthanum.

PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

International Nuclear Information System (INIS)

Kostromina, N.A.; Novikova, L.B.

1975-01-01

Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

Studies on the promotion of nickel—alumina coprecipitated catalysts: II. Lanthanum oxide

NARCIS (Netherlands)

Lansink Rotgerink, H.G.J.; Paalman, R.P.A.M.; van Ommen, J.G.; Ross, J.R.H.

1988-01-01

Two series of lanthanum promoted nickel—alumina catalysts have been prepared by coprecipitation of the metal nitrates, using potassium carbonate. The molar ratio between nickel and the sum of aluminium and lanthanum was kept constant at 2.5 or 9.0 within each series. The calcination and reduction of

Removal of Lanthanum (III) From Aqueous Solution Using Non-Living Water Hyacinth Roots

International Nuclear Information System (INIS)

Aly, A.; Amer, H.A.; Shawky, S.; Shawky, S.; Kandil, A.T.

2013-01-01

Removal of lanthanum (III) from aqueous solution using dried roots of water hyacinth (Eichhornia crassipes) has been investigated. The roots have been characterized by determining the ash percentage, the ph of the slurry, the elemental composition, the thermal gravimetric analysis, the surface area, the pore size, the zeta potential and ph of zero point charge. A surface area of 128 m 2 /g has been found and the micropore structure of the roots has been confirmed. Zeta potential and ph of zero point charge of the roots surfaces showed that they are positively charged within the ph range from 2 to 7.5. Sorption is rapid and depends on ph, weight of roots, concentration of lanthanum (III) and ionic strength. The sorption of lanthanum (III) was confirmed by scanning electron microscope, energy dispersive spectroscopy and the release of Ca +2 , Mg +2 and K +1 after sorption of lanthanum (III) have been indicated an ion exchange mechanism. Fourier transform infrared spectra indicated surface complexation mechanism, and sorption isotherms and kinetics were discussed. The roots were tested for removal of radioactive lanthanum ( 140 La) from simulated radioactive waste. Accepted June 2013.

Strengthening and elongation mechanism of Lanthanum-doped Titanium-Zirconium-Molybdenum alloy

Energy Technology Data Exchange (ETDEWEB)

Hu, Ping, E-mail: huping1985@126.com [School of Metallurgy Engineering, Xi’an University of Architecture and Technology, Xi’an 710055 (China); Jinduicheng Molybdenum Co., Ltd., Xi’an 710068 (China); Hu, Bo-liang; Wang, Kuai-she; Song, Rui; Yang, Fan [School of Metallurgy Engineering, Xi’an University of Architecture and Technology, Xi’an 710055 (China); Yu, Zhi-tao [Ruifulai Tungsten & Molybdenum Co., Ltd., Xi’an 721914 (China); Tan, Jiang-fei [School of Metallurgy Engineering, Xi’an University of Architecture and Technology, Xi’an 710055 (China); Cao, Wei-cheng; Liu, Dong-xin; An, Geng [Jinduicheng Molybdenum Co., Ltd., Xi’an 710068 (China); Guo, Lei [Ruifulai Tungsten & Molybdenum Co., Ltd., Xi’an 721914 (China); Yu, Hai-liang [School of Mechanical, Materials and Mechatronics Engineering, University of Wollongong, NSW 2522 (Australia)

2016-12-15

The microstructural contributes to understand the strengthening and elongation mechanism in Lanthanum-doped Titanium-Zirconium-Molybdenum alloy. Lanthanum oxide particles not only act as heterogeneous nucleation core, but also act as the second phase to hinder the grain growth during sintering crystallization. The molybdenum substrate formed sub-grain under the effect of second phase when the alloy rolled to plate.

Characterization of dense lead lanthanum titanate ceramics prepared from powders synthesized by the oxidant peroxo method

Energy Technology Data Exchange (ETDEWEB)

Pinto, Alexandre H. [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Departamento de Quimica, UFSCar-Universidade Federal de Sao Carlos, Rod.Washington Luis km 235, CP 676 Sao Carlos, SP 13565-905 (Brazil); Souza, Flavio L., E-mail: flavio.souza@ufabc.edu.br [Centro de Ciencias Naturais e Humanas, Universidade Federal do ABC, Rua Santa Adelia 166, Bangu, Santo Andre, SP 09210-170 (Brazil); Chiquito, Adenilson J., E-mail: chiquito@df.ufscar.br [Departamento de Fisica, UFSCar-Federal University of Sao Carlos, Rod.Washington Luis km 235, CP 676 Sao Carlos, SP 13565-905 (Brazil); Longo, Elson, E-mail: elson@iq.unesp.br [Instituto de Quimica de Araraquara, UNESP-Universidade Estadual Paulista, Rua Francisco Degni, CP 355 Araraquara, SP 14801-907 (Brazil); Leite, Edson R., E-mail: derl@power.ufscar.br [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Departamento de Quimica, UFSCar-Universidade Federal de Sao Carlos, Rod.Washington Luis km 235, CP 676 Sao Carlos, SP 13565-905 (Brazil); Camargo, Emerson R., E-mail: camargo@ufscar.br [LIEC-Laboratorio Interdisciplinar de Eletroquimica e Ceramica, Departamento de Quimica, UFSCar-Universidade Federal de Sao Carlos, Rod.Washington Luis km 235, CP 676 Sao Carlos, SP 13565-905 (Brazil)

2010-12-01

Nanosized powders of lead lanthanum titanate (Pb{sub 1-x}La{sub x}TiO{sub 3}) were synthesized by means of the oxidant-peroxo method (OPM). Lanthanum was added from 5 to 30% in mol through the dissolution of lanthanum oxide in nitric acid, followed by the addition of lead nitrate to prepare a solution of lead and lanthanum nitrates, which was dripped into an aqueous solution of titanium peroxo complexes, forming a reactive amorphous precipitate that could be crystallized by heat treatment. Crystallized powders were characterized by FT-Raman spectroscopy and X-ray powder diffraction, showing that tetragonal perovskite structure is obtained for samples up to 25% of lanthanum and cubic perovskite for samples with 30% of lanthanum. Powders containing 25 and 30% in mol of lanthanum were calcined at 700 deg. C for 2 h, and in order to determine the relative dielectric permittivity and the phase transition behaviour from ferroelectric-to-paraelectric, ceramic pellets were prepared and sintered at 1100 or 1150 deg. C for 2 h and subjected to electrical characterization. It was possible to observe that sample containing 25% in mol of La presented a normal behaviour for the phase transition, whereas the sample containing 30% in mol of La presented a diffuse phase transition and relaxor behaviour.

Characterization of dense lead lanthanum titanate ceramics prepared from powders synthesized by the oxidant peroxo method

International Nuclear Information System (INIS)

Pinto, Alexandre H.; Souza, Flavio L.; Chiquito, Adenilson J.; Longo, Elson; Leite, Edson R.; Camargo, Emerson R.

2010-01-01

Nanosized powders of lead lanthanum titanate (Pb 1-x La x TiO 3 ) were synthesized by means of the oxidant-peroxo method (OPM). Lanthanum was added from 5 to 30% in mol through the dissolution of lanthanum oxide in nitric acid, followed by the addition of lead nitrate to prepare a solution of lead and lanthanum nitrates, which was dripped into an aqueous solution of titanium peroxo complexes, forming a reactive amorphous precipitate that could be crystallized by heat treatment. Crystallized powders were characterized by FT-Raman spectroscopy and X-ray powder diffraction, showing that tetragonal perovskite structure is obtained for samples up to 25% of lanthanum and cubic perovskite for samples with 30% of lanthanum. Powders containing 25 and 30% in mol of lanthanum were calcined at 700 deg. C for 2 h, and in order to determine the relative dielectric permittivity and the phase transition behaviour from ferroelectric-to-paraelectric, ceramic pellets were prepared and sintered at 1100 or 1150 deg. C for 2 h and subjected to electrical characterization. It was possible to observe that sample containing 25% in mol of La presented a normal behaviour for the phase transition, whereas the sample containing 30% in mol of La presented a diffuse phase transition and relaxor behaviour.

Signal amplification of dopamine using lanthanum hexacyanoferrate ...

Indian Academy of Sciences (India)

rare earth metal hexacyanoferrates, for e.g., lanthanum ... to facilitate the electrochemical reactions of biological molecules.9,10 In general ... bic acid and potassium hexacyanoferrate (Merck) were ... were prepared using doubly distilled water.

Leaching behavior of lanthanum, nickel and iron from spent catalyst using inorganic acids

Science.gov (United States)

Astuti, W.; Prilitasari, N. M.; Iskandar, Y.; Bratakusuma, D.; Petrus, H. T. B. M.

2018-01-01

Highly technological applications of rare earth metals (REs) and scarcity of supply have become an incentive torecover the REs from various resources, which include high grade and low grade ores, as well as recycledwaste materials. Spent hydrocracking catalyst contain lanthanum and a variety of valuable metals such as nickel and iron. This study investigated the recovery of lanthanum, nickel and iron from spent hydrocracking catalyst by leaching using various inorganic acid (sulfuric acid, hydrochloric acid, and nitric acid). The effect of acid concentration, type of acid and leaching temperature was conducted to study the leaching behavior of each valuable metal from spent-catalyst. It has been shown that it is possible to recover more than 90% of lanthanum, however the leaching efficiency of nickel and iron in this process was very low. It can be concluded that the leaching process is selective for lanthanum recovery from hydrocracking spent-catalyst.

Eutrophication management in surface waters using lanthanum modified bentonite

DEFF Research Database (Denmark)

Copetti, Diego; Finsterle, Karin; Marziali, Laura

2016-01-01

This paper reviews the scientific knowledge on the use of a lanthanum modified bentonite (LMB) to manage eutrophication in surface water. The LMB has been applied in around 200 environments worldwide and it has undergone extensive testing at laboratory, mesocosm, and whole lake scales. The availa......This paper reviews the scientific knowledge on the use of a lanthanum modified bentonite (LMB) to manage eutrophication in surface water. The LMB has been applied in around 200 environments worldwide and it has undergone extensive testing at laboratory, mesocosm, and whole lake scales....... The available data underline a high efficiency for phosphorus binding. This efficiency can be limited by the presence of humic substances and competing oxyanions. Lanthanum concentrations detected during a LMB application are generally below acute toxicological threshold of different organisms, except in low...... alkalinity waters. To date there are no indications for long-term negative effects on LMB treated ecosystems, but issues related to La accumulation, increase of suspended solids and drastic resources depletion still need to be explored, in particular for sediment dwelling organisms. Application of LMB...

High-temperature, Knudsen cell-mass spectroscopic studies on lanthanum oxide/uranium dioxide solid solutions

International Nuclear Information System (INIS)

Sunder, S.; McEachern, R.; LeBlanc, J.C.

2001-01-01

Knudsen cell-mass spectroscopic experiments were carried out with lanthanum oxide/uranium oxide solid solutions (1%, 2% and 5% (metal at.% basis)) to assess the volatilization characteristics of rare earths present in irradiated nuclear fuel. The oxidation state of each sample used was conditioned to the 'uranium dioxide stage' by heating in the Knudsen cell under an atmosphere of 10% CO 2 in CO. The mass spectra were analyzed to obtain the vapour pressures of the lanthanum and uranium species. It was found that the vapour pressure of lanthanum oxide follows Henry's law, i.e., its value is directly proportional to its concentration in the solid phase. Also, the vapour pressure of lanthanum oxide over the solid solution, after correction for its concentration in the solid phase, is similar to that of uranium dioxide. (authors)

Synthesis characterization and sintering of cobalt-doped lanthanum chromite powders for use in SOFCs

International Nuclear Information System (INIS)

Yamagata, Chieko; Mello-Castanho, Sonia R.H.

2009-01-01

Doped lanthanum chromite is a promising as interconnect material because of its good conductivity at high temperatures and its stability in oxidizing and reducing atmospheres. Perovskite oxide powders of Co-doped lanthanum chromite were synthesized by dispersing precursor metal salt solutions in a polymer matrix followed by a thermal treatment. XRD patterns showed that a highly crystalline cobalt-doped lanthanum chromite was obtained. Fine perovskite powder with a surface area of 6.15 m 2 g -1 calcined at 700 deg C for 1 h, were obtained. After the sample sintered at 1450 deg C for 3h, the powder reached high densities exceeding 97% of the theoretical density. The proposed here has proved to be a very promising technique for the synthesis of lanthanum chromite powders. (author)

Scanning Auger microscopy study of lanthanum partitioning in sphene-based glass-ceramics

International Nuclear Information System (INIS)

Hocking, W.H.; Hayward, P.J.; Watson, D.G.; Allen, G.C.

1984-01-01

Glass-ceramics are being investigated as possible hosts for the radioactive wastes that would result from recycling irradiated nuclear fuels. The partitioning of lanthanum in sphene-based glass-ceramics has been studied by scanning Auger electron microscopy for lanthanum concentrations from 0.2 to 2.0 mol.%. Sphene crystals (CaTiSiO 5 ) were located in the silica-rich glass matrix by recording digital Auger images of the calcium and titanium distributions. The sphene crystals were typically 0.5 to 5 μm in size and occupied approximately 40% of the total specimen volume. Auger spot analyses revealed that lanthanum was strongly partitioned into the sphene phase of phosphorus-free glass-ceramics; however, when a small amount of phosphorus was included in the glass-ceramic composition as a crystal nucleating agent, the lanthanum was concentrated in a third minor phase which also contained calcium, phosphorus and oxygen. Chemical shift effects in the Auger spectra of silicon, titanium and phosphorus showed evidence for electron-stimulated desorption of oxygen. (author)

Bifunctional lanthanum phosphate substrates as novel adsorbents and biocatalyst supports for perchlorate removal

International Nuclear Information System (INIS)

Sankar, Sasidharan; Prajeesh, Gangadharan Puthiya Veetil; Anupama, Vijaya Nadaraja; Krishnakumar, Bhaskaran; Hareesh, Padinhattayil; Nair, Balagopal N.; Warrier, Krishna Gopakumar; Hareesh, Unnikrishnan Nair Saraswathy

2014-01-01

Graphical abstract: Porous lanthanum phosphate substrates, obtained by an environmentally benign thermal gelation process, performed the role of dual functional sorbent facilitating perchlorate adsorption and bioremediation through the growth of perchlorate reducing microbial colonies. - Highlights: • Lanthanum phosphate monoliths as efficient perchlorate adsorbents. • And also as substrates for biofilm (perchlorate reducing bacteria) growth. • Environmentally benign thermal gelation process for substrate fabrication. • 98% adsorption efficiency for perchlorate concentrations up to 100 μg/L. • The regenerated monoliths show nearly 100% reusability. - Abstract: Porous lanthanum phosphate substrates, obtained by an environmentally benign colloidal forming process employing methyl cellulose, are reported here as excellent adsorbents of perchlorate with >98% efficiency and with 100% reusability. Additionally, the effectiveness of such substrates as biocatalyst supports that facilitate biofilm formation of perchlorate reducing microbes (Serratia marcescens NIIST 5) is also demonstrated for the first time. The adsorption of perchlorate ions is attributed to the pore structure of lanthanum phosphate substrate and the microbial attachment is primarily ascribed to its intrinsic hydrophobic property. Lanthanum phosphate thus emerges as a dual functional material that possesses an integrated adsorption/bioremediation property for the effective removal of ClO 4 − which is an increasingly important environmental contaminant

Bifunctional lanthanum phosphate substrates as novel adsorbents and biocatalyst supports for perchlorate removal

Energy Technology Data Exchange (ETDEWEB)

Sankar, Sasidharan [Materials Science and Technology Division (India); Prajeesh, Gangadharan Puthiya Veetil; Anupama, Vijaya Nadaraja [Process Engineering and Environmental Technology Division, CSIR – National Institute for Interdisciplinary Science and Technology, Industrial Estate P.O., Thiruvananthapuram 695019 (India); Krishnakumar, Bhaskaran [Process Engineering and Environmental Technology Division, CSIR – National Institute for Interdisciplinary Science and Technology, Industrial Estate P.O., Thiruvananthapuram 695019 (India); Academy of Scientific and Industrial Research (AcSIR) (India); Hareesh, Padinhattayil [Materials Science and Technology Division (India); Nair, Balagopal N. [R and D Centre, Noritake Co. Ltd., Aichi (Japan); Warrier, Krishna Gopakumar [Materials Science and Technology Division (India); Academy of Scientific and Industrial Research (AcSIR) (India); Hareesh, Unnikrishnan Nair Saraswathy, E-mail: hareesh@niist.res.in [Materials Science and Technology Division (India); Academy of Scientific and Industrial Research (AcSIR) (India)

2014-06-30

Graphical abstract: Porous lanthanum phosphate substrates, obtained by an environmentally benign thermal gelation process, performed the role of dual functional sorbent facilitating perchlorate adsorption and bioremediation through the growth of perchlorate reducing microbial colonies. - Highlights: • Lanthanum phosphate monoliths as efficient perchlorate adsorbents. • And also as substrates for biofilm (perchlorate reducing bacteria) growth. • Environmentally benign thermal gelation process for substrate fabrication. • 98% adsorption efficiency for perchlorate concentrations up to 100 μg/L. • The regenerated monoliths show nearly 100% reusability. - Abstract: Porous lanthanum phosphate substrates, obtained by an environmentally benign colloidal forming process employing methyl cellulose, are reported here as excellent adsorbents of perchlorate with >98% efficiency and with 100% reusability. Additionally, the effectiveness of such substrates as biocatalyst supports that facilitate biofilm formation of perchlorate reducing microbes (Serratia marcescens NIIST 5) is also demonstrated for the first time. The adsorption of perchlorate ions is attributed to the pore structure of lanthanum phosphate substrate and the microbial attachment is primarily ascribed to its intrinsic hydrophobic property. Lanthanum phosphate thus emerges as a dual functional material that possesses an integrated adsorption/bioremediation property for the effective removal of ClO{sub 4}{sup −} which is an increasingly important environmental contaminant.

Separation of lanthanum (3) and samarium (3) extraction with tributylphosphate in the solvent presence of solid phase

International Nuclear Information System (INIS)

Korotkevich, I.B.; Kolesnikov, A.A.; Bomshtejn, V.E.

1990-01-01

Lanthanum (3) and samarium (3) extraction from nitric acid solutions by tributylphosphate in the presence of solid phase has been investigated. An increase in samarium α-nitrate distribution factor in the presence of solid phase with a decrease in its concentration in the initial solution and with lanthanum nitrate concentration increase is detected. The greatest effect of separation is observed in samarium nitrate microregion. The method of quantitative extraction of samarium from lanthanum nitrate solutions with samarium-lanthanum separation factor exceeding 50 has been suggested

Lanthanum benzoyl acetonates: an IR and mass spectrometric study of the composition and structure

International Nuclear Information System (INIS)

Kostyuk, N.N.; Dik, T.A.; Tereshko, N.V.

2005-01-01

IR spectroscopy and mass spectrometry were used to study the structure of lanthanum chelates of benzoyl acetone (1-phenyl-1,3-butadione, HBA) of the following compositions: La(BA) 3 · EtOH, La(BA) 2 , La(BA) 2 · CH 3 CN, and La(BA) 2 · HDA, where EtOH = ethanol, HDA = nonadecanoic acid. It is demonstrated that a quasi-aromatic metalloring is formed in lanthanum chelates studied. Stable metal-containing fragments of the molecular ions of lanthanum bis- and tris-benzoylacetonate were identified [ru

Synthesis and characterization of lanthanum incorporated mesoporous molecular sieves

International Nuclear Information System (INIS)

Pesquera, C.; Gonzalez, F.; Blanco, C.; Sanchez, L.

2004-01-01

A series of mesoporous materials under reflux conditions have been synthesized with two silicon sources (fumed silica and sodium silicate) and lanthanum added. The following Si/La molar ratio was used in the samples: 100; 75; 50 and 25. The calcined products were characterized by means of X-ray diffraction, nitrogen adsorption isotherms and energy dispersive X-ray spectrometry (EDS). The BET surface area gradually decreases with an increase in the lanthanum content of the LaxMCM-41 samples. Moreover, the average pore size tends to decrease along with the increase in the La content in the samples

Physiological responses in barley to applications of lanthanum

International Nuclear Information System (INIS)

Reddy, N.; Maheswaran, J.; Peverill, K.; Meehan, B.

1998-01-01

Full text: Chinese research and glasshouse investigations carried out in Victoria by the authors have shown that several plant species, when treated with Rare Earth Elements (REEs), retain greater amounts of moisture under water stressed conditions. The physiological adaptation of the plant to retain moisture in response to REE treatment however, has not been investigated. A glasshouse trial is currently in progress to study the physiological and agronomic responses of barley (cv. Schooner) grown in pots to application of lanthanum (0, 5 and 10 kg/ha), at a concentration of 0.05%, under well-watered (field capacity) and water-deficit (25 - 30% field capacity) conditions. Lanthanum was applied both directly to the soil and as a foliar spray. The physiological measurements include, photosynthetic rate, leaf water potential, osmotic potential, relative water content, stomatal conductance and water use efficiency. Measured agronomic parameters include plant height, tiller production, leaf area development, total grain weight, total biomass, root and shoot ratio and harvest index. Analysis of plant tissue for N, P, K, Ca, Mg, Zn and La to study the relationship between application of REE and nutrient uptake is also being carried out. The paper discusses physiological and agronomic changes in barley plants in response to treatment with lanthanum, under conditions of water stress

Formulation and Assessment of a Wash-Primer Containing Lanthanum "Tannate" for Steel Temporary Protection

Science.gov (United States)

D'Alessandro, Oriana; Selmi, Gonzalo J.; Deyá, Cecilia; Di Sarli, Alejandro; Romagnoli, Roberto

2018-02-01

Tannins are polyphenols synthesized by plants and useful for the coating industry as corrosion inhibitors. In addition, lanthanum salts have a great inhibitory effect on steel corrosion. The aim of this study was to obtain lanthanum "tannate" with adequate solubility to be incorporated as the corrosion inhibitor in a wash-primer. The "tannate" was obtained from commercial "Quebracho" tannin and 0.1 M La(NO3)3. The soluble tannin was determined by the Folin-Denis reagent, while the concentration of Lanthanum was obtained by a gravimetric procedure. The protective action of "tannate" on SAE 1010 steel was evaluated by linear polarization curves and corrosion potential measurements. Lanthanum "tannate" was incorporated in a wash-primer formulation and tested by corrosion potential and ionic resistance measurements. The corrosion rate was also determined by the polarization resistance technique. Besides, the primer was incorporated in an alkyd paint system and its anticorrosion performance assessed in the salt spray cabinet and by electrochemical impedance spectroscopy. Results showed that lanthanum "tannate" primer inhibits the development of deleterious iron oxyhydroxides on the steel substrate and incorporated into a paint system had a similar behavior to the primer formulated with zinc tetroxychromate.

Separation of lanthanum (3) and neodymium (3) by tributyl phosphate extraction in the presence of solid phase

International Nuclear Information System (INIS)

Korotkevich, I.B.; Kolesnikov, A.A.; Bomshtejn, V.E.; Shikhaleeva, N.N.

1987-01-01

Lanthanum (3) and neodymium (3) extraction from nitric acid solutions by tributyl phosphate in the presence of solid phase of the element nitrates is investigated. An increase in distribution of neodymium nitrate in the presence of solid phase with the decrease in its concentration in the initial solution and with the increase in lanthanum nitrate concentration is detected. The highest effect of extractive-crystallizational separation is observed in the range of neodymium nitrate microconcentrations. A method of neodymium quantitative extraction from lanthanum nitrate solutions with neodymium - lanthanum separation coefficient exceeding 25 is suggested

Interfacial layers in tape cast anode-supported doped lanthanum gallate SOFC elements

Energy Technology Data Exchange (ETDEWEB)

Maffei, N.; De Silveira, G. [Materials Technology Laboratory, Natural Resources Canada, CANMET, 405 Rochester Street, Ottawa, Ontario (Canada) K1A OG3

2003-04-01

Lanthanum gallate doped with strontium and magnesium (LSGM) is a promising electrolyte system for intermediate temperature solid oxide fuel cells (SOFCs). The reported formation of interfacial layers in monolithic type SOFCs based on lanthanum gallate is of concern because of its impact on the performance of the fuel cell. Planar anode-supported SOFC elements (without the cathode) were prepared by the tape casting technique in order to determine the nature of the anode/electrolyte interface after sintering. Two anode systems were studied, one a NiO-CeO{sub 2} cermet, and the other, a modified lanthanum gallate anode containing manganese. Sintering studies were conducted at 1250, 1300, 1350, 1400 and 1450 C to determine the effect of temperature on the interfacial characteristics. Scanning electron microscopy (SEM) revealed a significant diffusion of Ni from the NiO-CeO{sub 2} anode resulting in the formation of an interfacial layer regardless of sintering temperature. Significant La diffusion from the electrolyte into the anode was also observed. In the case of the modified lanthanum gallate anode containing manganese, there was no interfacial layer formation, but a significant diffusion of Mn into the electrolyte was observed.

Preparation of lanthanum ferrite powder at low temperature

Energy Technology Data Exchange (ETDEWEB)

Andoulsi, R.; Horchani-Naifer, K.; Ferid, M., E-mail: karima_horchani@yahoo.com [Physical Chemistry Laboratory of Mineral Materials and their Applications, Hammam-Lif (Tunisia)

2012-01-15

Single lanthanum ferrite phase was successfully prepared at low processing temperature using the polymerizable complex method. To implement this work, several techniques such as differential scanning calorimetry, X-ray diffraction, Fourier Transform Infrared Spectroscopy, scanning electron microscopy and BET surface area measurements were used. Throw the obtained results, it was shown that steps of preparing the powder precursor and temperature of its calcination are critical parameters for avoiding phase segregation and obtaining pure lanthanum ferrite compound. Thus, a single perovskite phase was obtained at 600 deg C. At this temperature, the powder was found to be fine and homogeneous with an average crystallite size of 13 nm and a specific surface area of 12.5 m{sup 2}.g{sup -1}. (author)

Trimethylphosphide isomerization in lanthanum ions presence

International Nuclear Information System (INIS)

Zacharias, M.A.; Massabni, A.M.G.

1984-01-01

The integration between the trimethilphosphide and the lanthanum ions carry to the formation of solid complexes in a relation of 6:1 where the ligand is the phosphonate what is resultant of the isomerization of trimetylphosphite. By the RMN -1 H and infra-red spectra the products were characterized. (L.M.J.) [pt

The air oxidation behavior of lanthanum ion implanted zirconium at 500 deg. C

CERN Document Server

Peng, D Q; Chen, X W; Zhou, Q G

2003-01-01

The beneficial effect of lanthanum ion implantation on the oxidation behavior of zirconium at 500 deg. C has been studied. Zirconium specimens were implanted by lanthanum ions using a MEVVA source at energy of 40 keV with a fluence range from 1x10 sup 1 sup 6 to 1x10 sup 1 sup 7 ions/cm sup 2 at maximum temperature of 130 deg. C, The weight gain curves were measured after being oxidized in air at 500 deg. C for 100 min, which showed that a significant improvement was achieved in the oxidation behavior of zirconium ion implanted with lanthanum compared with that of the as-received zirconium. The valence of the oxides in the scale was analyzed by X-ray photoemission spectroscopy; and then the depth distributions of the elements in the surface of the samples were obtained by Auger electron spectroscopy. Glancing angle X-ray diffraction at 0.3 deg. incident angles was employed to examine the modification of its phase transformation because of the lanthanum ion implantation in the oxide films. It was obviously fou...

Effect of noble metal doping on the structural properties of lanthanum cobaltite

International Nuclear Information System (INIS)

Dharmadhikari, Dipti V.; Athawal, Anjali A.

2016-01-01

Pristine and Noble metal (Ag and Pd) doped lanthanum cobaltite samples have been synthesised by Hydrothermal method. Lanthanum in the A-Site and Co at B-site of Lanthanum cobaltite (LaCoO 3 ) perovskites were partially doped by silver and palladium (4%). Crystal structure analysis revealed that the hydrothermal synthesis led to the formation of pure nanocrystalline perovskite structure. Morphological analysis of the samples shows that the noble metal doping affects the morphology of the samples. Pristine sample shows spherical to oval shaped particles while the doping results in the formation of irregular shaped, spherical and rod shaped particles. Silver doping results in the agglomeration of particles. The particles were observed to be fused with each other to form rod shaped structures in case of palladium doped samples. (author)

Types of defect ordering in undoped and lanthanum-doped Bi2201 single crystals

International Nuclear Information System (INIS)

Martovitsky, V. P.

2006-01-01

Undoped and lanthanum-doped Bi2201 single crystals having a perfect average structure have been comparatively studied by x-ray diffraction. The undoped Bi2201 single crystals exhibit very narrow satellite reflections; their half-width is five to six times smaller than that of Bi2212 single crystals grown by the same technique. This narrowness indicates three-dimensional defect ordering in the former crystals. The lanthanumdoped Bi2201 single crystals with x = 0.7 and T c = 8-10 K exhibit very broad satellite reflections consisting of two systems (modulations) misoriented with respect to each other. The modulation-vector components of these two modulations are found to be q 1 = 0.237b* + 0.277c* and q 2 = 0.238b* + 0.037c*. The single crystals having a perfect average structure and a homogeneous average distribution of doping lanthanum consist of 70-to 80-A-thick layers that alternate along the c axis and have two different types of modulated superlattice. The crystals having a less perfect average structure also consist of alternating layers, but they have different lanthanum concentrations. The low value of T c in the undoped Bi2201 single crystals (9.5 K) correlates with three-dimensional defect ordering in them, and an increase in T c to 33 K upon lanthanum doping can be related to a thin-layer structure of these crystals and to partial substitution of lanthanum for the bismuth positions

AB initio energetics of lanthanum substitution in ferroelectric bismuth titanate

International Nuclear Information System (INIS)

Shah, S.H.

2012-01-01

Density functional theory based electronic structure calculations play a vital role in understanding, controlling and optimizing physical properties of materials at microscopic level. In present study system of interest is bismuth titanate (Bi/sub 4/Ti/sub 3/O/sub 12/)/(BIT) which has wide range of applications such as a high temperature piezoelectric and one of the best material for memory devices. However, it also suffers from serious issues such as oxygen vacancies which degrade its performance as a memory element and piezoelectric material. In this context, the bulk and defect properties of orthorhombic bismuth titanate (Bi/sub 4/Ti/sub 3/O/sub 12/) and bismuth lanthanum titanate (Bi/sub 3.25/La/sub 0.75/Ti/sub 3/O/sub 12/)/(BLT, x=0.75) were investigated by using first principles calculations and atomistic thermodynamics. Heats of formation, valid chemical conditions for synthesis, lanthanum substitution energies and oxygen and bismuth vacancy formation energies were computed. The study improves understanding of how native point defects and substitutional impurities influence the ferroelectric properties of these layered perovskite materials. It was found that lanthanum incorporation could occur on either of the two distinct bismuth sites in the structure and that the effect of substitution is to increase the formation energy of nearby native oxygen vacancies. The results provide direct atomistic evidence over a range of chemical conditions for the suggestion that lanthanum incorporation reduces the oxygen vacancy concentration. Oxygen vacancies contribute to ferroelectric fatigue by interacting strongly with domain walls and therefore a decrease in their concentration is beneficial. (orig./A.B.)

Phase segregation in cerium-lanthanum solid solutions

NARCIS (Netherlands)

Belliere, V.; Joorst, G; Stephan, O; de Groot, FMF; Weckhuysen, BM

2006-01-01

Electron energy-loss spectroscopy (EELS) in combination with scanning transmission electron microscopy ( STEM) reveals that the La enrichment at the surface of cerium-lanthanum solid solutions is an averaged effect and that segregation occurs in a mixed oxide phase. This separation occurs within a

Structural characterization and properties of lanthanum film as chromate replacement for tinplate

International Nuclear Information System (INIS)

Huang Xingqiao; Li Ning

2007-01-01

Sulfide-stain resistance of La-passivated, unpassivated and Cr-passivated tinplate was measured using a cysteine tarnish test. Corrosion behavior of these tinplates was investigated using electrochemical impedance spectroscopy (EIS) measurement. The morphology, composition and thickness of lanthanum film were studied by atomic force microscopy (AFM), X-ray photoelectron spectroscopy (XPS) and X-ray fluorescence spectrometry (XRF), respectively. La-passivation treatment remarkably enhances sulfide-stain resistance of tinplate, and sulfide-stain resistance of La-passivated tinplate is slightly higher than that of Cr-passivated tinplate. La-passivation treatment also significantly improves corrosion protection property of tinplate. In contact with 3.5% NaCl solution, corrosion resistance of La-passivated tinplate is close to that of Cr-passivated tinplate, and in contact with 0.1 M citric-citrate buffer solution, corrosion resistance of La-passivated tinplate is higher than that of Cr-passivated tinplate. Lanthanum film is composed of spherical particles about 50-1000 nm in diameter, while most part of tinplate's surface is covered with the small particles about 50-200 nm. The film mainly consists of lanthanum and oxygen, which mainly exist as La 2 O 3 and its hydrates such as La(OH) 3 and LaOOH. The amount of lanthanum in the film is about 0.0409 g/m 2

Effect of lanthanum doping on electrical and electromechanical ...

Indian Academy of Sciences (India)

Unknown

temperature, Tc increased with the increase of lanthanum content. ... By adding oxide group softeners, hardeners and stabi- ... pressed with 2% polyvinyl alcohol as binder under a ... study are dependent on temperature and are shown in.

Lanthanum Nitrate As Electrolyte Additive To Stabilize the Surface Morphology of Lithium Anode for Lithium-Sulfur Battery.

Science.gov (United States)

Liu, Sheng; Li, Guo-Ran; Gao, Xue-Ping

2016-03-01

Lithium-sulfur (Li-S) battery is regarded as one of the most promising candidates beyond conventional lithium ion batteries. However, the instability of the metallic lithium anode during lithium electrochemical dissolution/deposition is still a major barrier for the practical application of Li-S battery. In this work, lanthanum nitrate, as electrolyte additive, is introduced into Li-S battery to stabilize the surface of lithium anode. By introducing lanthanum nitrate into electrolyte, a composite passivation film of lanthanum/lithium sulfides can be formed on metallic lithium anode, which is beneficial to decrease the reducibility of metallic lithium and slow down the electrochemical dissolution/deposition reaction on lithium anode for stabilizing the surface morphology of metallic Li anode in lithium-sulfur battery. Meanwhile, the cycle stability of the fabricated Li-S cell is improved by introducing lanthanum nitrate into electrolyte. Apparently, lanthanum nitrate is an effective additive for the protection of lithium anode and the cycling stability of Li-S battery.

Synthesis and characterization of lanthanum complex (5-choloro-8-hydroxy quinoline) bis (2-2'bipyridine) lanthanum La(Bpy)2(5-Clq)

Science.gov (United States)

Kumar, Rahul; Soam, Ankur; Bhargava, Parag

2017-05-01

Lanthanum complex, (5-choloro 8-hydroxy quinoline) bis (2-2'bipyridine) has been synthesized and characterized by different techniques. Lanthanum complex, La(Bpy)2(5-Clq) was characterized for structural, thermal and photoluminescence analysis. Structural analysis of this material was done by Fourier transformed infrared spectroscopy (FTIR) and mass spectroscopy. Thermal analysis of this material was done by thermal gravimetric analysis (TGA) and material shows the thermal stability up to 400°C. Absorption and emission spectra of the material was measured by UV-visible spectroscopy and photoluminescence spectroscopy. Solution of this material La(Bpy)2(5-Clq) in ethanol showed absorption peak at 332 nm, which may be attributed due to (π - π*) transitions. The photoluminescence spectra of La(Bpy)2(5-Clq) in ethanol solution showed intense peak at 505 nm.

Plasma spheroidization and high temperature stability of lanthanum phosphate and its compatibility with molten uranium

International Nuclear Information System (INIS)

Ananthapadmanabhan, P.V.; Sreekumar, K.P.; Thiyagarajan, T.K.; Satpute, R.U.; Krishnan, K.; Kulkarni, N.K.; Kutty, T.R.G.

2009-01-01

Lanthanum phosphate has excellent thermal stability and corrosion resistance against many molten metals and other chemically corrosive environments. Lanthanum phosphate (LaPO 4 ) was synthesized from lanthanum oxalate by thermal dissociation of the oxalate to the oxide, followed by conversion to hydrated lanthanum phosphate (LaPO 4 .0.5H 2 O). Thermal treatment of LaPO 4 .0.5H 2 O above 773 K resulted in the irreversible transformation of the hydrated phase to the stable monazite phase. Thermal and chemical stability of monazite was studied by plasma spheroidization experiments using a DC thermal plasma reactor set up. Compatibility of monazite with molten uranium was studied by thermal analysis. Results showed that monazite is thermally stable up to its melting point and also is resistant towards attack by molten uranium. Adherent coatings of LaPO 4 could be deposited onto various substrates by atmospheric plasma spray technique

Nanoscale photoelectron ionisation detector based on lanthanum hexaboride

International Nuclear Information System (INIS)

Zimmer, C.M.; Kunze, U.; Schubert, J.; Hamann, S.; Doll, T.

2011-01-01

A nanoscale ioniser is presented exceeding the limitation of conventional photoionisation detectors. It employs accelerated photoelectrons that allow obtaining molecule specificity by the tuning of ionisation energies. The material lanthanum hexaboride (LaB 6 ) is used as air stable photo cathode. Thin films of that material deposited by pulsed laser deposition (PLD) show quantum efficiency (QE) in the range of 10 -5 which is comparable to laser photo stimulation results. A careful treatment of the material yields reasonable low work functions even after surface reoxidation which opens up the possibility of using ultraviolet light emitting diodes (UV LEDs) in replacement of discharge lamps. Schematic diagram of a photoelectron ionisation detector (PeID) operating by an electron emitter based on the photoelectric effect of lanthanum hexaboride. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

The study of interaction of lanthanum-, cerium- and neodymium chlorides with sodium borohydride in pyridine- and tetrahydrofuran medium

International Nuclear Information System (INIS)

Mirsaidov, U.; Rotenberg, T.G.; Dymova, T.N.

1976-01-01

Bis-tetrahydrofurans of lanthanum and neodymium borohydrides and bis-pyridinates of lanthanum, cerium and neodymium borohydrides were obtained by interacting sodium borohydride with lanthanum-, cerium and neodymium chlorides in pyridine and tetrahydrofuran media. All operations involving reagent combination, sampling and phase separation are performed in inert atmosphere using argonvacuum equipment. The reaction in pyridine was virtually instantaneous and accompanied by flocculanet precipitation. The interaction of lanthanum chloride and neodymium chloride with sodium borohydride in tetrahydrofuran (THF) was a slow (23-30 hr) heterophase process. The interaction rate was affected by size reduction of the intial substances, temperature, reagent proportion and mixing rate. The reaction time was twice reduced with boiling tetrahydrofuran

Plasma spheroidization and high temperature stability of lanthanum phosphate and its compatibility with molten uranium

Energy Technology Data Exchange (ETDEWEB)

Ananthapadmanabhan, P.V. [Laser and Plasma Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)], E-mail: pvananth@barc.gov.in; Sreekumar, K.P.; Thiyagarajan, T.K.; Satpute, R.U. [Laser and Plasma Technology Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Krishnan, K.; Kulkarni, N.K. [Fuel Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kutty, T.R.G. [Radiometallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

2009-01-15

Lanthanum phosphate has excellent thermal stability and corrosion resistance against many molten metals and other chemically corrosive environments. Lanthanum phosphate (LaPO{sub 4}) was synthesized from lanthanum oxalate by thermal dissociation of the oxalate to the oxide, followed by conversion to hydrated lanthanum phosphate (LaPO{sub 4}.0.5H{sub 2}O). Thermal treatment of LaPO{sub 4}.0.5H{sub 2}O above 773 K resulted in the irreversible transformation of the hydrated phase to the stable monazite phase. Thermal and chemical stability of monazite was studied by plasma spheroidization experiments using a DC thermal plasma reactor set up. Compatibility of monazite with molten uranium was studied by thermal analysis. Results showed that monazite is thermally stable up to its melting point and also is resistant towards attack by molten uranium. Adherent coatings of LaPO{sub 4} could be deposited onto various substrates by atmospheric plasma spray technique.

Lanthanum chromite colloidal processing

International Nuclear Information System (INIS)

Setz, Luiz Fernando Grespan

2009-01-01

Lanthanum chromite (LaCrO 3 ) is currently the most studied material for applications such as solid oxide fuel cell inter connector (HTSOFC). The complexity of microstructures and geometries of HTSOFC devices, require a precise control of processing parameters to get the desired combination of properties and this, the use of techniques involving concentrated ceramic slips conformation are appropriate, therefore, is well controlled, assist in obtaining homogeneous parts, reproductive and complex geometries. Thus, studies involving the surface chemistry, the stability conditions and slips flow behaviour in the forming conditions, provide important elements for processes control in the inter connectors manufacture, where more applied settings have slots and channels for the gases passage. Thus, surface chemistry, stability and rheological behaviour of strontium and cobalt doped LaCrO 3 (La) 0.80 Sr 0. 2 0 Cr 0.92 Co 0.08 O 3 ) slips prepared with ethanol and water, were studied. The doped lanthanum chromite was produced by combustion synthesis in the IPEN/SP labs. The influence of parameters: pH (water), dispersant concentration, homogenization times and conditions, solid concentration, different ratios binder:plasticizer in the stability and the flow behavior of ceramic suspensions prepared were evaluated. The La) 0.80 Sr 0. 2 0 Cr 0.92 Co 0.08 O 3 products obtained by casting aqueous slips in a plaster mould, using alkaline pH and anionic polyelectrolyte and tapes obtained by using ethanol as a dispersant medium, after sintering at 1600 degree C/4 hours presented theoretical density > 94%, suitable for use as HTSOFC inter connector. (author)

Exchange, x-ray and IR spectral behaviour of lanthanum and praseodymium exchanged zeolite X

International Nuclear Information System (INIS)

Das, D.; Upreti, M.C.

1995-01-01

Exchange behaviour of lanthanum and praseodymium ions in zeolite X involves three steps: preferential exchange, intrazeolitic exchange and irreversible exchange. At room temperature , higher exchange has been observed with La(III) than with Pr(III) which is attributed to the smaller hydrosphere of lanthanum than praseodymium. IR spectra of these zeolites in KBr pellets show a shift in the major Si-O stretching vibration of 972 cm -1 to higher frequencies. Their x-ray diffraction patterns remain unchanged except a large decrease of the line intensities caused by the absorption of x-rays by heavy La(III) and Pr(III) ions. The present study reports the preparation and physicochemical properties of lanthanum and praseodymium exchanged zeolite X. (author). 12 refs., 3 figs., 3 tabs

40 CFR 141.700 - General requirements.

Science.gov (United States)

2010-07-01

... described in §§ 141.721 through 141.722. (7) Systems must address significant deficiencies identified in... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements. 141.700 Section 141.700 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

Lake responses following lanthanum-modified bentonite clay (Phoslock) application: an analysis of water column lanthanum data from 16 case study lakes

NARCIS (Netherlands)

Spears, B.M.; Lürling, M.F.L.L.W.; Yasseri, S.; Castro-Castellon, A.T.; Gibbs, M.; Meis, S.; McDonald, C.; McIntosh, J.; Sleep, D.; Oosterhout, van F.

2013-01-01

Phoslock is a lanthanum (La) modified bentonite clay that is being increasingly used as a geo-engineering tool for the control of legacy phosphorus (P) release from lake bed sediments to overlying waters. This study investigates the potential for negative ecological impacts from elevated La

18 CFR 284.141 - Applicability.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 284.141 Section 284.141 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Sales by Intrastate Pipelines § 284.141 Applicability. This subpart implements section 311(b) of...

40 CFR 141.89 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.89 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.89 Analytical methods. (a... shall be conducted with the methods in § 141.23(k)(1). (1) Analyses for alkalinity, calcium...

On dependence of stability of lanthanum complexes with aminopolycarboxylic acids on the complex structure

International Nuclear Information System (INIS)

Poluehktov, N.S.; Meshkova, S.B.; Danilkovich, M.M.; Topilova, Z.M.

1985-01-01

Regularities in changes of stability constants of lanthanum complexes with aminopolycarboxylic acids (APA) versus their structure are studied, The stability of lathanum-APA complexes depends mainly on the number of carboxyl groups in a ligand molecule. At that, the highest stability constant is characteristic of a complex with a ligand, containing 3 nitrogen atoms and 5 carboxyl groups, in the presenoe of which the lanthanum ion coordination sphere gets satupated. The oxyethy group introduction into a ligand molecule also improves the lanthanum complex stability but to a lesser degree than during the introduction of a carboxyl group. The number of nitrogen atoms in a ligand polecule affects insignificantly the complex stability constant value, and the elongation of a chain of CH 2 groups, separating nitrogen atoms, reduces the constant to a -0.6 power

Order parameters in lanthanum gallate lightly doped with manganese and paramagnetic resonance

Science.gov (United States)

Vazhenin, V. A.; Potapov, A. P.; Artyomov, M. Yu.; Guseva, V. B.

2010-09-01

The Cr3+ centers have been revealed, transitions at room temperature have been identified, and spin Hamiltonian parameters have been determined for the Cr3+ and Fe3+ triclinic centers in lanthanum gallate lightly doped with manganese. The principal axes of the fourth-rank fine-structure tensor for the Fe3+ triclinic centers have been established and used to determine the order parameters, i.e., the angles of rotation of oxygen octahedra of lanthanum gallate with respect to the perovskite structure. The order parameter in the rhombohedral phase has been estimated.

Textile Dye Removal from Aqueous Solution using Modified Graphite Waste/Lanthanum/Chitosan Composite

Science.gov (United States)

Kusrini, E.; Wicaksono, B.; Yulizar, Y.; Prasetyanto, EA; Gunawan, C.

2018-03-01

We investigated various pre-treatment processes of graphite waste using thermal, mechanical and chemical methods. The aim of this work is to study the performance of modified graphite waste/lanthanum/chitosan composite (MG) as adsorbent for textile dye removal from aqueous solution. Effect of graphite waste resources, adsorbent size and lanthanum concentration on the dye removal were studied in batch experiments. Selectivity of MG was also investigated. Pre-heated graphite waste (NMG) was conducted at 80°C for 1 h, followed by mechanical crushing of the resultant graphite to 75 μm particle size, giving adsorption performance of ˜58%, ˜67%, ˜93% and ˜98% of the model dye rhodamine B (concentration determined by UV-vis spectroscopy at 554 nm), methyl orange (464 nm), methylene blue (664 nm) and methyl violet (580 nm), respectively from aqueous solution. For this process, the system required less than ˜5 min for adsorbent material to be completely saturated with the adsorbate. Further chemical modification of the pre-treated graphite waste (MG) with lanthanum (0.01 – V 0.03 M) and chitosan (0.5% w/w) did not improve the performance of dye adsorption. Under comparable experimental conditions, as those of the ‘thermal-mechanical-pre-treated-only’ (NMG), modification of graphite waste (MG) with 0.03 M lanthanum and 0.5% w/w chitosan resulted in ˜14%, ˜47%, ˜72% and ˜85% adsorption of rhodamine B, methyl orange, methylene blue and methyl violet, respectively. Selective adsorption of methylene blue at most to ˜79%, followed by methyl orange, methyl violet and rhodamine B with adsorption efficiency ˜67, ˜38, and ˜9% sequentially using MG with 0.03 M lanthanum and 0.5% w/w chitosan.

10 CFR 63.141 - Scope.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Scope. 63.141 Section 63.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Quality Assurance § 63.141 Scope. As used in this part, quality assurance comprises all those...

XPS characterisation of in situ treated lanthanum oxide and hydroxide using tailored charge referencing and peak fitting procedures

International Nuclear Information System (INIS)

Sunding, M.F.; Hadidi, K.; Diplas, S.; Lovvik, O.M.; Norby, T.E.; Gunnaes, A.E.

2011-01-01

Highlights: → Gold particles deposited in vacuum as energy reference for insulating samples in XPS. → Separation of La 3d and MNN peaks in XP spectra acquired with Al Kα radiation. → We describe the spectral differences between lanthanum oxide and lanthanum hydroxide. → A doublet in O 1s of La 2 O 3 is ascribed to two distinct oxygen sites in the crystal. - Abstract: A technique is described for deposition of gold nanoparticles under vacuum, enabling consistent energy referencing of X-ray photoelectron spectra obtained from lanthanum hydroxide La(OH) 3 and in situ treated lanthanum oxide La 2 O 3 powders. A method is also presented for the separation of the overlapping lanthanum 3d and MNN peaks in X-ray photoelectron spectra acquired with Al Kα radiation. The lower satellite intensity in La(OH) 3 compared to La 2 O 3 is related to the higher ionicity of the La-O bond in the former compared to the latter compound. The presence of an additional peak in the valence band spectrum of the hydroxide compared to the oxide is attributed to the O-H bond as indicated by density functional theory based calculations. A doublet in the O 1s peak of lanthanum oxide is associated to the presence of two distinct oxygen sites in the crystal structure of this compound.

Electrochemical corrosion of lanthanum chromite and yttrium chromite in coal slag

Energy Technology Data Exchange (ETDEWEB)

Marchant, D.D.; Bates, J.L.

1981-01-01

Lanthanum chromites have long been considered as electrodes for magnetohydrodynamic (MHD) generator channels. These chromites, when doped with divalent ions such as Ca, Mg or Sr, have adequate electronic and electrical conductivity (2), and melting points greater than 2500/sup 0/K. However, above approx. 1850/sup 0/K, selective vapor loss of chromium results in the formation of a La/sub 2/O/sub 3/ phase. The La/sub 2/O/sub 3/ is hydroscopic at room temperature, resulting in a large volume change and loss of mechanical integrity when exposed to H/sub 2/O. The analogous yttrium chromites have thermal and electrical properties similar to that for the lanthanum chromites. Although vapor loss of Cr results in the formation of Y/sub 2/O/sub 3/, this oxide does not hydrate. Corrosion studies of yttrium chromite compositions show that doped YCrO/sub 3/ may be a viable MHD electrode. An electrochemical corrosion study of both magnesium-doped lanthanum and yttrium chromites in synthetic coal slag electrolytes is described. Possible chemical and electrochemical degradation phenomena, as well as the relative rates of corrosion are emphasized.

Phase transformations in lead zirconate-titanate doped with lanthanum

Energy Technology Data Exchange (ETDEWEB)

Ishchuk, V M; Morozov, E M

1979-07-01

Presented are the results of studies on the character of phase transitions of the lead-lanthanum zirconate-titanate (LLZT) system. The replacement of lead by lanthanum leads to the expansion of the region of antisegnetoelectric (ASE) states of solid solutions of lead zirconate-titanate (LZT) in the direction of PbTiO/sub 3/ concentration growth. An intermediate region is revealed between segnetoelectric (SE) and ASE states, material properties in which depend on their prehistory: annealed samples are in the ASE state, whereas the application of electric field exceeding some critical value induces the SE state. A family of phase diagrams obtained at consequent replacement of lead by lanthanum permits to identify phase states in any series of LLZT with a constant ratio of Zr:Ti, in the x/65/35 series in particular. Thermally depolarized state of materials of this series at x<6.5 is shown to be antisegnetoelectric at all the temperatures below the Curie point Tsub(c), and heating causes phase transition of ASE..-->..PE (paraelectric state) at Tsub(c). Polarized samples being heated, a successiveness of phase transitions of SE..-->..ASE takes place at T/sub 0/, and that of ASE reversible PE at Tsub(C) (Tsub(0)..ASE phase transition in the LZT system.

XPS characterisation of in situ treated lanthanum oxide and hydroxide using tailored charge referencing and peak fitting procedures

Energy Technology Data Exchange (ETDEWEB)

Sunding, M.F., E-mail: m.f.sunding@fys.uio.no [Department of Physics, University of Oslo, P.O. Box 1048 Blindern, NO-0316 Oslo (Norway); Hadidi, K. [Department of Physics, University of Oslo, P.O. Box 1048 Blindern, NO-0316 Oslo (Norway); Diplas, S. [Department of Chemistry and Centre for Material Science and Nanotechnology (SMN), University of Oslo, P.O. Box 1033 Blindern, NO-0315 Oslo (Norway); SINTEF Materials and Chemistry, P.O. Box 124 Blindern, NO-0314 Oslo (Norway); Lovvik, O.M. [Department of Physics, University of Oslo, P.O. Box 1048 Blindern, NO-0316 Oslo (Norway); SINTEF Materials and Chemistry, P.O. Box 124 Blindern, NO-0314 Oslo (Norway); Norby, T.E. [Department of Chemistry and Centre for Material Science and Nanotechnology (SMN), University of Oslo, P.O. Box 1033 Blindern, NO-0315 Oslo (Norway); Gunnaes, A.E. [Department of Physics, University of Oslo, P.O. Box 1048 Blindern, NO-0316 Oslo (Norway)

2011-07-15

Highlights: {yields} Gold particles deposited in vacuum as energy reference for insulating samples in XPS. {yields} Separation of La 3d and MNN peaks in XP spectra acquired with Al K{alpha} radiation. {yields} We describe the spectral differences between lanthanum oxide and lanthanum hydroxide. {yields} A doublet in O 1s of La{sub 2}O{sub 3} is ascribed to two distinct oxygen sites in the crystal. - Abstract: A technique is described for deposition of gold nanoparticles under vacuum, enabling consistent energy referencing of X-ray photoelectron spectra obtained from lanthanum hydroxide La(OH){sub 3} and in situ treated lanthanum oxide La{sub 2}O{sub 3} powders. A method is also presented for the separation of the overlapping lanthanum 3d and MNN peaks in X-ray photoelectron spectra acquired with Al K{alpha} radiation. The lower satellite intensity in La(OH){sub 3} compared to La{sub 2}O{sub 3} is related to the higher ionicity of the La-O bond in the former compared to the latter compound. The presence of an additional peak in the valence band spectrum of the hydroxide compared to the oxide is attributed to the O-H bond as indicated by density functional theory based calculations. A doublet in the O 1s peak of lanthanum oxide is associated to the presence of two distinct oxygen sites in the crystal structure of this compound.

Lanthanum Deposition in the Stomach in the Absence of Helicobacter pylori Infection.

Science.gov (United States)

Iwamuro, Masaya; Urata, Haruo; Tanaka, Takehiro; Kawano, Seiji; Kawahara, Yoshiro; Kimoto, Katsuhiko; Okada, Hiroyuki

2018-03-15

In this case report, we describe two patients who showed a diffusely whitish mucosa in the posterior wall and the lesser curvature of the gastric body. The patients were serologically- and histopathologically-negative for Helicobacter pylori. Random biopsy specimens from the stomach revealed no regenerative changes, intestinal metaplasia, and/or foveolar hyperplasia in either of the patients. Although lanthanum deposition in the gastric mucosa has been reported to occur in close association with H. pylori-associated gastritis, our patients tested negative for H. pylori. These cases suggest that lanthanum deposition presents as whitish lesions in the gastric body in H. pylori-negative patients.

Properties of lanthanum hexaboride a compilation

CERN Document Server

Fisher, D J

2013-01-01

Lanthanum hexaboride is useful because it possesses a high melting point (2210C), a low work function, one of the highest known electron emissivities, and is stable in vacuum. This volume summarises the extant data on the properties of this material, including the: bulk modulus, conductivity, crystal structure, Debye temperature, defect structure, elastic constants, electronic structure, emissivity, Fermi surface, hardness, heat capacity, magnetoresistance, reflectivity, resistivity, specific heat, surface structure, thermal conductivity, thermoelectric power, toughness and work function. The

Lake responses following lanthanum-modified bentonite clay (Phoslock®) application: an analysis of water column lanthanum data from 16 case study lakes.

Science.gov (United States)

Spears, Bryan M; Lürling, Miquel; Yasseri, Said; Castro-Castellon, Ana T; Gibbs, Max; Meis, Sebastian; McDonald, Claire; McIntosh, John; Sleep, Darren; Van Oosterhout, Frank

2013-10-01

Phoslock(®) is a lanthanum (La) modified bentonite clay that is being increasingly used as a geo-engineering tool for the control of legacy phosphorus (P) release from lake bed sediments to overlying waters. This study investigates the potential for negative ecological impacts from elevated La concentrations associated with the use of Phoslock(®) across 16 case study lakes. Impact-recovery trajectories associated with total lanthanum (TLa) and filterable La (FLa) concentrations in surface and bottom waters were quantified over a period of up to 60 months following Phoslock(®) application. Both surface and bottom water TLa and FLa concentrations were 0.8 mEq L(-1)), but higher (up to 0.12 mg L(-1)) in lakes characterised by very low alkalinity. The effects of elevated La(3+) concentrations following Phoslock(®) applications in lakes of very low alkalinity requires further evaluation. The implications for the use of Phoslock(®) in eutrophication management are discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

Conductometric study of lanthanum chloride interaction with potash soaps of higher fatty acids

International Nuclear Information System (INIS)

Skrylev, L.D.; Sazonova, V.F.; Kornelli, M.Eh.; Shumilina, N.A.

1978-01-01

Interaction of lanthanum chloride with potassium salts of higher aliphatic acids, containing from 10 to 16 carbon atoms, at room temperature in weakly acid media (pH=5.5) gives rise to neutral soaps of the La[CHsub(3)(CHsub(2))sub(n)COO]sub(3) composition, while in alkaline media (pH=8.0) base soaps of the LaOH[CHsub(3)(CHsub(2))sub(n)COO]sub(2) composition are formed. In acid solutions (pH=2.0) no interaction of lanthanum chloride with potassium soaps of the above carboxylic acids is observed

Dicty_cDB: VHI141 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

Room temperature synthesis of high temperature stable lanthanum phosphate–yttria nano composite

International Nuclear Information System (INIS)

Sankar, Sasidharan; Raj, Athira N.; Jyothi, C.K.; Warrier, K.G.K.; Padmanabhan, P.V.A.

2012-01-01

Graphical abstract: A facile aqueous sol–gel route involving precipitation–peptization mechanism followed by electrostatic stabilization is used for synthesizing nanocrystalline composite containing lanthanum phosphate and yttria. Highlights: ► A novel lanthanum phosphate–Y 2 O 3 nano composite is synthesized for the first time using a modified facile sol gel process. ► The composite becomes crystalline at 600 °C and X-ray diffraction pattern is indexed for monoclinic LaPO 4 and cubic yttria. ► The composite synthesized was tested up to 1300 °C and no reaction between the phases of the constituents is observed with the morphologies of the phases being retained. -- Abstract: A facile aqueous sol–gel route involving precipitation–peptization mechanism followed by electrostatic stabilization is used for synthesizing nanocrystalline composite containing lanthanum phosphate and yttria. Lanthanum phosphate (80 wt%)–yttria (20 wt%) nano composite (LaPO 4 –20%Y 2 O 3 ), has an average particle size of ∼70 nm after heat treatment of precursor at 600 °C. TG–DTA analysis reveals that stable phase of the composite is formed on heating the precursor at 600 °C. The TEM images of the composite show rod shape morphology of LaPO 4 in which yttria is acquiring near spherical shape. Phase identification of the composite as well as the phase stability up to 1300 °C was carried out using X-ray diffraction technique. With the phases being stable at higher temperatures, the composite synthesized should be a potential material for high temperature applications like thermal barrier coatings and metal melting applications.

Structural consideration with respect to the thermal stability of a new platinum supported lanthanum-alumina catalyst

International Nuclear Information System (INIS)

Oudet, F.; Bordes, E.; Courtine, P.; Maxant, G.; Lambert, C.; Guerlet, J.P.

1987-01-01

The influence of lanthanum aluminate, LaAlO 3 , on the thermal stability of both alumina and platinum supported alumina catalysts is investigated. In the case of alumina, the stabilization is interpreted in terms of structural coherence between δ-Al 2 O 3 and a three-fold superstructure of LaAlO 3 . The addition of LaAlO 3 , is shown to increase both the dispersion and the resistance to sintering of the platinum supported alumina catalyst. Moreover, lanthanum hexa-aluminate (La-β-Al 2 O 3 ) is present in the platinum catalyst fired at 1150 0 C. These observations are assumed to result for the epitaxial relations between platinum and the lanthanum-alumina support. 23 refs.; 8 figs.; 2 tabs

Investigation of paramagnetic saturation in lanthanum manganese nitrate

NARCIS (Netherlands)

Flokstra, Jakob; Meijer, H.C.; Bots, G.J.C.; Verheij, W.A.; van der Marel, L.C.

1973-01-01

Paramagnetic saturation of lanthanum manganese nitrate, La2Mn3(NO3)12·24H2O, has been investigated at liquid He temperatures in a static as well as a dynamical way. With the aid of the molecular-field theory the Casimir and Du Pré dispersion and absorption curves are adapted explicitly to the

40 CFR 141.76 - Recycle provisions.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

Deposition barium titanate (BaTiO3) doped lanthanum with chemical solution deposition

International Nuclear Information System (INIS)

Iriani, Y.; Nurhadi, N.; Jamaludin, A.

2016-01-01

Deposition of Barium Titanate (BaTiO 3 ) thin films used Chemical Solution Deposition (CSD) method and prepared with spin coater. BaTiO 3 is doped with lanthanum, 1%, 2%, and 3%. The thermal process use annealing temperature 900°C and holding time for 3 hours. The result of characterization with x-ray diffraction (XRD) equipment show that the addition of La 3+ doped on Barium Titanate caused the change of angle diffraction.The result of refine with GSAS software shows that lanthanum have been included in the structure of BaTiO 3 . Increasing mol dopant La 3+ cause lattice parameter and crystal volume become smaller. Characterization result using Scanning Electron Microscopy (SEM) equipment show that grain size (grain size) become smaller with increasing mole dopant (x) La 3+ . The result of characterization using Sawyer Tower methods show that all the samples (Barium Titanante and Barium Titanate doped lanthanum) are ferroelectric material. Increasing of mole dopant La 3+ cause smaller coercive field and remanent polarization increases. (paper)

Eucalyptus tolerance mechanisms to lanthanum and cerium: subcellular distribution, antioxidant system and thiol pools.

Science.gov (United States)

Shen, Yichang; Zhang, Shirong; Li, Sen; Xu, Xiaoxun; Jia, Yongxia; Gong, Guoshu

2014-12-01

Guanglin 9 (Eucalyptus grandis × Eucalyptus urophlla) and Eucalyptus grandis 5 are two eucalyptus species which have been found to grow normally in soils contaminated with lanthanum and cerium, but the tolerance mechanisms are not clear yet. In this study, a pot experiment was conducted to investigate the tolerance mechanisms of the eucalyptus to lanthanum and cerium. Cell walls stored 45.40-63.44% of the metals under lanthanum or cerium stress. Peroxidase and catalase activities enhanced with increasing soil La or Ce concentrations up to 200 mg kg(-1), while there were no obvious changes in glutathione and ascorbate concentrations. Non-protein thiols concentrations increased with increasing treatment levels up to 200 mg kg(-1), and then decreased. Phytochelatins concentrations continued to increase under La or Ce stress. Therefore, the two eucalyptus species are La and Ce tolerant plants, and the tolerance mechanisms include cell wall deposition, antioxidant system response, and thiol compound synthesis. Copyright © 2014 Elsevier Ltd. All rights reserved.

40 CFR 141.70 - General requirements.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.70 General requirements. (a... regulations establish criteria under which filtration is required as a treatment technique for public water... filtration requirements in § 141.73 and the disinfection requirements in § 141.72(b). (c) Each public water...

14 CFR 141.23 - Advertising limitations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

Fabrication of Polycrystalline Lanthanum Manganite (La0.99 Mn0.01 O3) Powder and Fibres by Electrospinning Method

International Nuclear Information System (INIS)

Yin Yin Win; That Htar Lwin; Than Than Win; Yin Maung Maung; Ko Ko Kyaw Soe

2011-12-01

Lanthanum manganite (La0.99 Mn0.01 O3) powder have been prepared by using pyrolysis methods. Lanthanum manganite fibres were successfully fabricated by electro-spinning utilizing precursors. Polycrystalline perovskite structure lanthanum manganite powder and fibres showed that the grain size and crystal grain increased significantly with the increase in calcination temperature. A variety of techniques (SEM, FT-IR and TG-DTA) were employed to study the morphology and fibre quality, crystal structure, and thermal analysis of La0.99 Mn0.01 O3 specimen respectively.

The Catalytic Activity of Modified Zeolite Lanthanum on the Catalytic Cracking of Al-Duara Atmospheric Distillation Residue

Directory of Open Access Journals (Sweden)

Karim Khalifa Esgair

2016-03-01

Full Text Available Atmospheric residue fluid catalytic cracking was selected as a probe reaction to test the catalytic performance of modified NaY zeolites and prepared NaY zeolites. Modified NaY zeolites have been synthesized by simple ion exchange methods. Three samples of modified zeolite Y have been obtained by replacing the sodium ions in the original sample with lanthanum and the weight percent added are 0.28, 0.53, and 1.02 respectively. The effects of addition of lanthanum to zeolite Y in different weight percent on the cracking catalysts were investigated using an experimental laboratory plant scale of fluidized bed reactor. The experiments have been performed with weight hourly space velocity (WHSV range of 6 to 24 h-1, and the range of temperature from 450 to 510 oC. The activity of the catalyst with 1.02 wt% lanthanum has been shown to be much greater than that of the sample parent NaY. Also it was observed that the addition of the lanthanum causes an increase in the thermal stability of the zeolite.

47 CFR 101.141 - Microwave modulation.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

14 CFR 141.91 - Satellite bases.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

Stability constant of the lanthanum complex with humic acid

International Nuclear Information System (INIS)

Jimenez R, M.; Solache R, M. J.

2008-01-01

The work described here is a study on the formation of trivalent lanthanum complex with humic acid. Commercial humic acid was purified and then characterized by various analytical techniques. The stability constant determined by a radiochemical method has a worth of log β La , AHA = 13.6. (Author)

Revised energy levels of singly ionized lanthanum

Science.gov (United States)

Güzelçimen, Feyza; Tonka, Mehdi; Uddin, Zaheer; Bhatti, Naveed Anjum; Windholz, Laurentius; Kröger, Sophie; Başar, Gönül

2018-05-01

Based on the experimental wavenumbers of 344 spectral lines from calibrated Fourier transform (FT) spectra as well as wavenumbers of 81 lines from the wavelength tables from literature, the energy of 115 fine structure levels of singly ionized lanthanum has been revised by weighted global fits. The classifications of the lines are provided by numerous previous investigations of lanthanum by different spectroscopic methods and authors. For the high accurate determination of the center of gravity wavenumbers from the experimental spectrum, the hyperfine constants of the involved levels have been taken into account, if possible. For the 94 levels with known hyperfine constants the accuracy of energy values is better than 0.01 cm-1. For 34 levels the magnetic dipole hyperfine constants A have been determined from FT spectra as part of this work. For four of these 34 levels even electric quadrupole hyperfine constants B could be estimated. For levels, which have experimentally unknown hyperfine constants and which are connected only by lines not found in the FT spectra but taken from literature, the uncertainties of energy values are about a factor of 10 higher. A list of all revised level energies together with a compilation of hyperfine structure data is given as well as a list of all lines used.

22 CFR 141.5 - Compliance information.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

19 CFR 141.88 - Computed value.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

14 CFR 1264.141 - Judicial review.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

25 CFR 141.16 - Price marking.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Price marking. 141.16 Section 141.16 Indians BUREAU OF... AND ZUNI RESERVATIONS General Business Practices § 141.16 Price marking. The price of each article... visible to the customer and that affords the customer a reasonable opportunity to learn the price of the...

Effects of intravenously injected lanthanum chloride on the femur of rats

International Nuclear Information System (INIS)

Miyagawa, Makoto; Daimon, Tateo

2010-01-01

Lanthanum (La) is widely used in industry and medicine. Because of lanthanum's physicochemical resemblance to calcium, the possible effects of it on bone have to be considered. The aim of this study was to examine the effects of La on bone toxicity. Rats were intravenously administrated with lanthanum chloride at 5 mg La/kg per week for five weeks. Histomorphometric analysis of femurs were performed using micro-CT scan. Compared with normal controls, the total bone area of the femur did not show any change in La-administrated rats, whereas the trabecular area slightly decreased. The trabecular bone mineral density in the experimented rats was higher than that in the normal controls, although the mineral density of the cortical bone and cancerou one was unchanged after the administration of La. La did not alter mechanical barometers of the femur such as mean cross-sectional moment of inertia, minimum cross-sectional moment of inertia and polar moment of inertia. Additionally, light microscopic analysis of the femurs revealed that histological features of osteoid, calcification front and bone matrix were normal after the administration of La. La was detected in the macrophages in the bone marrow, but not in the bone matrix by histological stain for La and X-ray fluorescence microanalysis. Thus, these micro-CT imaging and microscopy of the femurs did not reveal toxic changes due to La. (author)

Microstructured fibers with high lanthanum oxide glass core for nonlinear applications

Science.gov (United States)

Kobelke, J.; Schuster, K.; Litzkendorf, D.; Schwuchow, A.; Kirchhof, J.; Bartelt, H.; Tombelaine, V.; Leproux, P.; Couderc, V.; Labruyere, A.

2009-05-01

We demonstrate a low loss microstructured fiber (MOF) with a high nonlinear glass core and silica holey cladding. The substitution of mostly used silica as core material of microstructured fibers by lanthanum oxide glass promises a high nonlinear conversion efficiency for supercontinuum (SC) generation. The glass composition is optimized in terms of thermochemical and optical requirements. The glass for the MOF core has a high lanthanum oxide concentration (10 mol% La2O3) and a good compatibility with the silica cladding. This is performed by adding a suitable alumina concentration up to 20 mol%. The lanthanum oxide glass preform rods were manufactured by melting technique. Besides purity issues the material homogeneity plays an important role to achieve low optical loss. The addition of fluorides allows the better homogenization of the glass composition in the preform volume by refining. The minimum attenuation of an unstructured fiber drawn from this glass is about 0.6 dB/m. It is mostly caused by decreasing of scattering effects. The microstructured silica cladding allows the considerable shifting of dispersive behavior of the MOF for an optimal pump light conversion. The MOF shows zero dispersion wavelengths (ZDW) of 1140 nm (LP01 mode) and 970 nm (LP11 mode). The supercontinuum generation was investigated with a 1064 nm pump laser (650 ps). It shows a broad band emission between 500 nm and 2200 nm.

Preparation, characterization and optical properties of Lanthanum-(nanometer MCM-41) composite materials

International Nuclear Information System (INIS)

Zhai, Q. Z.; Wang, P.

2008-01-01

Nanometer MCM-41 molecular sieve was prepared under a base condition by using cetyltrimethylammonium bromide as template and tetraethyl orthosilicate as silica source by means of hydrothermal method. Lanthanum(III) was incorporated into the nanometer MCM-41 by a liquid phase grafting method. The prepared nano composite materials were characterized by means of powder X-ray diffraction, spectrophotometric analysis, Fourier transform infrared spectroscopy, low temperature nitrogen adsorption-desorption technique, solid diffuse reflectance absorption spectra and luminescence. The powder X-ray diffraction studies show that the nanometer MCM-41 molecular sieve is successfully prepared. The highly ordered meso porous two-dimensional hexagonal channel structure and framework of the support MCM-41 is retained intact in the prepared composite material La-(nanometer MCM-41). The spectrophotometric analysis indicates that lanthanum exists in the prepared nano composite materials. The Fourier transform infrared spectra indicate that the framework of the MCM-41 molecular sieve still remains in the prepared nano composite materials and some framework vibration peaks show blue shifts relative to those of the MCM-41 molecular sieve. The low temperature nitrogen adsorption-desorption indicates that the guest locales in the channel of the molecular sieve. Compared with bulk lanthanum oxide, the guest in the channel of the molecular sieve has smaller particle size and shows a significant blue shift of optical absorption band in solid diffuse reflectance absorption spectra. The observed blue shift in the solid state diffuse reflectance absorption spectra of the lanthanum-(nanometer MCM-41) sample show the obvious stereoscopic confinement effect of the channel of the host on the guest, which further indicates the successful encapsulation of the guest in the host. The La-(nanometer MCM-41) sample shows luminescence

Energetically benign synthesis of lanthanum silicate through “silica garden” route and its characterization

Energy Technology Data Exchange (ETDEWEB)

Parmar, Kavita [Central University of Jharkhand, Ranchi (India); Bhattacharjee, Santanu, E-mail: santanu@nmlindia.org [CSIR-National Metallurgical Laboratory, Jamshedpur (India)

2017-06-15

Lanthanum silicate synthesis through “silica garden” route has been reported as an alternative to energy intensive milling procedure. Under optimum conditions lanthanum chloride crystals react with water glass (sodium silicate) to produce self generating hollow lanthanum silicate precipitation tube(s) (LaSPT). The micro tubes are irregular, thick, white coloured and amorphous but are hierarchically built from smaller tubules of 10–20 nm diameters. They retain their amorphous nature on being heated up to 600 °C beyond which crystallization starts. The major phase in the LaSPT heated at 900 °C is La{sub 2}Si{sub 2}O{sub 7}. “As synthesized” LaSPT is heterogeneous and comprises non stoichiometric phases. The exterior and interior surfaces of these tubes are remarkably different in their morphology and chemical composition. LaSPT sintered at 1200 and 1300 °C show fair amount of ionic conductivity. - Graphical abstract: Lanthanum silicate precipitation tube (LaSPT) produced through ‘silica garden’ route offers a green alternative to energy intensive milling procedure. - Highlights: • La-silicate precipitation tube (LaSPT) synthesized via silica garden route. • The microtubes are irregular, thick, white coloured and amorphous. • They are hierarchically built from smaller tubules of 10–20 nm diameters. • The major phase in the LaSPT heated at 900 °C is La{sub 2}Si{sub 2}O{sub 7}. • LaSPT sintered at 1200 °C is fairly conducting.

Energetically benign synthesis of lanthanum silicate through “silica garden” route and its characterization

International Nuclear Information System (INIS)

Parmar, Kavita; Bhattacharjee, Santanu

2017-01-01

Lanthanum silicate synthesis through “silica garden” route has been reported as an alternative to energy intensive milling procedure. Under optimum conditions lanthanum chloride crystals react with water glass (sodium silicate) to produce self generating hollow lanthanum silicate precipitation tube(s) (LaSPT). The micro tubes are irregular, thick, white coloured and amorphous but are hierarchically built from smaller tubules of 10–20 nm diameters. They retain their amorphous nature on being heated up to 600 °C beyond which crystallization starts. The major phase in the LaSPT heated at 900 °C is La_2Si_2O_7. “As synthesized” LaSPT is heterogeneous and comprises non stoichiometric phases. The exterior and interior surfaces of these tubes are remarkably different in their morphology and chemical composition. LaSPT sintered at 1200 and 1300 °C show fair amount of ionic conductivity. - Graphical abstract: Lanthanum silicate precipitation tube (LaSPT) produced through ‘silica garden’ route offers a green alternative to energy intensive milling procedure. - Highlights: • La-silicate precipitation tube (LaSPT) synthesized via silica garden route. • The microtubes are irregular, thick, white coloured and amorphous. • They are hierarchically built from smaller tubules of 10–20 nm diameters. • The major phase in the LaSPT heated at 900 °C is La_2Si_2O_7. • LaSPT sintered at 1200 °C is fairly conducting.

Effects of lanthanum exposure on elemental distribution in rat brains measured by synchrotron radiation XRF

International Nuclear Information System (INIS)

Feng Liuxing; Xiao Haiqing; He Xiao; Liu Nianqing; Zhao Yuliang; Chai Zhifang; Zhang Zhiyong

2005-01-01

Rare earth elements (REEs) comprise a coherent series of 15 elements from lanthanum to lutetium and possessing very similar chemical properties. In recent decades, with the rapid increase of the exploitation of REE resources and their applications to modern industry and daily life, particularly to agriculture as fertilizer additives in China, more and more REEs are coming into environmental system as well as food chain through various ways. It has become increasingly important to obtain more information on the physiological function of REEs and their long-term biological effects on body of living beings. Epidemiological investigations found that the intelligence quotients (IQ) of children from the REE-high background regions are obviously different from that of the normal region. This indicated that REEs probably affect the function of brain. However, the mechanism is totally unknown. The contents and distributions of major and trace elements are sometimes good indicators of the physiological and pathological conditions of human and animal brains In this study, the effects of subchronic lanthanum exposure on the elemental distribution in the rat brains were studied. Wistar rats were exposed to lanthanum chloride through oral administration at O, 0.1, 2, and 40-mg/kg doses for 6 months. The elements such as Cl, K, Ca, Fe, Cu, and Zn in brain slices were identified by synchrotron radiation X-ray fluorescence analysis. Differences in two-dimensional maps of elemental distribution were noticed. Cl, Ca, and Zn were primarily concentrated in hippocampus of the controls. With the increase of the lanthanum dosage, the Ca and Zn levels were significantly decreased, while the Cu levels were significantly elevated in cortex, hippocampus and thalamus. Our results suggest that subchronic lanthanum exposure in rats appears to change elemental distribution in brain. The impact of lanthanides on brain function is not negligible.

The rare earth element (REE) lanthanum (La) induces hormesis in plants.

Science.gov (United States)

Agathokleous, Evgenios; Kitao, Mitsutoshi; Calabrese, Edward J

2018-07-01

Lanthanum is a rare earth element (REE) which has been extensively studied due to its wide application in numerous fields with a potential accumulation in the environment. It has long been known for its potential to stimulate plant growth within a hormetic-biphasic dose response framework. This article provides evidence from a series of high resolution studies published within the last two decades demonstrating a substantial and significant occurrence of lanthanum-induced hormesis in plants. These findings suggest that hormetic responses should be built into the study design of hazard assessment study protocols and included in the risk assessment process. Hormesis also offers the opportunity to substantially improve cost benefit estimates for environmental contaminants, which have the potential to induce beneficial/desirable effects at low doses. Copyright © 2018 Elsevier Ltd. All rights reserved.

Responses in sediment phosphorus and lanthanum concentrations and composition across 10 lakes following applications of lanthanum modified bentonite

DEFF Research Database (Denmark)

Dithmer, Line; Nielsen, Ulla Gro; Lürling, Miquel

2016-01-01

and binding forms, P adsorption capacity of discrete sediment layers, and pore water P concentrations. Lanthanum phosphate mineral phases were confirmed by solid state (31)P MAS NMR and LIII EXAFS spectroscopy. Rhabdophane (LaPO4 · nH2O) was the major phase although indications of monazite (LaPO4) formation...... conditions of P retention (with the exception of two lakes) by sediments, indicating effective control of sediment P release, i.e. between two and nine years after treatment....

Yttrium and lanthanum recovery from low cerium carbonate, yttrium carbonate and yttrium concentrate

International Nuclear Information System (INIS)

Vasconcelos, Mari Estela de

2006-01-01

In this work, separation, enrichment and purification of lanthanum and yttrium were performed using as raw material a commercial low cerium rare earth concentrate named LCC (low cerium carbonate), an yttrium concentrate named 'yttrium carbonate', and a third concentrated known as 'yttrium earths oxide. The first two were industrially produced by the late NUCLEMON - NUCLEBRAS de Monazita e Associados Ltda, using Brazilian monazite. The 'yttrium earths oxide' come from a process for preparation of lanthanum during the course of the experimental work for the present thesis. The following techniques were used: fractional precipitation with urea; fractional leaching of the LCC using ammonium carbonate; precipitation of rare earth peroxycarbonates starting from the rare earth complex carbonates. Once prepared the enriched rare earth fractions the same were refined using the ion exchange chromatography with strong cationic resin without the use of retention ion and elution using the ammonium salt of ethylenediaminetetraacetic acid. With the association of the above mentioned techniques were obtained pure oxides of yttrium (>97,7%), lanthanum (99,9%), gadolinium (96,6%) and samarium (99,9%). The process here developed has technical and economic viability for the installation of a large scale unity. (author)

Electrical behaviour of strontium-doped lanthanum manganite interfaces

DEFF Research Database (Denmark)

Koch, Søren; Hendriksen, P.V.; Jacobsen, Torben

2005-01-01

The contact resistance of strontium-doped lanthanum manganite (LSM) contact pairs is investigated by polarisation analysis at different temperatures and atmospheres. The ceramic contacts have a high contact resistance, and strongly nonlinear current–voltage behaviour is observed at low temperatur....... The nonlinear behaviour is ascribed to the presence of energy barriers at the contact interface. Generally, point contacts showed a more linear behaviour than plane contact interfaces....

Selective isotope determination of lanthanum by diode-laser-initiated resonance-ionization mass spectrometry

International Nuclear Information System (INIS)

Young, J.P.; Shaw, R.W.

1995-01-01

A diode-laser step has been incorporated into a resonance-ionization mass spectrometry optical excitation process to enhance the isotopic selectivity of the technique. Lanthanum isotope ratio enhancements as high as 10 3 were achieved by use of a single-frequency cw diode laser tuned to excite the first step of a three-step excitation--ionization optical process; the subsequent steps were excited by use of a pulsed dye laser. Applying the same optical technique, we measured atomic hyperfine constants for the high-lying even-parity 4 D 5/2 state of lanthanum at 30 354 cm --1 . The general utility of this spectral approach is discussed

14 CFR 141.93 - Enrollment.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

36 CFR 406.141-406.148 - [Reserved

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

44 CFR 206.141 - Disaster unemployment assistance.

Science.gov (United States)

2010-10-01

... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

Oriented growing and anisotropy of emission properties of lanthanum hexaboride single crystals

International Nuclear Information System (INIS)

Lazorenko, V.I.; Lotsko, D.V.; Platonov, V.F.; Kovalev, A.V.; Galasun, A.P.; Matvienko, A.A.; Klinkov, A.E.

1987-01-01

Single crystals of lanthanum hexaboride with preset crystallographic orientation are grown by the method of crucible-free zone melting. It is shown that oriented growing of single crystals of the given compound is possible only when using seed crystals of the required orientation because no predominant orientation of the LaB 6 growth is found in case of spontaneous crystallization. Orientation of spontaneously growing LaB 6 crystals does not depend on their growth rate, degree of the melt diffusion annealing, purity of the inital powder. Anisotropy of the electronic work function for single crystal lanthanum hexaboride is confirmed. Its value grows as (100)<(110)<(111). Conditions of the preliminary thermovacuum purification of the surface are shown to affect the measured work function

Thermoelectric power and electrical conductivity of strontium-doped lanthanum manganite

DEFF Research Database (Denmark)

Ahlgren, E.O.; Poulsen, F.W.

1996-01-01

Thermoelectric power and electrical conductivity of pure and 5, 10 and 20% strontium-doped lanthanum manganite are determined as function of temperature in air and of P-O2 at 1000 degrees C. At high temperatures the thermoelectric power is negative. Both thermoelectric power and conductivity...

A case of lanthanum carbonate ingestion thought to be phlebosclerotic colitis on CT imaging and abdominal radiograph

International Nuclear Information System (INIS)

Harris, K.; Balcam, S.

2017-01-01

A male admitted in the early hours of the morning, complained of a four week, right sided, non-radiating, dull and intermittent abdominal pain. Imaging suggested a diagnosis of phlebosclerotic colitis which was later discounted when the patients' history of lanthanum carbonate ingestion was examined. Phlebosclerotic colitis mostly affects the Asian population, and its cause is still not known, but can be associated with specific radiographic features. Collections of lanthanum may confuse a diagnosis of phlebosclerotic colitis as well as other factors such as voxel errors, photon starvation and movement. - Highlights: • PC can be non-specific, its cause unknown, diagnosis is often delayed. • PC depends on specific radiographic features. • Lanthanum Carbonate can collect within the lumen and confuses diagnosis. • Voxel errors, photon starvation and patient movement can displace densities.

On magnetic ordering in heavily sodium substituted hole doped lanthanum manganites

Energy Technology Data Exchange (ETDEWEB)

Sethulakshmi, N. [Department of Physics, Cochin University of Science and Technology, Cochin 682022, Kerala (India); Unnimaya, A.N. [Centre for Materials for Electronic Technology (CMET), Thrissur 680581, Kerala (India); Al-Omari, I.A.; Al-Harthi, Salim [Department of Physics, Sultan Qaboos University, PC 123 Muscat (Oman); Sagar, S. [Government College for Women, Thiruvananthapuram 695014, Kerala (India); Thomas, Senoy [Materials Science and Technology Division, National Institute for Interdisciplinary Science and Technology, Thiruvananthapuram 695019, Kerala (India); Srinivasan, G. [Department of Physics, Oakland University, Rochester (United States); Anantharaman, M.R., E-mail: mraiyer@yahoo.com [Department of Physics, Cochin University of Science and Technology, Cochin 682022, Kerala (India)

2015-10-01

Mixed valence manganite system with monovalent sodium substituted lanthanum manganites form the basis of the present work. Lanthanum manganites belonging to the series La{sub 1−x}Na{sub x}MnO{sub 3} with x=0.5–0.9 were synthesized using modified citrate gel method. Variation of lattice parameters and unit cell volume with Na concentration were analyzed and the magnetization measurements indicated ferromagnetic ordering in all samples at room temperature. Low temperature magnetization behavior indicated that all samples exhibit antiferromagnetism along with ferromagnetism and it has also been observed that antiferromagnetic ordering dominates ferromagnetic ordering as concentration is increased. Evidence for such a magnetic inhomogeneity in these samples has been confirmed from the variation in Mn{sup 3+}/Mn{sup 4+} ion ratio from X-ray Photoelectron Spectroscopy and from the absorption peak studies using Ferromagnetic Resonance Spectroscopy. - Highlights: • Higher substitution of more than 50 percent of monovalent ion, sodium for La sites in lanthanum manganites scarce in literature. • Structural studies using XRD and further structure refinement by Rietveld refinement confirmed orthorhombic pbnm spacegroup. • Ferromagnetic behavior at room temperature with saturation magnetization decreasing with increase in sodium concentration. • M vs T measurements using FC ZFC proved coexisting FM/AFM behavior arising from exchange interactions between different valence states of Mn ions. • Disparity in ratio of Mn valence ions indicated presence of vacancies providing the role of vacancies and oxygen stoichiometry in deciding magnetic inhomogeneity.

Self-assembly in lanthanum(III) and calcium(II) complexes of salicylaldimines derived from putrescine

International Nuclear Information System (INIS)

Pospieszna-Markiewicz, Izabela; Kaczmarek, Malgorzata T.; Kubicki, Maciej; Radecka-Paryzek, Wanda

2008-01-01

The one-step template reaction of salicylaldehyde with putrescine, a biogenic diamine, in the presence of lanthanum(III) or calcium(II) ions produces salicylaldimine complexes containing the N,N'-bis(salicylidene)-1,4-butanediamine ligand L as a result of the [2 + 1] Schiff base condensation. The X-ray diffraction studies of the lanthanum complex reveals an infinite [La 2 L 4 (NO 3 ) 6 ] ∞ polymeric structure based on networks of 10-coordinated La(III) nodes linked by bridging unionized ligands that use exclusively the oxygens as donor atoms with the nitrogen atoms not being involved in coordination

25 CFR 141.48 - Translation of disclosure statements.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

Application of the Rietveld method in powders of strontium-doped lanthanum manganite calcined in different temperatures

International Nuclear Information System (INIS)

Chiba, R.; Vargas, R.A.; Martinez, L.G.; Andreoli, M.; Seo, E.S.M.

2010-01-01

The strontium-doped lanthanum manganite (LSM) is a ceramic material used as cathode in device called High Temperature Solid Oxide Fuel Cell. In this work, the LSM was synthesized by the citrate technique with the objective to get powders without the formation of secondary phases, such as lanthanum oxide and the lanthanum hydroxide, harmful for the functional performance of the device. The definitive calcination temperatures had been 700, 900 and 1100 deg C, due the decomposition of the polymeric precursors to present stabilization from 480 deg C. The analysis by X-ray diffraction of the calcined powders in different temperatures shows the formation only of phase LSM of hexagonal crystalline structure, type pseudo-perovskite. Using the refinement of Rietveld was determined the parameters and volumes of unity cells, atomic positions and occupations. These results confirm that the chemical compositions obtained are similar to the nominal. (author)

5 CFR 185.141 - Stay pending appeal.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.141 Stay pending appeal. (a) An initial decision is stayed automatically pending...

45 CFR 2490.141-2490.148 - [Reserved

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

25 CFR 141.59 - Customer complaint procedures.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

28 CFR 39.141-39.148 - [Reserved

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

19 CFR 141.43 - Delegation to subagents.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Delegation to subagents. 141.43 Section 141.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.43 Delegation to subagents. (a) Resident...

Effect of voltage on the characteristics of magnesium-lanthanum deposits synthesized by an electrodeposition process

Energy Technology Data Exchange (ETDEWEB)

Sahli, M. [Laboratoire de Physique Energétique, Université de Constantine 1 (Algeria); Chetehouna, K.; Gascoin, N. [INSA-CVL, Univ. Orléans, PRISME, EA 4229, F-18020, Bourges (France); Bellel, N. [Laboratoire de Physique Energétique, Université de Constantine 1 (Algeria); Tadini, P., E-mail: tadini.pietro@gmail.com [INSA-CVL, Univ. Orléans, PRISME, EA 4229, F-18020, Bourges (France)

2017-04-15

This work deals with the characterization of magnesium-lanthanum powders deposits produced with an electrodeposition technique using an aqueous solution based on magnesium chloride and lanthanum(III) nitrate. In recent years, the interest for magnesium-based alloys is growing due to their potential use as solid state systems for hydrogen storage. This work is a preliminary study on the synthesis of magnesium-lanthanum powders oriented to their later evaluation in systems for hydrogen storage. Magnesium and Lanthanum are deposited on a copper plate used as a cathode. Chemical composition, structure and morphology are investigated by EDS, XRD, FTIR and SEM. The effect of voltage on powders characteristics is studied considering three values (3, 3.5 and 4 V). EDS analysis shows the presence of three major elements (Mg, La and O) with a little amount of Cl. The weight percentages of Mg and O increase whereas the one of La decreases with the growth of voltage. Morphological characterization reveals that heterogeneous chemical structures are formed on the surface of the electrode and the size of aggregates decreases with the increase of voltage. From the results of X-ray analysis the deposits reveal the significant presence of two phases: Mg(OH){sub 2} and La(OH){sub 3}. The peaks originating from the Mg(OH){sub 2} phase has a non-monotonic behavior and those of La(OH){sub 3} phase increase with the increase of voltage. FTIR analysis confirms the presence of the two phases identified in XRD diffractograms and exhibits that their corresponding transmittance values increase for higher voltage values. - Highlights: • Synthesis of magnesium-lanthanum deposits by an electrodeposition process. • Voltage effect is investigated using different physicochemical analysis techniques (EDS, XRD, FTIR and SEM). • The EDS analysis shows the presence of three major elements (Mg, La and O) and a little amount of Cl. • Two phases, namely Mg(OH){sub 2} and La(OH){sub 3} are

49 CFR 28.141-28.148 - [Reserved

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

18 CFR 141.500 - Cash management programs.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.500 Cash management programs. Public utilities and... and § 141.1 or § 141.2 of this title that participate in cash management programs must file these...

Impact of Annealing Temperature on the Physical Properties of the Lanthanum Deficiency Manganites

Directory of Open Access Journals (Sweden)

Skini Ridha

2017-10-01

Full Text Available The lanthanum deficiency manganites La0.8-x□xCa0.2MnO3 (x = 0, 0.1 and 0.2, where □ is a lanthanum vacancy, were prepared using the classic ceramic methods with different thermal treatments (1373 K and 973 K. The structural, magnetic, and magnetocaloric properties of these compounds were studied as a function of annealing temperature. It was noted that the annealing temperature did not affect the crystal structure of our samples (orthorhombic structure with Pnma space group. Nevertheless, a change in the variation of the unit cell volume V, the average bond length dMn–O, and the average bond angles θMn–O–Mn were observed. Magnetization versus temperature study has shown that all samples exhibited a magnetic transition from ferromagnetic (FM to paramagnetic (PM phase with increasing temperature. However, it can be clearly seen that the annealing at 973 K induced an increase of the magnetization. In addition, the magnetocaloric effect (MCE as well as the relative cooling power (RCP were estimated. As an important result, the values of MCE and RCP in our Lanthanum-deficiency manganites are reported to be near to those found in gadolinium, considered as magnetocaloric reference material.

Modification of TiO2 nanoparticles through lanthanum doping and PEG templating

Directory of Open Access Journals (Sweden)

Marija Milanovic

2014-12-01

Full Text Available Pure and lanthanum doped titania nanopowders were synthesized through a room temperature sol-gel method using a template of polyethylene glycol (PEG. The progress of the synthesis in terms of phase formation and size of nanoparticles was monitored by X-ray diffraction, FTIR spectroscopy and SEM analysis. After calcination at 450 °C in air, the results have shown the presence of small particles crystallized predominantly in the form of anatase phase, with significant agglomeration. Nitrogen adsorption-desorption measurements confirmed that all prepared powders are mesoporous with an average pore diameter in range 3.1–3.8 nm. The addition of lanthanum ions leads to the nanopowders with the highest specific surface (BET area (203 m2/g. The obtained powders were compared to TiO2 prepared without a template.

Lanthanum and yttrium oxysulfides activated by europium: (Ln1-x Eux)2 O2 S - Synthesis and characterization

International Nuclear Information System (INIS)

Luiz, J.M.

1989-01-01

The synthesis of lanthanum and yttrium oxysulfides activated by europium were obtained by thermal decomposition of lanthanum and yttrium oxalates doped with europium, under an argon and sulphur atmosphere. The thermal decomposition of these compounds is studied by differential thermal analysis (DTA). The characterization of these oxysulfides were made by chemical analyses, infrared spectroscopy, X-ray diffraction, scanning electron microscopy and emission spectroscopy. (M.V.M.)

7 CFR 1.41 - Service of process.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Service of process. 1.41 Section 1.41 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Judicial Proceedings § 1.41 Service of... of the General Counsel, in order that service of process may be made. In the event an officer of the...

Molecular absorption spectra of beryllium, cerium, lanthanum, iron, and platinum salts

International Nuclear Information System (INIS)

Daidoji, Hidehiro

1980-01-01

The absorption spectra of some salts of beryllium, cerium, lanthanum, iron and platinum in air-acetylene flame were measured in the wavelength range from 200 to 400 nm. A Hitachi 207 type atomic absorption spectrophotometer was used. A deuterium lamp, a home-made continuous radiation lamp and some hollow cathode lamps were used as light sources. The new molecular absorption spectra of cerium, lanthanum and platinum and the absorption spectra due to Be(OH) 2 , LaO, PtH, FeO and FeCl in 200-400 nm region were obtained. Emission spectra of CeO, LaO and FeOH were also obtained. These molecular absorption bands were estimated as absorption errors of maximum 15 times to the sensitivity of each elements in atomic absorption spectrometry. In addition, spectral line interferences of iron were observed in atomic absorption spectrometry of Zn, Cd, Ni, Cu and Cr. (author)

The combination of lanthanum chloride and the calcimimetic calindol delays the progression of vascular smooth muscle cells calcification

Energy Technology Data Exchange (ETDEWEB)

Ciceri, Paola; Volpi, Elisa; Brenna, Irene; Elli, Francesca [Renal Division and Laboratory of Experimental Nephrology, Dipartimento di Medicina e Chirurgia, Universita di Milano, Milan (Italy); Borghi, Elisa [Dipartimento di Salute Pubblica, Microbiologia e Virologia, Universita di Milano, Milan (Italy); Brancaccio, Diego [Renal Division and Laboratory of Experimental Nephrology, Dipartimento di Medicina e Chirurgia, Universita di Milano, Milan (Italy); Cozzolino, Mario, E-mail: mario.cozzolino@unimi.it [Renal Division and Laboratory of Experimental Nephrology, Dipartimento di Medicina e Chirurgia, Universita di Milano, Milan (Italy)

2012-02-24

Highlights: Black-Right-Pointing-Pointer Lanthanum reduces the progression of high phosphate-induced calcium deposition. Black-Right-Pointing-Pointer Calcium receptor agonists and the calcimimetic calindol reduce calcium deposition. Black-Right-Pointing-Pointer Lanthanum and calindol cooperate on reducing calcium deposition. Black-Right-Pointing-Pointer Lanthanum and calindol may interact with the same receptor. -- Abstract: Phosphate (Pi)-binders are commonly used in dialysis patients to control high Pi levels, that associated with vascular calcification (VC). The aim of this study was to investigate the effects of lanthanum chloride (LaCl{sub 3}) on the progression of high Pi-induced VC, in rat vascular smooth muscle cells (VSMCs). Pi-induced Ca deposition was inhibited by LaCl{sub 3}, with a maximal effect at 100 {mu}M (59.0 {+-} 2.5% inhibition). Furthermore, we studied the effects on VC of calcium sensing receptor (CaSR) agonists. Gadolinium chloride, neomycin, spermine, and the calcimimetic calindol significantly inhibited Pi-induced VC (55.9 {+-} 2.2%, 37.3 {+-} 4.7%, 30.2 {+-} 5.7%, and 63.8 {+-} 5.7%, respectively). To investigate the hypothesis that LaCl{sub 3} reduces the progression of VC by interacting with the CaSR, we performed a concentration-response curve of LaCl{sub 3} in presence of a sub-effective concentration of calindol (10 nM). Interestingly, this curve was shifted to the left (IC{sub 50} 9.6 {+-} 2.6 {mu}M), compared to the curve in the presence of LaCl{sub 3} alone (IC{sub 50} 19.0 {+-} 4.8 {mu}M). In conclusion, we demonstrated that lanthanum chloride effectively reduces the progression of high phosphate-induced vascular calcification. In addition, LaCl{sub 3} cooperates with the calcimimetic calindol in decreasing Ca deposition in this in vitro model. These results suggest the potential role of lanthanum in the treatment of VC induced by high Pi.

Effects of adding lanthanum to Ni/ZrO2 catalysts on ethanol steam reforming

International Nuclear Information System (INIS)

Profeti, Luciene Paula Roberto; Habitzheuter, Filipe; Assaf, Elisabete Moreira

2012-01-01

The catalytic performance of Ni/ZrO 2 catalysts loaded with different lanthanum content for steam reforming of ethanol was investigated. Catalysts were characterized by BET surface area, X-ray diffraction, UV-vis spectroscopy, temperature programmed reduction, and X-ray absorption fine structure techniques. Results showed that lanthanum addition led to an increase in the degree of reduction of both NiO and nickel surface species interacting with the support, due to the higher dispersion effect. The best catalytic performance at 450 deg C was found for the Ni/12LZ catalyst, which exhibited an effluent gaseous mixture with the highest H 2 yield. (author)

26 CFR 1.141-13 - Refunding issues.

Science.gov (United States)

2010-04-01

... management contract and takes over the operation of the facility. In 2009, C issues bonds to refund the 1999... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Refunding issues. 1.141-13 Section 1.141-13...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-13 Refunding issues...

Growth and physico chemical characterization of lanthanum neodymium oxalate single crystals

International Nuclear Information System (INIS)

Raju, K.S.; John, Varughese; Ittyachen, M.A.

1998-01-01

Single crystals of lanthanum neodymium oxalate (LNO) are grown in sodium meta silicate gels, by the diffusion of a mixture of aqueous solutions of lanthanum nitrate and neodymium nitrate into the test tube having the set gel containing oxalic acid. The bluish pink coloured tabular crystals of LNO having well defined hexagonal basal planes appear either as foggy or clear, the latter at the greater depths inside the gel. The coloration of LNO visually observed is evidenced in UV-visible spectrum, by the revelation of well pronounced characteristic peaks in the visible region (500-900 nm). X-ray diffraction (XRD) of powdered LNO is ordered, meaning crystalline in nature, besides its isostructurality with similarly grown lanthanum samarium oxalate crystals. The single crystallinity of LNO is established by its oscillation XRD pattern. Thermogravimetric analysis (TGA) and differential scanning colorimetry (DSC) support that LNO loses water of crystallization around 120 degC and CO and CO 2 around 350-450 degC, while the infrared absorption (IR) spectrum of LNO establishes the presence of oxalate (C 2 O 4 ) 2- ions. Energy dispersive x-ray analysis (EDAX) confirms the presence of La and Nd in the sample. X-ray photoelectron spectroscopic (XPS) studies of LNO establish the presence of La and Nd in their respective oxide states. An empirical structure for LNO has been proposed on the basis of these findings. The smokiness in the foggy LNO crystal has been attributed due to the gel inclusion during the growth process. (author)

Synthesis and Characterization of Lanthanum Complexes with Amino Acid Schiff Base

Institute of Scientific and Technical Information of China (English)

张秀英; 张有娟; 杨林

2001-01-01

Six new complexes of lanthanum with amino acid Schiff base ligands, A-F, were prepared in methanol-aqueous solution. The composition and properties of the title complexes were characterized by elemental analysis, molar conductance, infrared, electronic spectra, 1H NMR, thermogravimetric and differential thermal analysis.

Effect of long-term intake of lanthanum chloride on the concentrations of some macro- and trace elements in rat brains using NAA

International Nuclear Information System (INIS)

Yu Tong; Li Yaming; Ren Yan; Wang Enbo; Xu Hongying; Wang Wenzhong

2005-01-01

Effects of long-term intake of lanthanum in drinking water on the concentrations of twelve kinds of macro- and trace elements in rat brains were primarily studied by neutron activation analysis. The results show that, along with the elevation of the dose of lanthanum, more and more elements were affected in the rat brain tissues. Compared with control group, the concentrations of five elements were changed in the 1000 mg/L group. These elements have close relations with brain function. Accordingly, intake of lanthanum may have negative effects on brain function. (authors)

21 CFR 146.141 - Canned orange juice.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned orange juice. 146.141 Section 146.141 Food... Beverages § 146.141 Canned orange juice. (a) Canned orange juice is the food prepared from orange juice as specified in § 146.135 or frozen orange juice as specified in § 146.137, or a combination of both, to which...

Separation of lanthanum from samarium on solid aluminum electrode in LiCl-KCl eutectic melts

International Nuclear Information System (INIS)

De-Bin Ji; Mi-Lin Zhang; Xing Li; Xiao-Yan Jing; Wei Han; Yong-De Yan; Yun Xue; Zhi-Jian Zhang; Harbin Engineering University, Harbin

2015-01-01

This paper presents an electrochemical study on the separation of lanthanum from samarium on aluminum electrode at 773 K. The results from different electrochemical methods showed that Sm(III) and La(III) formed Al-Sm and Al-La intermetallic compounds on an aluminum electrode at electrode potential around -1.67 and -1.46 V, respectively. The electrochemical separation of lanthanum was carried out in LiCl-KCl-LaCl 3 -SmCl 3 melts on solid aluminum electrodes at 773 K by potentiostatic electrolysis at -1.45 V for 40 h and the separation efficiency was 99.1 %. (author)

Effect of lanthanum substitution on dielectric relaxation, impedance response, conducting and magnetic properties of strontium hexaferrite

Energy Technology Data Exchange (ETDEWEB)

Want, Basharat, E-mail: bawant@kashmiruniversity.ac.in; Bhat, Bilal Hamid; Ahmad, Bhat Zahoor

2015-04-05

Highlights: • The substitution of La affects the dielectric and magnetic properties of strontium hexaferrite. • The electric behaviour of the compound follows the Koop’s phenomenological theory. • The impedance study shows the role of grain boundaries to the electric properties of the compound. • The substitution of La to strontium hexaferrite reduces the resistive nature of grain boundaries. - Abstract: Lanthanum strontium hexaferrite Sr{sub 1−x}La{sub x}Fe{sub 12}O{sub 19} (x = 0, 0.08, 0.13 , 0.18) has been successfully synthesized by using citrate-precursor method and characterized by different techniques. The X-ray diffraction results revealed that the sample is crystalline in nature and is of single phase with the space group P63/mmc. The dielectric, conducting and impedance related studies have been carried out as a function of frequency and concentration of lanthanum in the frequency ranges of 20 Hz–3 MHz. Impedance studies were performed in the frequency domain to distinguish between bulk and grain boundary contributions of the material to the overall dielectric response. The electric response of the material was also modeled by an equivalent circuit and different circuit parameters were calculated. Magnetic characterization of the material was also performed and the effect of lanthanum concentration was studied. The hysteresis loop obtained from the magnetometer showed that with the increase of lanthanum concentration, the saturation magnetisation decreases while as coercivity increases.

Distribution and Translocation of 141Ce (III) in Horseradish

Science.gov (United States)

Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua

2007-01-01

Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

40 CFR 141.155 - Report delivery and recordkeeping.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141.155 Section 141.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports § 141.155...

Studies on the lanthanum arsenate ion-exchanger: preparation, physicochemical properties and applications

International Nuclear Information System (INIS)

Mukherjee, A.K.; Mandal, S.K.

1984-01-01

The cation-exchange behaviour of lanthanum arsenate has been studied. This paper reports the preparation and physicochemical properties of the exchanger. Its analytical utility is compared with that of other arsenate exchangers. Some practical analytical applications are described. (author)

Development of a 1 kW Class SOFC Stack using Doped Lanthanum Gallate

Energy Technology Data Exchange (ETDEWEB)

Akikusa, J.; Adachi, K.; Yamada, T.; Akbay, T.; Murakami, N.; Chitose, N.; Hoshino, K.; Hosoi, K.; Yoshida, H.; Sasaki, T.; Inagaki, T.; Ishihara, T.; Takita, Y.

2002-06-01

The performance of lanthanum gallate based SOFC has been investigated as a high-energy conversion device. A planar type SOFC which could operate at temperatures below 800 {sup o}C has been jointly developed. As an electrolyte material, lanthanum gallate (LaGaO{sub 3}) with substitutions of Sr for the La site and Mg and Co for the Ga site (LSGMC) was used. The synthesis technique for large-sized cell production has been established, and the performance of a self- supported diameter 154 mm cell with 200 {mu}m electrolyte thickness is investigated. The output power of 50 W has been obtained with a conversion efficiency [LHV] of 45 % for a single cell. In addition, a metallic separator made of stainless steel was chosen and tested successfully for a seal-less stack. The output power of 1 kW by means of the stack of 18 cells has been achieved for the first time utilizing lanthanum gallate. Moreover, NiO-SDC composite powders were prepared by the spray pyrolysis method and used for the anode on 100 {mu}m thickness LSGMC electrolyte with a combination of samarium cobaltite for the cathode. The power density of as high as 1.8 W/cm{sup 2} at 0.7 V terminal voltage was achieved at 800{sup o}C. (author)

40 CFR 141.172 - Disinfection profiling and benchmarking.

Science.gov (United States)

2010-07-01

... benchmarking. 141.172 Section 141.172 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... sanitary surveys conducted by the State. (c) Disinfection benchmarking. (1) Any system required to develop...

40 CFR 141.101 - Use of bottled water.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

Materials system for intermediate temperature solid oxide fuel cells based on doped lanthanum-gallate electrolyte

Science.gov (United States)

Gong, Wenquan

2005-07-01

The objective of this work was to identify a materials system for intermediate temperature solid oxide fuel cells (IT-SOFCs). Towards this goal, alternating current complex impedance spectroscopy was employed as a tool to study electrode polarization effects in symmetrical cells employing strontium and magnesium doped lanthanum gallate (LSGM) electrolyte. Several cathode materials were investigated including strontium doped lanthanum manganite (LSM), Strontium and iron doped lanthanum cobaltate (LSCF), LSM-LSGM, and LSCF-LSGM composites. Investigated Anode materials included nickel-gadolinium or lanthanum doped cerium oxide (Ni-GDC, or Ni-LDC) composites. The ohmic and the polarization resistances of the symmetrical cells were obtained as a function of temperature, time, thickness, and the composition of the electrodes. Based on these studies, the single phase LSM electrode had the highest polarization resistance among the cathode materials. The mixed-conducting LSCF electrode had polarization resistance orders of magnitude lower than that of the LSM-LSGM composite electrodes. Although incorporating LSGM in the LSCF electrode did not reduce the cell polarization resistance significantly, it could reduce the thermal expansion coefficient mismatch between the LSCF electrodes and LSGM electrolyte. Moreover, the polarization resistance of the LSCF electrode decreased asymptotically as the electrode thickness was increased thus suggesting that the electrode thickness needed not be thicker than this asymptotic limit. On the anode side of the IT-SOFC, Ni reacted with LSGM electrolyte, and lanthanum diffusion occurred from the LSGM electrolyte to the GDC barrier layer, which was between the LSGM electrolyte and the Ni-composite anode. However, LDC served as an effective barrier layer. Ni-LDC (70 v% Ni) anode had the largest polarization resistance, while all other anode materials, i.e. Ni-LDC (50 v% Ni), Ni-GDC (70 v% NO, and Ni-GDC (50 v% Ni), had similar polarization

Nanostructured Lanthanum Halides and CeBr3 for Nuclear Radiation and Detection

International Nuclear Information System (INIS)

Guss, Paul; Mukhopadhyay, Sanjoy; Guise, Ron; Yuan, Ding

2010-01-01

Scintillator materials are used to detect, and in some cases identify, gamma rays. Higher performance scintillators are expensive, hard to manufacture, fragile, and sometimes require liquid nitrogen or cooling engines. But whereas lower-quality scintillators are cheap, easy to manufacture, and more rugged, their performance is lower. At issue: can the desirable qualities of high-and low-performance scintillators be combined to achieve better performance at lower cost? Preliminary experiments show that a LaF 3 :Ce oleic acid-based nanocomposite exhibits a photopeak when exposed to 137 Cs source gamma-radiation. The chemical synthesis of the cerium-doped lanthanum halide nanoparticles are scalable and large quantities of material can be produced at a time, unlike typical crystal growth processes such as the Bridgeman process. Using a polymer composite (Figure 1), produced by LANL, initial measurements of the unloaded and 8% LaF 3 :Ce-loaded sample have been made using 137 Cs sources. Figure 2 shows an energy spectrum acquired for CeF 3 . The lighter plot is the measured polymer-only spectrum and the black plot is the spectrum from the nanocomposite scintillator. As the development of this material continues, the energy resolution is expected to improve and the photopeak-to-Compton ratio will become greater at higher loadings. These measurements show the expected Compton edge in the polymer-only sample, and the Compton edge and photo-peak expected in the nanophosphor composites that LANL has produced. Using a porous VYCORR with CdSe/ZnS core shell quantum dots, Letant has demonstrated that he has obtained signatures of the 241Am photopeak with energy resolution as good at NaI (Figure 3). We begin with the fact that CeBr 3 crystals do not have a self-activity component as strong as the lanthanum halides. The radioactive 0.090% 138 La component of lanthanum leads to significant self-activity, which will be a problem for very large detector volumes. Yet a significant

9 CFR 3.141 - Terminal facilities.

Science.gov (United States)

2010-01-01

... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3.141 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

40 CFR 141.704 - Analytical methods.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.704 Section... Monitoring Requirements § 141.704 Analytical methods. (a) Cryptosporidium. Systems must analyze for Cryptosporidium using Method 1623: Cryptosporidium and Giardia in Water by Filtration/IMS/FA, 2005, United States...

17 CFR 141.8 - Procedures for salary offset.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for salary offset. 141.8 Section 141.8 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.8 Procedures for salary offset. (a) Deductions to liquidate an employee's debt will be by...

20 CFR 1001.141 - Functions of DVOP staff.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Functions of DVOP staff. 1001.141 Section 1001.141 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING... Veterans Outreach Program (DVOP) § 1001.141 Functions of DVOP staff. Each DVOP specialist shall carry out...

Lanthanum (samarium) nitrate-4-aminoantipyrine nitrate-water systems

International Nuclear Information System (INIS)

Starikova, L.I.; Zhuravlev, E.F.

1985-01-01

Using the isothermal method of cross-sections at 50 deg C systems lanthanum nitrate-4-aminoantipyrine nitrate-water (1), samarium nitrate-4-aminoantipyrine nitrate-water (2), are studied. Isotherms of system 1 consist of two crystallization branches of initial salt components. In system 2 formation of congruently soluble compounds of the composition Sm(No) 3 ) 3 xC 11 H 13 ON 3 xHNO 3 is established. Analytical, X-ray phase and thermogravimetric analysis of the isolated binary salt are carried out

Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

International Nuclear Information System (INIS)

Warmińska, Dorota; Wawer, Jarosław

2012-01-01

Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

Effect of various lanthanum sol-gel coatings on the 330Cb (Fe-35Ni-18Cr-1Nb-2Si) oxidation at 900 deg. C

Energy Technology Data Exchange (ETDEWEB)

Buscail, H., E-mail: buscail@iut.u-clermont1.fr [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Issartel, C.; Riffard, F.; Rolland, R.; Perrier, S. [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Fleurentin, A. [CETIM, 52 av Felix Louat, BP 80067, 60304 Senlis (France); Josse, C. [L' ICB UMR5209 CNRS, BP 47870, 21078 Dijon (France)

2011-11-01

The influence of a lanthanum sol-gel coating on the oxide scale adherence has been studied during the 330Cb (Fe-35Ni-18Cr-1Nb-2Si) oxidation at 900 deg. C, in air. The alloy oxidation is performed in order to generate a protective chromia scale acting as a good barrier against carburization. Argon annealing of lanthanum sol-gel coatings have been performed at various temperatures in order to find the best conditions to insure the scale adherence. Kinetic results show that lanthanum sol-gel coatings lead to a lower oxidation rate compared to blank specimens. Thermal cycling tests on lanthanum the sol-gel coated specimen show that the oxide scale formed at 900 deg. C, in air, is adherent.

19 CFR 141.41 - Surety on Customs bonds.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

25 CFR 141.55 - Price monitoring and control.

Science.gov (United States)

2010-04-01

... be made a survey of the prices of flour, sugar, fresh eggs, lard, coffee, ground beef, bread, cheese... 25 Indians 1 2010-04-01 2010-04-01 false Price monitoring and control. 141.55 Section 141.55... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.55 Price...

Hydrocarbon conversion with cracking catalyst having co-combustion promoters lanthanum and iron

International Nuclear Information System (INIS)

Csicsery, S.M.

1979-01-01

A composition useful in hydrocarbon conversion processes such as catalytic cracking comprises 0.05 to 10 weight percent lanthanum associated with a refractory support. The composition may also include 0.02 to 10 weight percent iron. The refractory support is a zeolitic crystalline aluminosilicate

Paramagnetic resonance of Mn4+ and Mn2+ centers in lanthanum gallate single crystals

Science.gov (United States)

Vazhenin, V. A.; Potapov, A. P.; Guseva, V. B.; Artyomov, M. Yu.

2010-03-01

An increase in the manganese concentration in lanthanum gallate in the range 0.5-5.0% has been found to result in a complete replacement of individual Mn4+ ions by Mn2+ ions. The relative concentrations and binding energies of individual Mn4+, Mn3+, and Mn2+ ions have been determined. The spin Hamiltonians of the Mn2+ and Mn4+ centers in the rhombohedral and orthorhombic phases, respectively, have been constructed and the orientation of the principal axes of the fine-structure tensor of Mn4+ at room temperature has been found. The possibility of using electron paramagnetic resonance for determining the rotation angles of oxygen octahedra of lanthanum gallate with respect to the perovskite structure has been discussed.

40 CFR 141.621 - Routine monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Routine monitoring. 141.621 Section....621 Routine monitoring. (a) Monitoring. (1) If you submitted an IDSE report, you must begin monitoring..., you must monitor at the location(s) and dates identified in your monitoring plan in § 141.132(f...

Adsorbtion of oxygen and cesium on lanthanum hexaboride

International Nuclear Information System (INIS)

Gorodetskij, D.A.; Tskhakaya, V.K.; Shchudlo, Yu.G.; Yarygin, V.I.; Yas'ko, A.A.

1982-01-01

Oxygen and cesium adsorption on lanthanum hexaboride was investigated. Especial attention was paid to structural investigations of the LaB 6 (100)-O system. Diffraction pictures and curves of changes in work function in the process of oxygen disorption have been obtained. At oxygen adsorption on a crystal heated up to different temperatures in the range of 900-1400 K the same diffraction pictures as at corresponding annealing temperatures observed were. It is noted that adsorption heat changes slightly in the LaB 6 -O-Cs system

Synthesis and characterization of nanoporous strontium-doped lanthanum cobaltite thin film using metal organic chemical solution deposition

Energy Technology Data Exchange (ETDEWEB)

Park, Jun-Sik [Department of Mechanical Convergence Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, Young-Beom, E-mail: ybkim@hanyang.ac.kr [Department of Mechanical Convergence Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Institute of Nano Science and Technology, Hanyang University, Seoul 133-791 (Korea, Republic of)

2016-01-29

By employing strontium as a dopant of lanthanum cobaltite (LaCoO{sub 3}), strontium-doped lanthanum cobaltite (La{sub 1−x}Sr{sub x}CoO{sub 3−δ}, LSC) thin film was fabricated using a metal organic chemical solution deposition (MOCSD) method. Lanthanum nitrate hexahydrate [La(NO{sub 3}){sub 3}6H{sub 2}O], strontium acetate [Sr(CH{sub 3}COO){sub 2}], and cobalt acetate tetrahydrate [Co(CH{sub 3}COO){sub 2}4H{sub 2}O] were used as precursors. The coating process was performed through a spin coating method on a substrate, which were then heat treated under various temperature conditions. Electrical properties, microstructures, and crystalline structures with respect to sintering temperature were analyzed. According to these analyses, the change in surface morphology, phase shift, and conductive properties were closely related, which could explain their respective behaviors. Furthermore, sintered strontium-doped lanthanum perovskite oxides showed various conductivities according to the amount of dopant. With the molar ratio of strontium that is stoichiometrically equivalent to lanthanum (La{sub 0.5}Sr{sub 0.5}CoO{sub 3−δ}) thin film showed the best conductivity in the sintering temperature range of 650–700 °C, with perovskite phases formed at this temperature condition. As the electrically conductive properties of the thin film are a function of thickness, the films were coated several times to a thickness of approximately 300 nm, with the lowest resistivity (approximately 9.06 × 10{sup −4} Ω cm) observed at the optimized sintering temperature and solution composition. - Highlights: • LSC thin film was fabricated by metal organic chemical solution deposition (MOCSD). • The film shows good agreement on the electrical conductivity of LSC by conventional methods. • The properties of LSC film are influenced by the surface morphology and crystalline phase. • Optimal molar ratio of strontium for the highest conductivity was investigated.

High spin states of 141Pm

Science.gov (United States)

Bhattacharyya, Sarmishtha; Chanda, Somen; Bhattacharjee, Tumpa; Basu, Swapan Kumar; Bhowmik, R. K.; Muralithar, S.; Singh, R. P.; Ghugre, S. S.

2004-01-01

The high spin states in the N=80 odd- A141Pm nucleus have been investigated by in-beam γ-spectroscopic techniques following the reaction 133Cs( 12C, 4n) 141Pm at E=65 MeV using a modest γ detector array, consisting of seven Compton-suppressed high purity germanium detectors and a multiplicity ball of 14 bismuth germanate elements. Thirty new γ rays have been assigned to 141Pm on the basis of γ-ray singles and γγ-coincidence data. The level scheme of 141Pm has been extended upto an excitation energy of 5.2 MeV and spin {35}/{2}ℏ and 16 new levels have been proposed. Spin-parity assignments for most of the newly proposed levels have been made on the basis of the deduced directional correlation orientation ratios for strong transitions. The meanlives of a few excited states have been determined from the pulsed beam- γγ coincidence data using the generalised centroid-shift method. The level structure is discussed in the light of known systematics of neighbouring N=80 isotonic nuclei.

Lanthanum carbonate versus placebo for management of hyperphosphatemia in patients undergoing peritoneal dialysis: a subgroup analysis of a phase 2 randomized controlled study of dialysis patients

Directory of Open Access Journals (Sweden)

Hutchison Alastair J

2013-02-01

Full Text Available Abstract Background This short-term study assessed the efficacy and safety of lanthanum carbonate in the treatment of hyperphosphatemia in dialysis patients; here, we report a prespecified subgroup analysis of patients undergoing peritoneal dialysis. Methods Men and women (n = 39 who had received continuous ambulatory peritoneal dialysis for chronic kidney disease for 6 months or more were enrolled in eight renal medicine departments in the United Kingdom. A 2-week washout period was followed by a 4-week dose-titration phase during which patients received lanthanum carbonate titrated up to 2250 mg/day. This was followed by a 4-week, randomized, placebo-controlled, parallel-group phase during which patients continued to receive either lanthanum carbonate at the titrated dose, or a matched dose of placebo. The main outcome measure was control of serum phosphate levels (1.3-1.8 mmol/l at the end of the parallel-group phase. Results Serum phosphate was controlled in 3/39 (8% patients at the beginning of the dose-titration phase (after washout and in 18/31 (58% patients treated with lanthanum carbonate at its end. After the parallel-group phase, 60% of lanthanum carbonate-treated patients and 10% of those receiving placebo had controlled serum phosphate. There was no difference in mean (95% confidence interval serum phosphate levels between groups at randomization: lanthanum carbonate, 1.57 (1.34-1.81 mmol/l; placebo, 1.58 (1.40-1.76 mmol/l (p = 0.96. However, a difference was seen at the end of the parallel-group phase: lanthanum carbonate, 1.56 (1.33-1.79 mmol/l; placebo, 2.25 (1.81-2.68 mmol/l (p = 0.0015. There were no clinically important changes in nutritional parameters and no serious treatment-related adverse events were recorded. Conclusions At doses up to 2250 mg/day, lanthanum carbonate is well tolerated and controls hyperphosphatemia effectively. Treatment with higher doses of lanthanum carbonate may allow patients undergoing

Photoluminescence properties of cerium oxide nanoparticles as a function of lanthanum content

International Nuclear Information System (INIS)

Deus, R.C.; Cortés, J.A.; Ramirez, M.A.; Ponce, M.A.; Andres, J.; Rocha, L.S.R.

2015-01-01

Highlights: • CeO 2 nanoparticles were obtained by microwave-hydrothermal method. • Rietveld refinement reveals a cubic structure. • KOH mineralizer agent exhibit weak agglomeration at low temperature and shorter time. - Abstract: The structural and photoluminescent properties at room temperature of CeO 2 and La-doped CeO 2 particles were undertaken. The obtained particles were synthesized by a microwave-assisted hydrothermal method (MAH) under different lanthanum contents. X-ray diffraction (XRD), Fourier transform infrared (FT-IR), Fourier transform Raman (FT-Raman), Ultra-violet spectroscopy (UV–vis) and photoluminescence (PL) measurements were carried out. XRD revealed that the powders are free of secondary phases and crystallize in the cubic structure. Raman data show that increasing La doping content increase oxygen vacancies due to lattice expansion. The UV/vis absorption spectroscopy suggested the presence of intermediate energy levels in the band gap of structurally ordered powders. Lanthanum addition creates oxygen vacancies and shifts the photoluminescence in the low energy range leading to intense PL emission

Structures, stabilities, and electronic properties for rare-earth lanthanum doped gold clusters

International Nuclear Information System (INIS)

Zhao, Ya-Ru

2015-01-01

The structures, stabilities, and electronic properties of rare-earth lanthanum doped gold La 2 Au n (n = 1-9) and pure gold Au n (n ≤ 11) clusters have been investigated by using density functional theory. The optimized geometries show that the lowest energy structures of La 2 Au n clusters favour the 3D structure at n ≥ 3. The lanthanum atoms can strongly enhance the stabilities of gold clusters and tend to occupy the most highly coordinated position. By analysing the gap, vertical ionization potential, and chemical hardness, it is found that the La 2 Au 6 isomer possesses higher stability for small-sized La 2 Au n clusters (n = 1-9). The charges in the La 2 Au n clusters transfer from La atoms to the Au n host. In addition, Wiberg bond indices analysis reveals that the intensity of different bonds of La 2 Au n clusters exhibits a sequence of La-La bond > La-Au bond > Au-Au bond.

Induced assembly and photoluminescence of lanthanum (Tb, Eu, Dy) complexes/ZnO/polyethylene glycol hybrid phosphors

Energy Technology Data Exchange (ETDEWEB)

Yan Bing [Department of Chemistry, Tongji University, Siping Road 1239, Shanghai 200092 (China)]. E-mail: byan@tongji.edu.cn; Chen Xi [Department of Chemistry, Tongji University, Siping Road 1239, Shanghai 200092 (China); Wu Jianhua [Department of Chemistry, Tongji University, Siping Road 1239, Shanghai 200092 (China)

2007-08-31

Some novel kinds of hybrid phosphors were assembled with lanthanum (Tb, Eu, Dy) complexes (with four kinds of terbium complexes is 2,4-dihydroxybenzonic acid (DHBA), 1,10-phenanthroline (phen), acetylacetone (AA) and nicotinic acid (Nic), respectively) doped ZnO/PEG particles by co-precipitation approach derived from Zn(CH{sub 3}COO){sub 2} (Zn(AC){sub 2}), NaOH, PEG as precursors at room temperature. The characteristic luminescence spectra for f-f transitions of Tb{sup 3+}, Eu{sup 3+}, Dy{sup 3+} were observed. It is worthy to point out that ZnO is the excellent host for lanthanum ions by the assembly of PEG matrices.

40 CFR 141.42 - Special monitoring for corrosivity characteristics.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for corrosivity characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations and Prohibition on Lead Use § 141.42 Special monitoring for corrosivity characteristics. (a)-(c...

Effects of combined flocculant – Lanthanum modified bentonite treatment on aquatic macroinvertebrate fauna

NARCIS (Netherlands)

Waajen, G.; Pauwels, M.; Lürling, M.

2017-01-01

A low dose flocculant (FeCl3), combined with lanthanum modified bentonite (LMB) as phosphate-binding agent, has been applied for eutrophication management in Lake De Kuil (The Netherlands). After the treatment, the state of the lake shifted from hypertrophic to mesotrophic. Although

Effect of pressure on the magnetic properties of lanthanum manganite

International Nuclear Information System (INIS)

Gonchar', L. E.; Leskova, Yu. V.; Nikiforov, A. E.; Kozlenko, D. P.

2010-01-01

The crystalline structure of pure lanthanum manganite under external hydrostatic pressure has been studied. The behavior of magnetic properties and nuclear magnetic resonance (NMR) spectra under these conditions is theoretically predicted. It is shown that an increase in the Neel temperature with pressure is not only caused by the general contraction of the crystal, but is also related to certain peculiarities in the baric behavior of the orbital structure.

Uranyl(VI) and lanthanum(III) complexes with functionalized macrocyclic and macroacyclic Schiff bases

International Nuclear Information System (INIS)

Aguiari, A.; Brianese, N.; Tamburini, S.; Vigato, P.A.

1995-01-01

Acyclic Schiff bases have been prepared by [2 + 1] condensation of 2,6-diformyl-4-chlorophenol and H 2 NCH 2 [CH 2 XCH 2 ] n CH 2 NH 2 (n =3D 0 H 2 -I; X =3D NH, S, O n =3D 1 H 2 -II...H 2 -IV; X =3D 0 n =3D 2 H 2 -V; X =3D 0 n =3D 3 H 2 -VI). The related uranlyl(VI) and lanthanum (III) complexes have bee synthesized by reaction by reaction of the preformed ligands with the appropriate salt or by the template procedure, in the presence of base. No base was employed in the preparation of lanthanum (III) complexes, La(H 2 -II)(NO 3 ) 3 , La(H 2 -IV)(NO 3 ) 3 where the Schiff bases coordinate as neutral chelate ligands. These acyclic complexes have been used for further condensation, and symmetric and asymmetric cyclic complexes have been obtained by their reaction with the polyamines H 2 NCH 2 [CH 2 XCH 2 ]nCH 2 NH 2 or with 4,4'-diaminodibenzo -18-crown-6. By reaction with 4-aminobenzo-15-crown-5 or 2-amino-methyl-15-crown-5, the same acyclic complexes give rise to functionalized complexes bearing crown-ether moieties. Analogously, the acyclic ligand H 3 -IXX, prepared by condensation of 2,6 diformyl-4-chlorophenol and tris(aminoethyl)amine, forms mono and homodinuclear lanthanum (III) complexes, which may undergo further condensation when reacted with primary functionalized amines. (authors). 42 refs., 2 figs., 2 schemes, 1 tab

Near fifty percent sodium substituted lanthanum manganites—A potential magnetic refrigerant for room temperature applications

Energy Technology Data Exchange (ETDEWEB)

Sethulakshmi, N.; Anantharaman, M. R., E-mail: mraiyer@yahoo.com [Department of Physics, Cochin University of Science and Technology, Cochin 682022, Kerala (India); Al-Omari, I. A. [Department of Physics, Sultan Qaboos University, PC 123 Muscat, Sultanate of Oman (Oman); Suresh, K. G. [Department of Physics, Indian Institute of Technology Bombay, Powai, Mumbai 400076 (India)

2014-03-03

Nearly half of lanthanum sites in lanthanum manganites were substituted with monovalent ion-sodium and the compound possessed distorted orthorhombic structure. Ferromagnetic ordering at 300 K and the magnetic isotherms at different temperature ranges were analyzed for estimating magnetic entropy variation. Magnetic entropy change of 1.5 J·kg{sup −1}·K{sup −1} was observed near 300 K. An appreciable magnetocaloric effect was also observed for a wide range of temperatures near 300 K for small magnetic field variation. Heat capacity was measured for temperatures lower than 300 K and the adiabatic temperature change increases with increase in temperature with a maximum of 0.62 K at 280 K.

14 CFR 141.11 - Pilot school ratings.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... rating course. (x) Aircraft type rating course. (2) Special preparation courses. (Appendix K). (i) Pilot...

14 CFR 121.141 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

37 CFR 1.41 - Applicant for patent.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

Method of producing a solution of radioactive lanthanum-140 from radioactive barium-140 in an isotope generator and installation to carry out the method

International Nuclear Information System (INIS)

Akerman, K.; Jacobs, G.; Sauerwein, K.

1979-01-01

A method of separating radioactive lanthanum-140 from radioactive Ba-140 is proposed. The lanthanum-140 will be washed out of a sulphate precipitate and separated from Ba-140-sulphate by a granular filter mass of CaSO 4 and BaSO 4 . Details of the process are given. (UWI) [de

Investigation of lanthanum- and neodymium ion interaction with potassium polyphosphate in aqueous solution

International Nuclear Information System (INIS)

Ezhova, Zh.A.; Tananaev, I.V.; Koval', E.M.

1983-01-01

A study was made on the interaction in the LaCl 3 -KPO 3 -H 2 O and NdCl 3 -KPO 3 -H 2 O systems at 0 deg C by methods of solubility of residual concentrations and measurement of the pH value. The formation of binary KLa 2 (PO 3 ) 7 x10H 2 O and KLa(PO 3 ) 4 X5H 2 O lanthanum- and potassium polyphosphates, as well as KNd 2 (PO 3 ) 7 X10H 2 O and KNd(PO 3 ) 4 X5H 2 O neodymium- apd potassiUm polyphasphates was established. Chemical, paper-chromatographic, infrared spectroscopic, X-ray diffraction and differential thermal analyses of the prepared compoUnds were conducted. Anhydrous binary lanthanum- and neodymium polyphosphates with potassium-=Kla(PO 3 ) 4 , KNd(PO 3 ) 4 , KLa 2 (PO 3 ) 7 and KNd 2 x(PO 3 ) 7 - eere prepared

Photoluminescence properties of cerium oxide nanoparticles as a function of lanthanum content

Energy Technology Data Exchange (ETDEWEB)

Deus, R.C. [Universidade Estadual Paulista, Unesp —Faculdade de Engenharia de Guaratinguetá, Av. Dr Ariberto Pereira da Cunha 333, Bairro Pedregulho, P.O. Box 355, 12.516-410 Guaratinguetá, São Paulo, Brazil, (Brazil); Cortés, J.A., E-mail: leandrosrr89@gmail.com [Universidade Estadual Paulista, Unesp —Faculdade de Engenharia de Guaratinguetá, Av. Dr Ariberto Pereira da Cunha 333, Bairro Pedregulho, P.O. Box 355, 12.516-410 Guaratinguetá, São Paulo, Brazil, (Brazil); Ramirez, M.A. [Universidade Estadual Paulista, Unesp —Faculdade de Engenharia de Guaratinguetá, Av. Dr Ariberto Pereira da Cunha 333, Bairro Pedregulho, P.O. Box 355, 12.516-410 Guaratinguetá, São Paulo, Brazil, (Brazil); Ponce, M.A. [Instituto de Investigaciones en Ciencia y Tecnología de Materiales (INTEMA) (CONICET-Universidad Nacional de Mar del Plata), Juan B. Justo 4302, 7600 Mar del Plata (Argentina); Andres, J. [Laboratório Interdisciplinar em Cerâmica, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, 14801-907 Araraquara, São Paulo (Brazil); Rocha, L.S.R. [Universidade Estadual Paulista, Unesp —Faculdade de Engenharia de Guaratinguetá, Av. Dr Ariberto Pereira da Cunha 333, Bairro Pedregulho, P.O. Box 355, 12.516-410 Guaratinguetá, São Paulo, Brazil, (Brazil); and others

2015-10-15

Highlights: • CeO{sub 2} nanoparticles were obtained by microwave-hydrothermal method. • Rietveld refinement reveals a cubic structure. • KOH mineralizer agent exhibit weak agglomeration at low temperature and shorter time. - Abstract: The structural and photoluminescent properties at room temperature of CeO{sub 2} and La-doped CeO{sub 2} particles were undertaken. The obtained particles were synthesized by a microwave-assisted hydrothermal method (MAH) under different lanthanum contents. X-ray diffraction (XRD), Fourier transform infrared (FT-IR), Fourier transform Raman (FT-Raman), Ultra-violet spectroscopy (UV–vis) and photoluminescence (PL) measurements were carried out. XRD revealed that the powders are free of secondary phases and crystallize in the cubic structure. Raman data show that increasing La doping content increase oxygen vacancies due to lattice expansion. The UV/vis absorption spectroscopy suggested the presence of intermediate energy levels in the band gap of structurally ordered powders. Lanthanum addition creates oxygen vacancies and shifts the photoluminescence in the low energy range leading to intense PL emission.

Lanthanum-modified bentonite: potential for efficient removal of phosphates from fishpond effluents.

Science.gov (United States)

Kurzbaum, Eyal; Raizner, Yasmin; Cohen, Oded; Rubinstein, Guy; Bar Shalom, Oded

2017-06-01

Adsorption has been suggested as an effective method for removing phosphates from agricultural wastewater effluents that contain relatively high phosphate concentrations. The present study focused on the use of a bentonite-lanthanum clay (Phoslock ® ) for reducing the dissolved phosphate concentration in fishpond effluents. Batch experiments with synthetic phosphate-spiked solutions and with fishpond effluents were performed in order to determine adsorption equilibrium isotherms and kinetics as well as to determine the efficiency of Phoslock ® in removing phosphate from these solutions. In the synthetic phosphate-spiked solution, the mean maximum phosphate adsorption capacity was 92 mg Phoslock ® /mg phosphate removal. A ratio of 50, 100, and 200 mg Phoslock ® /mg phosphate removal was found for complete phosphate removal from the fishpond effluents, where higher doses of Phoslock ® led to a faster removal rate (94% removal within the first 150 min). These results show that bentonite-lanthanum clay can be employed for designing a treatment process for efficient phosphate removal from fishpond effluents.

Chemically produced nanostructured ODS-lanthanum oxide-tungsten composites sintered by spark plasma

International Nuclear Information System (INIS)

Yar, Mazher Ahmed; Wahlberg, Sverker; Bergqvist, Hans; Salem, Hanadi G.; Johnsson, Mats; Muhammed, Mamoun

2011-01-01

High purity W and W-0.9La 2 O 3 (wt.%) nanopowders were produced by a wet chemical route. The precursor was prepared by the reaction of ammonium paratungstate (APT) with lanthanum salt in aqueous solutions. High resolution electron microscopy investigations revealed that the tungstate particles were coated with oxide precipitates. The precursor powder was reduced to tungsten metal with dispersed lanthanum oxide. Powders were consolidated by spark plasma sintering (SPS) at 1300 and 1400 o C to suppress grain growth during sintering. The final grain size relates to the SPS conditions, i.e. temperature and heating rate, regardless of the starting powder particle size. Scanning electron microscopy revealed that oxide phases were mainly accumulated at grain boundaries while the tungsten matrix constituted of nanosized sub-grains. The transmission electron microscopy revealed that the tungsten grains consist of micron-scale grains and finer sub-grains. EDX analysis confirmed the presence of W in dispersed oxide phases with varying chemical composition, which evidenced the presence of complex oxide phases (W-O-La) in the sintered metals.

Simultaneous determination of dopamine, uric acid and nitrite using carboxylated graphene oxide/lanthanum modified electrode

International Nuclear Information System (INIS)

Ye, Fengying; Feng, Chenqi; Jiang, Jibo; Han, Sheng

2015-01-01

Highlights: • The carboxylated graphene oxide/lanthanum-modified glassy carbon electrode (GO-COOLa/GCE) was successfully utilized for the simultaneous detection and quantification of DA, UA and NO 2 − . • Combining the benefits of carboxylated graphene oxide and lanthanum, the modified sensor displayed large peak separations, long linear ranges and low detection limits for simultaneously detecting DA, UA and NO 2 − . • The GO-COOLa/GCE electrode showed well stability, good repeatability, rapid response, and high catalytic performance toward the oxidations of DA, UA and NO 2 − . - Abstract: A bare glassy carbon electrode (GCE) was reformed by carboxylated graphene oxide/lanthanum, and the modified electrode, called GO-COOLa/GCE, was fabricated for simultaneously detecting dopamine (DA), uric acid (UA) and nitrite (NO 2 − ) by cyclic voltammetry (CV), differential pulse voltammetry (DPV) and amperometry. Several factors which affected the electrocatalytic activity of the GO-COOLa/GCE electrode, such as the effect of pH, scan rate and concentration were studied. Due to the combination of carboxylated graphene oxide and lanthanum ions, the GO-COOLa/GCE sensor showed rapid response, excellent selectivity and high catalytic performance toward the electrooxidation of DA, UA and NO 2 − . In optimized conditions, two linear response ranges for determining DA were obtained over ranges of 0.01-1.96×10 2 μM and 1.96×10 2 -1.23×10 3 μM with detection limit of 0.018 μM (S/N = 3). And the responses of the GO-COOLa/GCE electrode for UA and NO 2 − were linear in the region of 1-1.53×10 3 μM and 1-2.75×10 3 μM with detection limits of 0.058 μM and 0.070 μM, respectively. Furthermore, this reformed electrode was successfully used to the detection of DA, UA and NO 2 − in real urine and serum samples, showing its promising application in the electroanalysis of real samples.

Determination of Aluminum in Dialysis Concentrates by Atomic Absorption Spectrometry after Coprecipitation with Lanthanum Phosphate.

Science.gov (United States)

Selvi, Emine Kılıçkaya; Şahin, Uğur; Şahan, Serkan

2017-01-01

This method was developed for the determination of trace amounts of aluminum(III) in dialysis concentrates using atomic absorption spectrometry after coprecipitation with lanthanum phosphate. The analytical parameters that influenced the quantitative coprecipitation of analyte including amount of lanthanum, amount of phosfate, pH and duration time were optimized. The % recoveries of the analyte ion were in the range of 95-105 % with limit of detection (3s) of 0.5 µg l -1 . Preconcentration factor was found as 1000 and Relative Standard Deviation (RSD) % value obtained from model solutions was 2.5% for 0.02 mg L -1 . The accuracy of the method was evaluated with standard reference material (CWW-TMD Waste Water). The method was also applied to most concentrated acidic and basic dialysis concentrates with satisfactory results.

PROCESS USING POTASSIUM LANTHANUM SULFATE FOR FORMING A CARRIER PRECIPITATE FOR PLUTONIUM VALUES

Science.gov (United States)

Angerman, A.A.

1958-10-21

A process is presented for recovering plutonium values in an oxidation state not greater than +4 from fluoride-soluble fission products. The process consists of adding to an aqueous acidic solution of such plutonium values a crystalline potassium lanthanum sulfate precipitate which carries the plutonium values from the solution.

40 CFR 141.62 - Maximum contaminant levels for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic contaminants. 141.62 Section 141.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.62 Maximum...

40 CFR 141.61 - Maximum contaminant levels for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.61 Maximum contaminant...

12 CFR 410.141-410.148 - [Reserved

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

海藻酸镧颗粒除氟研究：吸附剂物性和吸附机理%Fluoride Removal by Lanthanum Alginate Bead:Adsorbent Characterization and Adsorption Mechanism

Institute of Scientific and Technical Information of China (English)

霍亚坤; 丁文明; 黄霞; 徐静年; 赵梦华

2011-01-01

Lanthanum alginate bead is a new, highly active adsorbent. In the present study, we investigated its adsorption performance and its adsorption mechanism. The adsorption isotherm for fluoride onto lanthanum alginate bead fits the Langmuir model well, and the maximum adsorption capacity is 197.2 mg·g-1. X-ray diffraction shows the amorphous nature of lanthanum alginate bead, which allows for better accessibility to fluoride and thus better activity. Infrared spectra of lanthanum alginate bead before and after adsorption confirm its stable skeletal structure.Scanning electron microscopy shows that the dense surface structure of the adsorbent appear cracks after adsorption.The adsorption mechanism of lanthanum alginate bead is considered as an ion exchange between F- and Cl- or OH-,as verified from the adsorbent and the solution by pH effect, energy dispersive X-ray, and ion chromatography.

Datablock: hd141

Indian Academy of Sciences (India)

2016-01-15

Jan 15, 2016 ... checkCIF/PLATON page 2 http://checkcif.iucr.org/cgibin/checkcif_hkl.pl. 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

40 CFR 141.171 - Criteria for avoiding filtration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

Inductively coupled plasma optical emission spectrometry analysis of lanthanum, samarium and gadolinium oxides for rare earths impurities

International Nuclear Information System (INIS)

Reino, L.C.P.; Lordello, A.R.

1990-09-01

An inductively coupled plasma optical emission spectrometry method is described for the determination of Sm, Eu, La, Gd, Dy, Pr, Ho, Nd, Tb and Y in purified oxides of lanthanum, samarium and gadolinium. The method enables a simple, precise and readily available determination. Dissolution of the samples is achieved with diluted hydrochloric acid (1:1). The solutions are diluted to volume for a concentration of 1mg/ml. The lowest determination limit is 0,01% for most elements and 0,05 or 0,1% for a few rare earths in samarium and gadolinium matrices. Lanthanum, Samarium and Gadolinium concentrates with purity grade of 99,9%, 99,6% and 99,8%, respectively, can be analysed by this procedure. (author)

40 CFR 141.400 - General requirements and applicability.

Science.gov (United States)

2010-07-01

... system with fecally contaminated source water or with significant deficiencies subject to the treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements and applicability. 141.400 Section 141.400 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

The oxidation of carbon monoxide over transition metal doped lanthanum manganates nanoparticles

International Nuclear Information System (INIS)

Fal Desai, M.S.; Salker, A.V.

2012-01-01

Lanthanum manganates perovskites (ABO 3 ) has been widely studied and applied. Many perovskites with A and B sites doped with different metals show good catalytic activity in many oxidation reactions than the individual perovskite. In present study, an attempt has been made to show comparative account of CO oxidation by doping the B site with different cations using sol-gel method

25 CFR 141.27 - Trade in imitation Indian crafts prohibited.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in imitation Indian crafts prohibited. 141.27 Section 141.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.27 Trade in imitation...

40 CFR 141.25 - Analytical methods for radioactivity.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

21 CFR 150.141 - Artificially sweetened fruit jelly.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... locust bean gum), guar gum, gum karaya, gum tragacanth, algin (sodium alginate), sodium...

Thermal stability and microstructure of catalytic alumina composite support with lanthanum species

Science.gov (United States)

Ozawa, Masakuni; Nishio, Yoshitoyo

2016-09-01

Lanthanum (La) modified γ-alumina composite was examined for application toward thermostable catalytic support at elevated temperature. La added alumina was prepared through an aqueous process using lanthanum (III) nitrate and then characterized by surface area measurement, X-ray powder diffraction (XRD), differential thermal analysis (DTA), scanning electron microscope (SEM), transmission electron microscope (TEM), X-ray photoemission spectroscopy (XPS) and surface desorption of CO2. It was found that the properties depended on the La content and heat treatment temperatures. The characterization of the surface, structural and chemical properties of La-Al2O3 showed the existence of a strong interaction between the La species and alumina via formation of new phase and modified surface in Al2O3 samples. LaAlO3 nanoparticle formed among alumina particles by the solid phase reaction of Al2O3 and La2O3. The increase of the surface basicity of La modified alumina was demonstrated using CO2 temperature programmed desorption experiments. The controlled surface interaction between La oxide and alumina provide the unique surface and structural properties of the resulting mixed oxides as catalysts and catalytic supports.

40 CFR 141.41 - Special monitoring for sodium.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

40 CFR 141.134 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

... meeting the criterion in § 141.135(a)(2)(vi). (vi) The running annual average of source water alkalinity for systems meeting the criterion in § 141.135(a)(2)(iii) and of treated water alkalinity for systems...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Disinfectant Residuals...

Cost-Effectiveness of First-Line Sevelamer and Lanthanum versus Calcium-Based Binders for Hyperphosphatemia of Chronic Kidney Disease.

Science.gov (United States)

Habbous, Steven; Przech, Sebastian; Martin, Janet; Garg, Amit X; Sarma, Sisira

2018-03-01

Phosphate binders are used to treat hyperphosphatemia among patients with chronic kidney disease (CKD). To conduct an economic evaluation comparing calcium-free binders sevelamer and lanthanum with calcium-based binders for patients with CKD. Effectiveness data were obtained from a recent meta-analysis of randomized trials. Effectiveness was measured as life-years gained and translated to quality-adjusted life-years (QALYs) using utility weights from the literature. A Markov model consisting of non-dialysis-dependent (NDD)-CKD, dialysis-dependent (DD)-CKD, and death was developed to estimate the incremental costs and effects of sevelamer and lanthanum versus those of calcium-based binders. A lifetime horizon was used and both costs and effects were discounted at 1.5%. All costs are presented in 2015 Canadian dollars from the Canadian public payer perspective. Results of probabilistic sensitivity analysis were presented using cost-effectiveness acceptability curves. Sensitivity analyses were conducted for risk pooling methods, omission of dialysis costs, and persistence of drug effects on mortality. Sevelamer resulted in an incremental cost-effectiveness ratio of $106,522/QALY for NDD-CKD and $133,847/QALY for DD-CKD cohorts. Excluding dialysis costs, sevelamer was cost-effective in the NDD-CKD cohort ($5,847/QALY) and the DD-CKD cohort ($11,178/QALY). Lanthanum was dominated regardless of whether dialysis costs were included. Existing evidence does not clearly support the cost-effectiveness of non-calcium-containing phosphate binders (sevelamer and lanthanum) relative to calcium-containing phosphate binders in DD-CKD patients. Our study suggests that sevelamer may be cost-effective before dialysis onset. Because of the remaining uncertainty in several clinically relevant outcomes over time in DD-CKD and NDD-CKD patients, further research is encouraged. Copyright © 2018 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier

Synthesis and Stability of Lanthanum Superhydrides

Energy Technology Data Exchange (ETDEWEB)

Geballe, Zachary M. [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Liu, Hanyu [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Mishra, Ajay K. [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Permanent address: HP& SRPD, Bhabha Atomic Research Center, Mumbai-85 India; Ahart, Muhtar [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Somayazulu, Maddury [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Meng, Yue [HPCAT, Geophysical Laboratory, Carnegie Institution of Washington, Argonne IL 60439 USA; Baldini, Maria [Geophysical Laboratory, Carnegie Institution of Washington, Washington DC 20015 USA; Hemley, Russell J. [Institute of Materials Science and Department of Civil and Environmental Engineering, The George Washington University, Washington DC 20052 USA

2017-12-15

Recent theoretical calculations predict that megabar pressure stabilizes very hydrogen-rich simple compounds having new clathrate-like structures and remarkable electronic properties including room-temperature superconductivity. X-ray diffraction and optical studies demonstrate that superhydrides of lanthanum can be synthesized with La atoms in an fcc lattice at 170 GPa upon heating to about 1000 K. The results match the predicted cubic metallic phase of LaH10 having cages of thirty-two hydrogen atoms surrounding each La atom. Upon decompression, the fcc-based structure undergoes a rhombohedral distortion of the La sublattice. The superhydride phases consist of an atomic hydrogen sublattice with H-H distances of about 1.1 Å, which are close to predictions for solid atomic metallic hydrogen at these pressures. With stability below 200 GPa, the superhydride is thus the closest analogue to solid atomic metallic hydrogen yet to be synthesized and characterized.

7 CFR 58.141 - Alternate quality control program.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control program. 58.141 Section 58... Service 1 Quality Specifications for Raw Milk § 58.141 Alternate quality control program. When a plant has in operation an acceptable quality program, at the producer level, which is approved by the...

25 CFR 141.14 - Trade in livestock restricted.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Trade in livestock restricted. 141.14 Section 141.14... livestock restricted. (a) No person other than an enrolled member of the tribe or any association... livestock from tribal members without a special permit issued by the Commissioner. (b) The Commissioner...

Cerium-activated lanthanum beryllate as a gamma detector material

International Nuclear Information System (INIS)

Czirr, J.B.; Berrondo, M.

1994-01-01

The authors have tested a single crystal of Ce-activated lanthanum beryllate BEL(Ce) as a potential gamma detector material. The density (6.1 g.cm -3 ) and decay time (50 ns) are competitive with other recently developed materials. The scintillation efficiency is 57 to 95% that of BGO. For an excitation wavelength of 340 nm, the emission spectra is a broad peak centered at 450 mn. The H 2 annealed sample is transparent for wavelengths greater than 400 mn. They are continuing a program to improve the scintillation efficiency by varying the crystal growth conditions

Synthesis of calcium doped lanthanum manganite by mechanosynthesis

International Nuclear Information System (INIS)

Bolarin, A.M.; Sanchez, F.; Palomares, S.; Aguilar, J.A.; Torres-Villasenor, G.

2007-01-01

Lanthanum manganite doped with calcium, Ca 1/3 La 2/3 MnO 3-δ , was prepared by a high-energy ball milling. The precursors used were Mn 2 O 3 , La 2 O 3 and CaO, mixed in the stoichiometric ratio to obtain this manganite. The mechano-chemical process was performed at room temperature in a SPEX 8000D mixer/mill, using hardened steel balls and stainless steel vials, in air atmosphere. X-ray diffraction was used to elucidate the phase transformation as a function of the milling time. The Rietveld refinement was used in order to characterize structurally the manganites. The morphology and particle size of powder compound obtained were characterized by scanning electron microscope. The particle size of this powder material was measured with zeta size analyzer, and selected area electron diffraction (SAED) from TEM was used to elucidate the crystalline structure of this powder compound. The results showed that it is possible to obtain calcium doped lanthanum manganite by mechano-synthesis, using a weight ratio of ball to powder of 12:1, after 3 h of milling. The evolution of the phase transformation during the milling time is reported. Increases in milling time produce exponential decrease in the particle size, up to 680 nm after 1 h of milling. After the milling process it is obtained a powder compound with an orthorhombic structure (S.G. Pbnm). A prolonged milling time (>9 h) produce an important reduction in the particle size but this is accompanied with a high iron contamination caused by metallic residues originated from vial and balls and also, after 9 h of milling time, it was found an important distortion in orthorhombic structure, obtaining two types of parameters

Solid state interaction studies on binary nitrate mixtures of uranyl nitrate hexahydrate and lanthanum nitrate hexahydrate at elevated temperatures

Energy Technology Data Exchange (ETDEWEB)

Kalekar, Bhupesh; Raje, Naina, E-mail: nraje@barc.gov.in; Reddy, A.V.R.

2017-02-15

Interaction behavior of uranyl nitrate hexahydrate (UNH) and lanthanum nitrate hexahydrate (LaNH) have been investigated on the mixtures in different molar ratios of the two precursors and monitoring the reactions at elevated temperatures with thermoanalytical and X-ray diffraction measurement techniques. During the decomposition of equimolar mixture of LaNH and UNH, formation of lanthanum uranate (U{sub 0.5}La{sub 0.5})O{sub 2}, was seen by the temperature of 500 °C along with lanthanum oxide (La{sub 2}O{sub 3}) and uranium trioxide (UO{sub 3}). By the temperature of 700 °C, the formation of uranium sesquioxide (U{sub 3}O{sub 8}) was observed along with (U{sub 0.5}La{sub 0.5})O{sub 2} as end products in uranium rich mixtures. Lanthanum rich compositions decomposed by the temperature of 700 °C to give (U{sub 0.5}La{sub 0.5})O{sub 2} and La{sub 2}O{sub 3} as end products. - Highlights: • UO{sub 2}(NO{sub 3}){sub 2}.6H{sub 2}O and La(NO{sub 3}){sub 3}.6H{sub 2}O interact through their intermediates. • Formation of (U{sub 0.5}La{sub 0.5})O{sub 2} by 500 °C. • La deficient mixtures decompose to give U{sub 3}O{sub 8} and (U{sub 0.5}La{sub 0.5})O{sub 2} as end products. • La rich mixtures decompose to give La{sub 2}O{sub 3} and (U{sub 0.5}La{sub 0.5})O{sub 2} as end product.

40 CFR 141.63 - Maximum contaminant levels (MCLs) for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels (MCLs) for microbiological contaminants. 141.63 Section 141.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.63 Maximum...

40 CFR 141.403 - Treatment technique requirements for ground water systems.

Science.gov (United States)

2010-07-01

... ground water systems. 141.403 Section 141.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Ground Water Rule § 141... customer as follows: (i) Chemical disinfection—(A) Ground water systems serving greater than 3,300 people...

Fine Structure in Proton Emission from the Deformed 141g.sHo and 141mHo

International Nuclear Information System (INIS)

Karny, M.; Rykaczewski, Krzysztof Piotr; Grzywacz, R.; Batchelder, J.C.; Bingham, C.R.; Goodin, C. T.; Gross, Carl J.; Hamilton, J.H.; Korgul, A.; Krolas, W.; Liddick, S. N.; Li, K.; Maier, Karl; Mazzocchi, C.; Piechaczek, A.; Shapira, Dan; Simpson, D.; Tantawy, M.N.; Winger, J.A.; Yu, Chang-Hong; Zganjar, E. F.

2007-01-01

Fine structure in proton emission from the deformed states 141g.s Ho (T 1/2 = 4.1 ms) and 141 mHo (T 1/2 = 7.4 (micro)s) has been discovered at Oak Ridge by detecting fusion evaporation residues with the Recoil Mass Spectrometer, Si-detectors and digital signal processing electronics. The branching ratios to the first 2 + excited state in 140 Dy were measured to be I p g.s. (2 + ) = 0.9±0.1% and I p m (2 + ) = 1.7±0.5%. A comparison of the available calculations to the experimental values calls for further development of the theoretical models

Paramagnetic centers in two phases of manganese-doped lanthanum gallate

Science.gov (United States)

Vazhenin, V. A.; Potapov, A. P.; Guseva, V. B.; Artyomov, M. Yu.

2009-05-01

An EPR study of two phases of manganese-doped lanthanum gallate (with a first-order structural transition occurring at 430 K) has revealed Gd3+, Fe3+, and Mn4+ centers at room temperature and 438 K. The parameters of spin Hamiltonians are determined for the Gd3+, Fe3+, and Mn4+ rhombohedral centers in the high-temperature phase (with no other centers found here) and for the monoclinic center Gd3+ in the low-temperature phase. Both in the orthorhombic and in the rhombohedral phase, crystallographic twins (or ferroelastic domains) are observed.

Lanthanum gallate substrates for epitaxial high-temperature superconducting thin films

Science.gov (United States)

Sandstrom, R. L.; Giess, E. A.; Gallagher, W. J.; Segmuller, A.; Cooper, E. I.

1988-11-01

It is demonstrated that lanthanum gallate (LaGaO3) has considerable potential as an electronic substrate material for high-temperature superconducting films. It provides a good lattice and thermal expansion match to YBa2Cu3O(7-x), can be grown in large crystal sizes, is compatible with high-temperature film processing, and has a reasonably low dielectric constant and low dielectric losses. Epitaxial YBa2Cu3O(7-x) films grown on LaGaO3 single-crystal substrates by three techniques have zero resistance between 87 and 91 K.

Bordoni relaxation and magnetic transformation in cerium and cerium-lanthanum alloys

Energy Technology Data Exchange (ETDEWEB)

Postnikov, V S; Polner, G L; Sharshakov, I M

1975-11-01

The internal friction in pure cerium and cerium-base alloys with 2.5 and 12 weight percent of lanthanum added at temperature ranging from 4.2 deg up to 77/sup 0/K is described. Amplitude-independent internal friction has been measured with an inverse torsion pendulum with a specimen oscillation frequency of 1-30 hz in vacuum not less than 1.10/sup -5/ torr. A temperature of the specimen has been determined with a capacitance-type sensor and a gas gage. A curve showing the dependence of internal friction upon a temperature of pure cerium has two distinct peaks; the first at 12.5/sup 0/K, the second at 45/sup 0/K. The 12.5/sup 0/K peak is accounted for by a transition of antiferromagnetic ..beta..-Ce into a paramagnetic state. The 45/sup 0/K peak is a Bordoni maximum. The paper describes an influence of additions, specimen oscillation frequency variations, deformation and annealing upon the peak behavor. Added lanthanum reduces not only a peak temperature but a height as well. Studies of the 45/sup 0/K peak have shown that its temperature location depends upon the specimen oscillation frequency. As the frequency increases the peak tends to a range of high temperatures which confirms its relaxation nature.

Phases in lanthanum-nickel-aluminum alloys

International Nuclear Information System (INIS)

Mosley, W.C.

1992-01-01

Lanthanum-nickel-aluminum (LANA) alloys will be used to pump, store and separate hydrogen isotopes in the Replacement Tritium Facility (RTF). The aluminum content (y) of the primary LaNi 5 -phase is controlled to produce the desired pressure-temperature behavior for adsorption and desorption of hydrogen. However, secondary phases cause decreased capacity and some may cause undesirable retention of tritium. Twenty-three alloys purchased from Ergenics, Inc. for development of RTF processes have been characterized by scanning electron microscopy (SEM) and by electron microprobe analysis (EMPA) to determine the distributions and compositions of constituent phases. This memorandum reports the results of these characterization studies. Knowledge of the structural characteristics of these alloys is a useful first step in selecting materials for specific process development tests and in interpreting results of those tests. Once this information is coupled with data on hydrogen plateau pressures, retention and capacity, secondary phase limits for RTF alloys can be specified

Synthesis and stability of lanthanum superhydrides

Energy Technology Data Exchange (ETDEWEB)

Geballe, Zachary M.; Liu, Hanyu; Mishra, Ajay K.; Ahart, Muhtar; Somayazulu, Maddury; Baldini, Maria [Geophysical Laboratory, Carnegie Institution, Washington, DC (United States); Meng, Yue [HPCAT, Geophysical Laboratory, Carnegie Institution of Washington, Argonne, IL (United States); Hemley, Russell J. [Institute of Materials Science and Department of Civil and Environmental Engineering, The George Washington University, Washington, DC (United States)

2018-01-15

Recent theoretical calculations predict that megabar pressure stabilizes very hydrogen-rich simple compounds having new clathrate-like structures and remarkable electronic properties including room-temperature superconductivity. X-ray diffraction and optical studies demonstrate that superhydrides of lanthanum can be synthesized with La atoms in an fcc lattice at 170 GPa upon heating to about 1000 K. The results match the predicted cubic metallic phase of LaH{sub 10} having cages of thirty-two hydrogen atoms surrounding each La atom. Upon decompression, the fcc-based structure undergoes a rhombohedral distortion of the La sublattice. The superhydride phases consist of an atomic hydrogen sublattice with H-H distances of about 1.1 Aa, which are close to predictions for solid atomic metallic hydrogen at these pressures. With stability below 200 GPa, the superhydride is thus the closest analogue to solid atomic metallic hydrogen yet to be synthesized and characterized. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

40 CFR 141.13 - Maximum contaminant levels for turbidity.

Science.gov (United States)

2010-07-01

... turbidity. 141.13 Section 141.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Maximum contaminant levels for turbidity. The maximum contaminant levels for turbidity are applicable to... part. The maximum contaminant levels for turbidity in drinking water, measured at a representative...

Preferable adsorption of phosphate using lanthanum-incorporated porous zeolite: Characteristics and mechanism

Science.gov (United States)

He, Yinhai; Lin, Hai; Dong, Yingbo; Wang, Liang

2017-12-01

The adsorbent, where lanthanum oxide was incorporated onto porous zeolite (La-Z), of preferable adsorption towards phosphate was prepared by hydrothermal synthesis. Based on pH effect results, La-Z would effectively sequestrate phosphate over wider pH range of 3.0-7.0, alkaline conditions were unfavorable for phosphate. The adsorption of phosphate was not significantly influenced by ionic strength and by coexisting anions of chloride, nitrate and sulfate but bicarbonate showed slightly greater negative effects, indicating La-Z possessed highly selectivity to phosphate. Adsorption of phosphate could be well fitted by pseudo-second-order model and the process was mainly controlled by intra-particle diffusion. Equilibrium adsorption demonstrated that Langmuir model was more suitable than Freundlich model for description phosphate adsorption and the adsorption capacity was 17.2 mg P g-1, which exhibited 95% utilization of incorporated La. Over 95% phosphate was eliminated in real effluent treatment when the dose was 2 g L-1. The underlying mechanism for phosphate capture was probed with Zeta potential and X-ray photoelectron spectroscope analysis, and the formation of La-P inner-sphere complexation was testified to be the dominant pathway. All the results suggested that the porous zeolite-supported lanthanum oxide can serve as a promising adsorbent for phosphate removal in realistic application.

26 CFR 1.141-6 - Allocation and accounting rules.

Science.gov (United States)

2010-04-01

... 1.141-6 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-6.... Thus, allocations generally may be made using any reasonable, consistently applied accounting method...

Atom states and interatomic interactions in complex perovskite-like oxides. Communication XX. Origin of electron-ionic conductivity in lanthanum gallates doped with strontium and chromium

International Nuclear Information System (INIS)

Chezhina, N.V.; Zolotukhina, N.V.; Pijr, I.V.

2006-01-01

Magnetic susceptibilities and electric conductivities of solid solutions based on lanthanum gallate containing chromium and strontium atoms in the ratio of 10 : 2 were studied. It was shown that no partial oxidation of chromium to Cr(IV) occurs when lanthanum gallate is doped with chromium and strontium simultaneously, whereas the ionic conductivity is associated with the appearance of vacancies stabilized by chromium atoms in the oxygen sublattice [ru

Internal-standard method for the determination of uranium, thorium, lanthanum and europium in carbonaceous shale and monazite by epithermal neutron activation analysis

Energy Technology Data Exchange (ETDEWEB)

Chen, Shuenn-Gang; Tsai, Hui-Tuh; Wu, Shaw-Chii [Institute of Nuclear Energy Research, Lung-Tan (Taiwan, Republic of China)

1981-10-03

An internal-standard method was applied for the determination of uranium, thorium, lanthanum and europium is carbonaceous shale samples and monazite sand by epithermal neutron activation analysis using gold as an internal standard element. The samples were irradiated in a zero-power reactor at the Institute of Nuclear Energy Research and measured with a high-resolution Ge(Li) detector. The detection limit is 0.1 ppm for uranium and europium, 1 ppm for thorium, 5 ppm for lanthanum, and the realative error of all elements is within +-2.6%.

Relaxation effects in oxygen-conducting oxides on base of lanthanum gallate (La, Sr)(Ga, Me)O3, Me = Mg, Fe

International Nuclear Information System (INIS)

Glavatskikh, T.Yu.; Venskovskij, N.U.; Kaleva, G.M.; Mosunov, A.V.; Politova, E.D.; Stefanovich, S.Yu.

2003-01-01

The dielectric and electric conducting properties of the heterosubstituted perovskite-like solid solutions (La, Sr)(Ga, Me)O 3 , Me Mg, Fe are studied. The increase in the ceramics electric conductivity, conditioned by increase in the ion constituent at strengthening the nonstoichiometry by oxygen and electron constituent by the additional introduction of iron is observed by replacing the part of the lanthanum and gallium cations by strontium, magnesium and iron in the solid solutions on the basis of the lanthanum gallate. The ceramics relaxation behavior is identified; the applicability of the model of the vacational electron transfer for the dipole relaxation is established [ru

40 CFR 141.205 - Content of the public notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Content of the public notice. 141.205 Section 141.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS..., especially those who may not have received this notice directly (for example, people in apartments, nursing...

Ionic conductivity and fuel cell properties of apatite-type lanthanum silicates doped with Mg and containing excess oxide ions

Energy Technology Data Exchange (ETDEWEB)

Yoshioka, Hideki [Hyogo Prefectural Institute of Technology, 3-1-12 Yukihira-cho, Suma-ku, Kobe 654-0037 (Japan); Nojiri, Yoshihiro [Kyushu University, Department of Mechanical Engineering Science, Faculty of Engineering, Motooka 744, Nishi-ku, Fukuoka 819-0935 (Japan); Tanase, Shigeo [National Institute of Advanced Industrial Science and Technology, 1-8-31 Midorigaoka, Ikeda, Osaka 563-8577 (Japan)

2008-11-30

Enhancement of the ionic conductivity of lanthanum silicate-based apatites is examined with emphasis on optimizing the La composition and the Mg doping level at the same time. La{sub 10}Si{sub 5.8}Mg{sub 0.2}O{sub 26.8} and La{sub 9.8}Si{sub 5.7}Mg{sub 0.3}O{sub 26.4} show the highest level of the ionic conductivities among apatite silicates, 8.8 and 7.4 x 10{sup -} {sup 2} S cm{sup -} {sup 1} at 800 C, respectively, with a very low level of activation energy (0.42-0.43 eV). Their conductivities are higher than yttria stabilized zirconia (YSZ) below 900 C and even comparable to Sr and Mg doped lanthanum gallate (LSGM) below 550 C. A solid oxide fuel cell using La{sub 9.8}Si{sub 5.7}Mg{sub 0.3}O{sub 26.4} as an electrolyte with Ni-ceria cermet anode and Sr doped lanthanum cobaltite cathode exhibits a remarkable improvement in power generation compared to previous data using Pt electrodes. Structural investigation by the Rietveld analysis on the powder X-ray diffraction pattern shows significant enlargement of the bottleneck triangle sizes of the conduction channel with the Mg doping. (author)

Sinterability and conductivity of barium doped aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} electrolyte of solid oxide fuel cells

Energy Technology Data Exchange (ETDEWEB)

Cao Xiaoguo [Faculty of Materials and Energy, Guangdong University of Technology, Guangzhou 510006, Guangdong (China); Jiang Sanping, E-mail: s.jiang@curtin.edu.au [Fuels and Energy Technology Institute and Department of Chemical Engineering, Curtin University, Perth, WA 6102 (Australia)

2012-05-15

Highlights: Black-Right-Pointing-Pointer Ba doping enhances the sintering and densification properties of aluminium lanthanum apatite. Black-Right-Pointing-Pointer Ba doping improves the oxide conductivity of aluminium lanthanum apatite. Black-Right-Pointing-Pointer The enhancement of Ba doping is mainly due to the significantly reduced grain boundary resistance of the aluminium lanthanum apatite. - Abstract: Apatite ceramics are interesting alternative solid oxide fuel cells (SOFCs) electrolytes because of their open structure for the transportation of oxide ions and their good chemical stability. This study reports the influence of barium doping on the microstructure, sinterability and oxide conductivity properties of the aluminium lanthanum oxyapatite La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5}. SEM results show that lanthanum substitution with barium improves the sinterability of apatite ceramics. The barium doping also enhances the conductivity of the aluminium lanthanum silicates. The oxygen ion conductivity of La{sub 9.5}Ba{sub 0.5}Si{sub 5.5}Al{sub 0.5}O{sub 26.5} sintered at 1600 Degree-Sign C is 2.21 Multiplication-Sign 10{sup -2} S cm{sup -1} at 800 Degree-Sign C, higher than 9.81 Multiplication-Sign 10{sup -3} S cm{sup -1} of La{sub 10}Si{sub 5}AlO{sub 26.5} sample prepared under the same conditions. The results in the present study demonstrate that doping Ba on the La site for aluminium lanthanum oxyapatite reduces the sintering temperature and improves the ion conductivity. The enhancement of Ba dopant is mainly on the improvement of the densification and thus substantially reduced grain boundary resistance of aluminium lanthanum oxyapatite particularly at low temperatures.

In situ XANES cell used for the study of lanthanum strontium cuprate deNOx catalysts

DEFF Research Database (Denmark)

Hagen, Anke

2011-01-01

, maintaining charge neutrality, with the concentration of oxygen vacancies likely increasing at substitution ratios larger than Sr/La>0.08. During heating in air, the valence of copper ions in the structure increased. Upon exposure to NO at 500 °C the valence of copper ions in a lanthanum strontium cuprate...

Lanthanum gallate substrates for epitaxial high-temperature superconducting thin films

International Nuclear Information System (INIS)

Sandstrom, R.L.; Giess, E.A.; Gallagher, W.J.; Segmueller, A.; Cooper, E.I.; Chisholm, M.F.; Gupta, A.; Shinde, S.; Laibowitz, R.B.

1988-01-01

We demonstrate that lanthanum gallate (LaGaO 3 ) has considerable potential as an electronic substrate material for high-temperature superconducting films. It provides a good lattice and thermal expansion match to YBa 2 Cu 3 O/sub 7-//sub x/, can be grown in large crystal sizes, is compatible with high-temperature film processing, and has a reasonably low dielectric constant (ε≅25) and low dielectric losses. Epitaxial YBa 2 Cu 3 O/sub 7-//sub x/ films grown on LaGaO 3 single-crystal substrates by three techniques have zero resistance between 87 and 91 K

Catalytic activity of lanthanum oxide for the reduction of cyclohexanone

International Nuclear Information System (INIS)

Sugunan, S.; Sherly, K.B.

1994-01-01

Lanthanum oxides, La 2 O 3 has been found to be an effective catalyst for the liquid phase reduction of cyclohexanone. The catalytic activities of La 2 O 3 activated at 300, 500 and 800 degC and its mixed oxides with alumina for the reduction of cylcohexanone with 2-propanol have been determined and the data parallel that of the electron donating properties of the catalysts. The electron donating properties of the catalysts have been determined from the adsorption of electron acceptors of different electron affinities on the surface of these oxides. (author). 15 refs., 2 figs., 1 tab

40 CFR 141.72 - Disinfection.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.72 Disinfection. A public water... the direct influence of surface water and provides filtration treatment must provide disinfection...) Disinfection requirements for public water systems which provide filtration. Each public water system that...

19 CFR 141.1 - Liability of importer for duties.

Science.gov (United States)

2010-04-01

... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

Effects of polyaluminum chloride and lanthanum-modified bentonite on the growth rates of three Cylindrospermopsis raciborskii strains

NARCIS (Netherlands)

Araújo, Fabiana; van Oosterhout, Frank; Becker, Vanessa; Attayde, José Luiz; Lürling, Miquel

2018-01-01

In tropical and subtropical lakes, eutrophication often leads to nuisance blooms of Cylindrospermopsis raciborskii. In laboratory experiments, we tested the combined effects of flocculant polyaluminum chloride (PAC) and lanthanum-modified bentonite (LMB) on the sinking and growth rates of three C.

effect of post-precipitation treatment on the pore-structure stability of sol-gel derived lanthanum zirconate

NARCIS (Netherlands)

Nair, Jalajakumari; Kumar, K.N.P.; Nair, P.; van Ommen, J.G.; Ross, J.R.H.; Ross, Julian R.H.; Burggraaf, Anthonie J.; Burggraaf, Anthonie

1998-01-01

The importance of post-precipitation treatments (pore-fluid exchange and its removal) on the evolution of the texture of coprecipitated lanthanum zirconate has been investigated. The nature of the pore fluid and the type of fluid-removal (drying) process have shown a profound effect on the aggregate

Synthesis and investigation of saturated vapor pressure of lanthanum, praseodymium and neodymium tris-isopropylcyclopentadienyls

International Nuclear Information System (INIS)

Devyatykh, G.G.; Chernyaev, N.P.; Zverev, Yu.B.; Gavrishchuk, E.M.; Runovskaya, I.V.; Krupnova, Eh.F.; Chesnokova, S.G.

1980-01-01

Lanthanum, praseodymium and neodymium tris-isopropylcyclopentadienyls are synthesized with corresponding unhydrous chlorides in tetrahydrofuran solution. Saturated vapour pressure of substances obtained is studied in the 150-262 deg C range by the statistic method using a compensation zero-manometer. Vapour pressure of the compounds in question is shown to increase with the growth of the rare earth element number [ru

40 CFR 141.801 - Definitions.

Science.gov (United States)

2010-07-01

... aircraft that supply water for human consumption to passengers or crew. Aircraft water system operations... distribution and consumption without further treatment, except as treatment necessary to maintain water quality...). (40 CFR 141.2) Human consumption means drinking, bathing, showering, hand washing, teeth brushing...

Non-natives: 141 scientists object

NARCIS (Netherlands)

Simberloff, D.; Van der Putten, W.H.

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. dsimberloff@utk.edu Jake Alexander Institute of Integrative

Angle resolved x-ray photoelectron spectroscopy (ARXPS) analysis of lanthanum oxide for micro-flexography printing

Energy Technology Data Exchange (ETDEWEB)

Hassan, S., E-mail: suhaimihas@uthm.edu.my; Yusof, M. S., E-mail: mdsalleh@uthm.edu.my; Maksud, M. I., E-mail: midris1973@gmail.com [Faculty of Mechanical and Manufacturing Engineering, Universiti Tun Hussein Onn Malaysia, 86400 Batu Pahat, Johor (Malaysia); Embong, Z., E-mail: zaidi@uthm.edu.my [Faculty of Science, Technology and Human Development, Universiti Tun Hussein Onn Malaysia, 86400 Batu Pahat, Johor (Malaysia)

2016-01-22

Micro-flexography printing was developed in patterning technique from micron to nano scale range to be used for graphic, electronic and bio-medical device on variable substrates. In this work, lanthanum oxide (La{sub 2}O{sub 3}) has been used as a rare earth metal candidate as depositing agent. This metal deposit was embedded on Carbon (C) and Silica (Si) wafer substrate using Magnetron Sputtering technique. The choose of Lanthanum as a target is due to its wide application in producing electronic devices such as thin film battery and printed circuit board. The La{sub 2}O{sub 3} deposited on the surface of Si wafer substrate was then analyzed using Angle Resolve X-Ray Photoelectron Spectroscopy (ARXPS). The position for each synthetic component in the narrow scan of Lanthanum (La) 3d and O 1s are referred to the electron binding energy (eV). The La 3d narrow scan revealed that the oxide species of this particular metal is mainly contributed by La{sub 2}O{sub 3} and La(OH){sub 3}. The information of oxygen species, O{sup 2-} component from O 1s narrow scan indicated that there are four types of species which are contributed from the bulk (O{sup 2−}), two chemisorb component (La{sub 2}O{sub 3}) and La(OH){sub 3} and physisorp component (OH). Here, it is proposed that from the adhesive and surface chemical properties of La, it is suitable as an alternative medium for micro-flexography printing technique in printing multiple fine solid lines at nano scale. Hence, this paper will describe the capability of this particular metal as rare earth metal for use in of micro-flexography printing practice. The review of other parameters contributing to print fine lines will also be described later.

Angle resolved x-ray photoelectron spectroscopy (ARXPS) analysis of lanthanum oxide for micro-flexography printing

Science.gov (United States)

Hassan, S.; Yusof, M. S.; Embong, Z.; Maksud, M. I.

2016-01-01

Micro-flexography printing was developed in patterning technique from micron to nano scale range to be used for graphic, electronic and bio-medical device on variable substrates. In this work, lanthanum oxide (La2O3) has been used as a rare earth metal candidate as depositing agent. This metal deposit was embedded on Carbon (C) and Silica (Si) wafer substrate using Magnetron Sputtering technique. The choose of Lanthanum as a target is due to its wide application in producing electronic devices such as thin film battery and printed circuit board. The La2O3 deposited on the surface of Si wafer substrate was then analyzed using Angle Resolve X-Ray Photoelectron Spectroscopy (ARXPS). The position for each synthetic component in the narrow scan of Lanthanum (La) 3d and O 1s are referred to the electron binding energy (eV). The La 3d narrow scan revealed that the oxide species of this particular metal is mainly contributed by La2O3 and La(OH)3. The information of oxygen species, O2- component from O 1s narrow scan indicated that there are four types of species which are contributed from the bulk (O2-), two chemisorb component (La2O3) and La(OH)3 and physisorp component (OH). Here, it is proposed that from the adhesive and surface chemical properties of La, it is suitable as an alternative medium for micro-flexography printing technique in printing multiple fine solid lines at nano scale. Hence, this paper will describe the capability of this particular metal as rare earth metal for use in of micro-flexography printing practice. The review of other parameters contributing to print fine lines will also be described later.

Thermoluminescent kinetic parameters of the perovskite, KMgF3, activated with lanthanum

International Nuclear Information System (INIS)

Sepulveda M, F.; Azorin N, J.; Rivera M, T.; Furetta, C.; Sanipoli, C.

2004-01-01

The thermoluminescent curves induced by the beta radiation in the perovskite KMgF 3 were investigated activated with lanthanum. The classic methods were used to determine the kinetic parameters (the kinetic order b, the activation energy E and the frequency of escape intent s) associated with the peaks of the thermoluminescent curve (Tl) in the KMgF 3 activated with lanthanum after the irradiation with beta rays. The method is based on the position of the thermoluminescent peaks, obtained of the temperature change of the peak in the maximum emission caused by the change in the heating rapidity to which the samples were measured. In this work, the samples in form of pellets were re cooked previously at 400 C during one hour before irradiating them with beta particles. The Tl measures were made with a Tl reader system using three different heating rapidities and storing the glow curves. To calculate the depth of the E traps and the frequency factor s, the parameters of the glow curve were determined experimentally of the shame of the glow curve by means of the mensuration of the shame of the maximum temperature of the peak, T M like a function of the heating rapidity. The results indicate that the values of the kinetic parameters are very near among if when they are obtained indistinctly of anyone of the different methods. (Author)

The origin of current blocking in interfacial conduction in Sr-doped lanthanum gallates

Science.gov (United States)

Park, Hee Jung

2018-02-01

The grain boundary transport of lanthanum gallate has been studied with various doping concentrations, and the origins of blocking on the grain boundary are compared. La1-xSrxGaO3 samples (x = 0.005, 0.01, 0.05 and 0.1) have been prepared and their bulk (grain) and grain boundary resistances been experimentally measured as a function of temperature (T: 200-550 °C) and oxygen partial pressure (Po2) using ac-impedance measurements. In addition, Hebb-Wagner polarization measurements have been conducted to investigate the electrical conductivity of minor charge carriers in the lanthanum gallates. The grain boundary resistance in the low-doped materials (x = 0.005 and 0.01) increases with increasing Po2 while in the highly-doped materials (x = 0.05, 0.1) it hardly depended on Po2. At lower concentrations conduction is mixed and at higher concentrations is found to be predominantly ionic conductivity. The space charge model successfully describes the mixed conduction at the grain boundary at low-doping, but does not explain the predominant ionic conductivity at high-doping. The origin of blocking at high-doping is explained by the crystallographic asymmetry of the grain boundary with respect to the bulk and/or Sr-segregation.

Improved adaptation of test with lanthanum nitrate for the colorimetric estimation of acetate

Energy Technology Data Exchange (ETDEWEB)

Szumilo, T [Akademia Medyczna, Lublin (Poland)

1976-01-01

A colorimetric method for the determination of acetate based on the production of the blue complex between iodine and lanthanum alkaline acetate has been developed. Optimum concentrations of reagents (acetate, lanthanum nitrate, iodine and ammonia) as well as the volume of acetate were selected to achieve best colour intensity. Coloured complex was stabilized by dilution of reagent mixture with water to the final volume convenient for determinaton. Absorbance of the complex can be measured immediately after dilution and any changes can be observed during at least 15 minutes. Elevation of temperature over 60/sup 0/decreases absorbance. The method fulfills the Beer's law in the range 1,5-3,5 ..mu..moles of acetate, precision of the method 2/sup +/ = 3,7%. Apart from acetate - propionate and fluoroacetate complex is 620 nm, propionate complex - at 590 nm. Propionate complex displayed any relationship between concentration and absorbance. Potassium, sodium, lithium and barium acetates give the identical results as acetic acid, whereas zinc and cupric acetates failed to react. Other derivatives tested, e.g. chloroacetate, trichloroacetate, iodoacetate, chloroporpionate and butyrate are unable to form the coloured complexes. Many compounds interfere with the formation of acetate complex, therefore, in material containing impurities acetate can be determined after purificaton by means of described in literature methods.

40 CFR 141.401 - Sanitary surveys for ground water systems.

Science.gov (United States)

2010-07-01

... systems. 141.401 Section 141.401 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... an evaluation of the applicable components listed in paragraphs (c)(1) through (8) of this section... facilities, and controls, (6) Monitoring, reporting, and data verification, (7) System management and...

40 CFR 141.73 - Filtration.

Science.gov (United States)

2010-07-01

... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...

On the stability of the ternary phases in the La-Co-O system and the nonstoichiometry of lanthanum cobaltate

International Nuclear Information System (INIS)

Seppaenen, Matti

1979-01-01

The crystal structure of La 4 Co 3 O 10 , which is a new ternary phase identified in the present study, was determined by means of X-ray diffraction. It has an orthorhombic symmetry and its space group is most likely Fsub(mmm) (face-centered). On the basis of the thermodynamical studies of the La-Co-O system, the stable ternary phases are LaCoO 3 , La 4 Co 3 O 10 and La 2 CoO 4 . The stability limits of these phases were determined as a function of oxygen activity and temperature, and their molar Gibbs standard formation functions were calculated. Electrons, e', and electron holes, hsup(.), are majority defects in lanthanum cobaltate and their concentrations are exceptionally high and nearly constant in the temperature range 1178 - 1295 K. Under thermodynamically well defined conditions the nonstoichiometry of lanthanum cobaltate was determined as a function of oxygen activity and temperature by coulometric titration. In the oxygen partial pressure and temperature range of the present study the oxygen vacancies were ionic minority defects dependent on the activity of oxygen. Due to the high concentration of electronic defects the oxygen vancancy concentration increases high at low oxygen pressures. Oxygen vacancies behave ideally in lanthanum cobaltate i.e. obey Henry's law when their concentrations are <=0.01. (author)

Effect of Lanthanum as a Promoter on Fe-Co/SiO2 Catalyst for Fischer-Tropsch Synthesis

Directory of Open Access Journals (Sweden)

Ali Abbasi

2014-03-01

Full Text Available Iron-Cobalt catalyst is well known from both operational and economical aspects for Fischer-Tropsch synthesis. Effort to increase the efficiency of this kind of catalyst is an important research topic. In this work, the effect of lanthanum on characteristic behavior, conversion and selectivity of a Fe-Co/SiO2 Fischer-Tropsch catalyst was studied. The Fe-Co-La/SiO2 Catalysts were prepared using an incipient wetness impregnation method. These catalysts were then characterized by XRF-EDAX, BET and TPR techniques, and their performance were evaluated in a lab-scale reactor at 250ºC, H2/CO = 1.8 of molar ratio, 16 barg pressure and GHSV=600 h-1. TPR analysis showed that the addition of La lowered the reduction temperature of Fe-Co catalyst, and due to a lower temperature, the sintering of the catalyst can be mitigated. Furthermore, from the micro reactor tests (about 4 days, it was found that lanthanum promoted catalyst had higher selectivity toward hydrocarbons, and lower selectivity toward CO2.Received: 8th July 2013; Revised: 18th November 2013; Accepted: 1st December 2013[How to Cite: Abbasi, A., Ghasemi, M., Sadighi, S. (2014. Effect of Lanthanum as a Promoter on Fe-Co/SiO2 Catalyst for Fischer-Tropsch Synthesis. Bulletin of Chemical Reaction Engineering & Catalysis, 9 (1: 23-27. (doi:10.9767/bcrec.9.1.5142.23-27][Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.1.5142.23-27

Lanthanum chromite colloidal processing; Processamento coloidal de cromito de lantanio

Energy Technology Data Exchange (ETDEWEB)

Setz, Luiz Fernando Grespan

2009-07-01

Lanthanum chromite (LaCrO{sub 3}) is currently the most studied material for applications such as solid oxide fuel cell inter connector (HTSOFC). The complexity of microstructures and geometries of HTSOFC devices, require a precise control of processing parameters to get the desired combination of properties and this, the use of techniques involving concentrated ceramic slips conformation are appropriate, therefore, is well controlled, assist in obtaining homogeneous parts, reproductive and complex geometries. Thus, studies involving the surface chemistry, the stability conditions and slips flow behaviour in the forming conditions, provide important elements for processes control in the inter connectors manufacture, where more applied settings have slots and channels for the gases passage. Thus, surface chemistry, stability and rheological behaviour of strontium and cobalt doped LaCrO{sub 3} (La{sub 0.80}Sr{sub 0.20}Cr{sub 0.92}Co{sub 0.08}O{sub 3}) slips prepared with ethanol and water, were studied. The doped lanthanum chromite was produced by combustion synthesis in the IPEN/SP labs. The influence of parameters: p H (water), dispersant concentration, homogenization times and conditions, solid concentration, different ratios binder:plasticizer in the stability and the flow behavior of ceramic suspensions prepared were evaluated. The La{sub 0.80}Sr{sub 0.20}Cr{sub 0.92}Co{sub 0.08}O{sub 3} products obtained by casting aqueous slips in a plaster mould, using alkaline p H and anionic polyelectrolyte and tapes obtained by using ethanol as a dispersant medium, after sintering at 1600 deg C/4h presented theoretical density > 94%, suitable for use as HTSOFC inter connector. (author)

40 CFR 141.173 - Filtration.

Science.gov (United States)

2010-07-01

... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...

Promising Ni-Fe-LSGMC anode compatible with lanthanum gallate electrolyte

Energy Technology Data Exchange (ETDEWEB)

Wang Shizhong [Department of Chemistry, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, Fujian 361005 (China); School of Materials Science and Engineering, Georgia Institute of Technology, Atlanta, GA 30332-0245 (United States)], E-mail: shizwang@sohu.com; He, Qiong [Department of Chemistry, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen, Fujian 361005 (China); Liu Meilin [School of Materials Science and Engineering, Georgia Institute of Technology, Atlanta, GA 30332-0245 (United States)], E-mail: meilin.liu@mse.gatech.edu

2009-06-01

A number of composite materials in the Ni-Fe-LSGMC family have been studied as potential anodes for solid oxide fuel cells (SOFCs) based on strontium, magnesium, and cobalt doped lanthanum gallate electrolyte (LSGMC). The results show that Ni reacts with LSGMC especially under reducing conditions at high temperatures, resulting in high contact resistance, large electrode polarization, and poor performance. The reaction between Ni and LSGMC depends strongly on the composition and pre-sintering temperature of LSGMC, the concentration of iron in the electrode, and the processing and operating temperatures. Under proper conditions, Ni-Fe-LSGMC5 could be a promising high-performance anode with good compatibility with LSGMC5 electrolyte.

Promising Ni-Fe-LSGMC anode compatible with lanthanum gallate electrolyte

International Nuclear Information System (INIS)

Wang Shizhong; He, Qiong; Liu Meilin

2009-01-01

A number of composite materials in the Ni-Fe-LSGMC family have been studied as potential anodes for solid oxide fuel cells (SOFCs) based on strontium, magnesium, and cobalt doped lanthanum gallate electrolyte (LSGMC). The results show that Ni reacts with LSGMC especially under reducing conditions at high temperatures, resulting in high contact resistance, large electrode polarization, and poor performance. The reaction between Ni and LSGMC depends strongly on the composition and pre-sintering temperature of LSGMC, the concentration of iron in the electrode, and the processing and operating temperatures. Under proper conditions, Ni-Fe-LSGMC5 could be a promising high-performance anode with good compatibility with LSGMC5 electrolyte.

The systems lanthanum (cerium, samarium) nitrate-tetramethyl-ammonium nitrate-water

International Nuclear Information System (INIS)

Zhuravlev, E.F.; Khisaeva, D.A.; Semenova, Eh.B.

1984-01-01

The method of cross sections at 25 and 50 deg C has been applied to study solubility in the systems lanthanum nitrate-tetramethyl ammonium nitrate-water (1), cesium (3) nitrate-tetramethyl ammonium nitrate-water (2) and samarium nitrate-tetramethyl ammonium nitrate-water (3). Crystallization fields of congruently dissolving compounds with 1:3 ratio of salt components (in system 1) and 1:2 ratio (in systems 2 and 3) are found in the systems. New solid phases are separated preparatively and subjected to chemical, differential thermal and IR spectroscopic analyses. Compositions of formed compounds are compared with the compositions known for nitrates of other representatives of light lanthanides

Cytotoxicity and genotoxicity of a monazite component: lanthanum effects on the viability and induction of breaks in the DNA of human lymphocytes

International Nuclear Information System (INIS)

Paiva, Amanda Valle de Almeida

2007-01-01

The Monazite is a mineral extracted from open mines. It is constituted by lanthanum element aggregated with cerium, yttrium and thorium [(Ce, La, Y, Th)PO 4 ]. Lanthanum (La) is a rare-earth metal with applications in agriculture, industry and medicine. Since lanthanides and their compounds show a broad spectrum of applications there is an increased risk of incorporation in human. Inhalation of aerosols containing La is the main route of incorporation in workers exposed to several chemical forms of La. Herein, we examined the effect of lanthanum nitrate - La(NO 3 ) 3 in human lymphocytes. JURKAT cells and human peripheral lymphocytes (HPL) were used to evaluate the effect of La(NO 3 ) 3 on viability (apoptosis or necrosis) and DNA strand breaks induction or/and alkali-labile sites (ALS). We demonstrate that La has a cytotoxic and genotoxic effect on both cell lines. The results indicate that necrosis is the pathway by which La(NO 3 ) 3 induces cytotoxicity. The vitamin E is able to diminish DNA strand breaks induced by La(NO 3 ) 3 suggesting that reactive oxygen species (ROS) may be involved in the genotoxic process. (author)

40 CFR 141.560 - Is my system subject to individual filter turbidity requirements?

Science.gov (United States)

2010-07-01

... filter turbidity requirements? 141.560 Section 141.560 Protection of Environment ENVIRONMENTAL PROTECTION... Filtration and Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.560 Is my system subject to individual filter turbidity requirements? If your system is a subpart...

Gamma-induced radiation polymerization of kaolin composite for sorption of lanthanum, europium and uranium ions from low-grade monazite leachate

International Nuclear Information System (INIS)

Metwally, S.S.; Hassan, R.S.; El-Masry, E.H.; Borai, E.H.

2018-01-01

Gamma radiation polymerization method was used for the modification of kaolin to produce (poly acrylamide-acrylic acid)-Kaolin (PAM-AA-K). Monazite ore is one of the main resources of uranium and lanthanide elements, therefore, this work focused on sorption of uranium, lanthanum and europium ions from low grade monazite leachate. The removal percent for Eu 3+ , La 3+ and UO 2 2+ are 94.6, 91.6 and 73.4%, respectively. Monolayer capacity of Eu 3+ , La 3+ and UO 2 2+ were found to be 54.64, 45.87 and 37.59 mg/g, respectively. The sorption mechanism of lanthanum and europium ions on PAM-AA-K composite mainly takes place as Ln(OH) 2+ , and for uranium as uranyl ion, UO 2 2+ . (author)

40 CFR 141.170 - General requirements.

Science.gov (United States)

2010-07-01

... recontamination by surface water runoff and a point downstream before or at the first customer for filtered...) Compliance with the profiling and benchmark requirements under the provisions of § 141.172. (b) A public...

Analysis of the elements sputtered during the lanthanum implantation in stainless steels

International Nuclear Information System (INIS)

Ager, F.J.; Respaldiza, M.A.; Silva, M.F. da; Redondo, L.M.; Soares, J.C.

1998-01-01

The evidence of the modification of the surface structure of the AISI-304 stainless steel during the implantation of lanthanum makes the analysis of the sputtered elements very interesting. Those sputtered elements are deposited on a carbon sheet placed in front of the steel being implanted, and studied by means of RBS and PIXE, together with the implanted specimens. Besides, the protective effect of the implanted ions during the high temperature oxidation is also studied by those techniques together with XRD and thermogravimetric methods. (orig.)

Vaporization and diffusion studies on the stability of doped lanthanum gallates

Energy Technology Data Exchange (ETDEWEB)

Stanislowski, M.; Singheiser, L.; Hilpert, K. [Research Center Juelich, Institute for Materials and Processes in Energy Systems, IWV-2, 52425 Juelich (Germany); Peck, D.H.; Woo, S.K. [Korea Institute of Energy Research, 71-2 Jang-Dong, Yuseong, 305-343 Daejeon (Korea); Schulz, O.; Martin, M. [RWTH Aachen University, Institute of Physical Chemistry, Landoltweg 2, 52056 Aachen (Germany)

2006-07-15

Vaporization and diffusion determine the stability of doped lanthanum gallates under SOFC operating conditions. Systematic vaporization studies of Ga and other elements were carried out using the vapor transpiration method. It was shown that the Ga vaporization is controlled by diffusion from the bulk to the surface. Diffusion coefficients D{sub Ga} and vaporization coefficients {alpha}{sub Ga} were determined by fitting the measured vaporization data to a vaporization model. Secondary phases formed as a result of the vaporization were detected. The influence of different doping levels of Sr, Mg and Fe on the Ga vaporization was elucidated. Moreover, cation self-diffusion of {sup 139}La, {sup 84}Sr and {sup 25}Mg as well as cation impurity diffusion of {sup 144}Nd, {sup 89}Y and {sup 56}Fe in polycrystalline samples of doped lanthanum gallate were directly determined for the composition La{sub 0.9}Sr{sub 0.1}Ga{sub 0.9}Mg{sub 0.1}O{sub 2.9} as an example, from diffusion profiles determined by SIMS. It was found that diffusion occurs by means of bulk and grain boundaries. The bulk diffusion coefficients are similar for all cations with activation energies which are strongly dependent on temperature. The results are explained by a frozen-in defect structure at low temperatures in the ABO{sub 3} perovskite lattice and by proposing a defect cluster containing cation vacancies in the A and B sublattices, as well as oxygen vacancies. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

25 CFR 141.36 - Maximum finance charges on pawn transactions.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Maximum finance charges on pawn transactions. 141.36... PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS Pawnbroker Practices § 141.36 Maximum finance charges on pawn transactions. No pawnbroker may impose an annual finance charge greater than twenty-four percent...

Study of lanthanum aluminate for cost effective electrolyte material for SOFC

Science.gov (United States)

Verma, O. N.; Shahi, A. K.; Singh, P.

2018-05-01

The perovskite type electrolyte material LaAlO3 (abbreviated LAO) has been prepared by easy processing of auto-combustion synthesis using lanthanum nitrate and aluminium nitrate salts as precursors and citric acid as the fuel. The XRD analysis reveals that as synthesized material exhibits only single phase having rhombohedral structure. The measured density and theoretical density have been deliberated. The temperature dependent electrical conductivity of LAO increases with increasing the temperature which leads to increased mobility of oxide ion. The major contribution of such a significant value of ionic conductivity of LAO can be inferred to grain boundary resistance.

Relaxation features of the Young's modulus and internal friction of lanthanum

International Nuclear Information System (INIS)

Bodryakov, V.Yu.

1993-01-01

E Young module and Q -1 inner friction of polycrystalline lanthanum specimens are studied comprehensively within 4.2-420 K temperature range using bend autovibrations of a specimen represented by a thin rod within ∼ 1-2 kHz frequency range. Three maximums of relaxation nature innner friction are detected under ∼ 380-410, 250-270 and 90-120 K temperatures with 0.29, 0.21 and 0.02 eV activation energies, respectively, on Q -1 (T) curves. Maximums of inner friction are accompanied by peculiarities of E(T) Young module behaviour. 21 refs., 3 figs., 2 tabs

Study of binding properties of lanthanum to wheat roots by INAA

International Nuclear Information System (INIS)

Zhang, Z.Y.; Li, F.L.; Xiao, H.Q.; Chai, Z.F.; Xu, L.; Liu, N.

2004-01-01

Chemical behavior of lanthanum in root tips excized from wheat seedlings growing at both promotional and inhibitory levels of LaCl 3 in culture solutions was investigated by a sequential leaching procedure combined with instrumental neutron activation analysis. The results indicate that most of La exists in non-exchangeable species and the binding of La 3+ to the root tips is extremely stable. The root tips during growing at the inhibitory level of LaCl 3 absorb much more La than those at the promotional level. However, the La proportion in each fraction is similar for both groups. (author)

26 CFR 1.381(c)(14)-1 - Dividend carryover to personal holding company.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Dividend carryover to personal holding company. 1.381(c)(14)-1 Section 1.381(c)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(14)-1...

Electron paramagnetic resonance of V4+ in the lanthanum and cerium orthophosphates

International Nuclear Information System (INIS)

Lima, J.C. de.

1983-11-01

The Electron Paramagnetic Resonance (EPR) spectrum of V 4+ was investigated in polycrystalline samples of lanthanum orthophosphate (LaPO 4 ) and cerium orthophosphate (CePO 4 ) doped with 0.2 wt % vanadium pentoxide (V 2 O 5 ). Measurements were performed at room temperature and 9.5 GHz. In LaPO 4 , two non-equivalent axial sites were inferred from the EPR spectra. The most stable of these two sites is probably substitutional. In CePO 4 , a single axial spectrum was observed. It was attributed to V 4+ in substitutional sites. A central, wide line was also seen; it was attributed to ferromagnetic clusters of vanadium ions. Photoacoustic absorption spectra were also recorded for the two compounds. The EPR and photoacoustic absorption data, when analyzed using the molecular orbital theory, show that for both lanthanum orthophosphate and cerium orthophosphate the ground orbital (d sub(x) 2 sub(-y) 2) of the unpainred electron is purely ionic, while the excited orbitals d sub(xy) and d sub(xz,yz) are partly covalent. The degree of covalency is higher for the d sub(xy) orbital. Finally, it should be pointed out that part of the theory used for the interpretation of the EPR and photoacoustic absorption spectra (study of the ligand field splitting of a d orbital in a site of distorted capped antiprism structure) was developed by the author in the present work and is therefore an original contribution. (Author) [pt

25 CFR 141.57 - Procedures to cancel liability on bond.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Procedures to cancel liability on bond. 141.57 Section 141.57 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Procedures to cancel liability on bond. (a) Any surety who wishes to be relieved from liability arising on a...

Effects of Dredging and Lanthanum-Modified Clay on Water Quality Variables in an Enclosure Study in a Hypertrophic Pond

Directory of Open Access Journals (Sweden)

Miquel Lürling Guido Waajen

2017-05-01

Full Text Available An enclosure experiment was conducted between July and September 2009 to compare the effectiveness of a phosphate fixative, the lanthanum-modified bentonite clay Phoslock® (LMB, dredging, and their combination in controlling eutrophication in a hypertrophic urban pond in Heesch, The Netherlands. In total, 25 water quality variables were monitored. Multivariate analysis revealed that the combination LMB-treated and dredged enclosures deviated most from the pond (reference and the controls, and showed the strongest eutrophication reduction. Overall, dredging significantly increased transparency, lowered turbidity, and improved the oxygen conditions in the enclosures compared to non-dredged ones. Nonetheless, one dredged enclosure deviated dramatically from the others, which might reflect methodological issues with dredging. The LMB treatment appeared to be less effective at mitigating eutrophication than dredging, and phosphate concentrations even increased during the experiment in the LMB-treated enclosures. Chemical equilibrium modeling suggested that humic substances could have formed complexes with lanthanum (La from the LMB, rendering it unavailable for intercepting P over the course of the enclosure experiment. Residual lanthanum concentrations in combination dredging and LMB treatments exceeded the Dutch standard 10-fold. Total zooplankton abundance, and particularly Cladocera, increased in all enclosures over the course of the experiment. The limited effect of LMB in the enclosure experiment and the violation of the Dutch La standard when combined with dredging disqualify LMB as an intervention agent in the restoration of the pond.

40 CFR 141.86 - Monitoring requirements for lead and copper in tap water.

Science.gov (United States)

2010-07-01

... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.86 Monitoring requirements for lead and copper in tap water. (a) Sample site location. (1) By the... the water system can collect the number of lead and copper tap samples required in paragraph (c) of...

Phosphate binding therapy in dialysis patients: focus on lanthanum carbonate

Directory of Open Access Journals (Sweden)

Ismail A Mohammed

2008-11-01

Full Text Available Ismail A Mohammed, Alastair J HutchisonManchester Institute of Nephrology and Transplantation, Manchester Royal Infirmary, Oxford Road, Manchester, UKAbstract: Hyperphosphatemia is an inevitable consequence of end stage chronic kidney disease and is present in the majority of dialysis patients. Recent observational data has associated hyperphosphatemia with increased cardiovascular mortality among dialysis patients. Dietary restriction of phosphate and current dialysis prescription practices are not enough to maintain serum phosphate levels within the recommended range so that the majority of dialysis patients require oral phosphate binders. Unfortunately, conventional phosphate binders are not reliably effective and are associated with a range of limitations and side effects. Aluminium-containing agents are highly efficient but no longer widely used because of well established and proven toxicity. Calcium based salts are inexpensive, effective and most widely used but there is now concern about their association with hypercalcemia and vascular calcification. Sevelamer hydrochloride is associated with fewer adverse effects, but a large pill burden and high cost are limiting factors to its wider use. In addition, the efficacy of sevelamer as a monotherapy in lowering phosphate to target levels in severe hyperphosphatemia remains debatable. Lanthanum carbonate is a promising new non-aluminium, calcium-free phosphate binder. Preclinical and clinical studies have demonstrated a good safety profile, and it appears well tolerated and effective in reducing phosphate levels in dialysis patients. Its identified adverse events are apparently mild to moderate in severity and mostly GI related. It appears to be effective as a monotherapy, with a reduced pill burden, but like sevelamer, it is significantly more expensive than calcium-based binders. Data on its safety profile over 6 years of treatment are now available.Keywords: hyperphosphatemia, lanthanum

STRUCTURE AND THERMAL STABILITY OF THE BENZO-15-CROWN-5 WITH LANTHANUM (III BROMIDE COMPLEX

Directory of Open Access Journals (Sweden)

Muhammad Idiris Saleh

2010-06-01

Full Text Available The reaction of benzo-15-crown-5 (C14H20O5 ligand with La(NO33.7H2O in the presence of HBr has resulted in the production of an exotic sandwich complex, [LaC28H36Br4O10][3Br]. The crystal system is triclinic with space group P1, a = 12.5834(14 Å, b = 13.5816(16 Å, c = 13.8403(16 Å, a = 70.751(2°, b = 66.773(2° and g = 67.631(2°. The cation comprises of the lanthanum atom coordinated to two crowns via three oxygen atoms from each crown in a η3-sandwich fashion. The two phenyl groups of the crown are brominated. The La-OLigand bond lengths are between 2.857(7 and 2.949(7 Å. The trianion [3Br]3- is linear with Br-Br bond lengths of 2.518(2 and 2.560(2 Å respectively. The molecule is stabilized by intermolecular interactions of the type C-H...Br to form dimers and are arranged parallel to bc face.  Keywords: lanthanum, benzo-15-crown-5, hydrogen bonding, bromination, x-ray structure

On isomorphous substitution of calcium by sodium and lanthanum in synthetic hydroxyapatite

International Nuclear Information System (INIS)

Get'man, E.I.; Kanyuka, Yu.V.; Loboda, S.N.

1998-01-01

Isomorphous substitution of calcium by sodium and lanthanum in synthetic hydroxyapatite Ca 5-2x La x (PO 4 ) 3 OH by x=0-2.5 within the temperature range 1100-800 deg C is studied through the roentgenophase analysis and IR-spectroscopy methods. It is established that singlephase solid solutions are formed in the area of x≥0.4 by a≤0.4 there exist phases with LaPO 4 , LaNa 6 (PO 4 ) 3 structures and unknown phase along with solid solution of the apatite structure

Characterization of phosphate sequestration by a lanthanum modified bentonite clay: A solid-state NMR, EXAFS and PXRD study

DEFF Research Database (Denmark)

Dithmer, Line; Lipton, Andrew S; Reitzel, Kasper

2015-01-01

Phosphate (Pi) sequestration by a lanthanum (La) exchanged clay mineral (La-Bentonite), which is extensively used in chemical lake restoration, was investigated on the molecular level using a combination of 31P and 139La solid state NMR spectroscopy (SSNMR), extended X-ray absorption spectroscopy...

Molecular cloning and expression analysis of a zebrafish novel zinc finger protein gene rnf141

Directory of Open Access Journals (Sweden)

Wenqian Deng

2009-01-01

Full Text Available ZNF230 is a novel zinc finger gene cloned by our laboratory. In order to understand the potential functions of this gene in vertebrate development, we cloned the zebrafish orthologue of human ZNF230, named rnf141. The cDNA fragment of rnf141 was obtained by rapid amplification of cDNA ends (RACE. The open reading frame (ORF encodes a polypeptide of 222 amino acids which shares 75.65% identity with the human ZNF230. RT-PCR analysis in zebrafish embryo and adult tissues revealed that rnf141 transcripts are maternally derived and that rnf141 mRNA has a broad distribution. Zygotic rnf141 message is strongly localized in the central nervous system, as shown by whole-mount in situ hybridization. Knockdown and over expression of rnf141 can induce abnormal phenotypes, including abnormal development of brain, as well as yolk sac and axis extendsion. Marker gene analysis showed that rnf141 may play a role in normal dorsoventral patterning of zebrafish embryos, suggesting that rnf141 may have a broad function during early development of vertebrates.

26 CFR 1.141-3 - Definition of private business use.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Definition of private business use. 1.141-3...-3 Definition of private business use. (a) General rule—(1) In general. The private business use test relates to the use of the proceeds of an issue. The 10 percent private business use test of section 141(b...

Equidensitometry: a method for characterising the structure of plasmas. Qualitative characterisation of the lanthanum d.c. arc by equidensitometry of monochromatic arc photographs

International Nuclear Information System (INIS)

Dittrich, K.; Niebergall, K.; Roessler, H.

1976-01-01

A new method has been developed for the experimental characterization of d.c. arc plasmas. The method consists of the combination of the spectral photography of d.c. arc plasmas with a slitless, stigmatic plane-grating spectrograph and the characterization of the photographs with the aid of photographic equidensitometry. The principles of the method are described. The method is used for the investigation of a lanthanum d.c. arc plasma. The qualitative results of the measurements of the axial distributions of the light emission and lanthanum and calcium particle concentrations in the arc are discussed. The limitations and shortcomings of the method are pointed out. (author)

Potentiometric measurement of polymer-membrane electrodes based on lanthanum

Energy Technology Data Exchange (ETDEWEB)

Saefurohman, Asep, E-mail: saefurohman.asep78@Gmail.com; Buchari,, E-mail: saefurohman.asep78@Gmail.com; Noviandri, Indra, E-mail: saefurohman.asep78@Gmail.com [Department of Chemistry, Bandung Institute of Technology (Indonesia); Syoni [Department of Metallurgy Engineering, Bandung Institute of Technology (Indonesia)

2014-03-24

Quantitative analysis of rare earth elements which are considered as the standard method that has a high accuracy, and detection limits achieved by the order of ppm is inductively coupled plasma atomic emission spectroscopy (ICPAES). But these tools are expensive and valuable analysis of the high cost of implementation. In this study be made and characterized selective electrode for the determination of rare earth ions is potentiometric. Membrane manufacturing techniques studied is based on immersion (liquid impregnated membrane) in PTFE 0.5 pore size. As ionophores to be used tri butyl phosphate (TBP) and bis(2-etylhexyl) hydrogen phosphate. There is no report previously that TBP used as ionophore in polymeric membrane based lanthanum. Some parameters that affect the performance of membrane electrode such as membrane composition, membrane thickness, and types of membrane materials studied in this research. Manufacturing of Ion Selective Electrodes (ISE) Lanthanum (La) by means of impregnation La membrane in TBP in kerosene solution has been done and showed performance for ISE-La. FTIR spectrum results for PTFE 0.5 pore size which impregnated in TBP and PTFE blank showed difference of spectra in the top 1257 cm{sup −1}, 1031 cm{sup −1} and 794.7 cm{sup −1} for P=O stretching and stretching POC from group −OP =O. The result showed shift wave number for P =O stretching of the cluster (−OP=O) in PTFE-TBP mixture that is at the peak of 1230 cm{sup −1} indicated that no interaction bond between hydroxyl group of molecules with molecular clusters fosforil of TBP or R{sub 3}P = O. The membrane had stable responses in pH range between 1 and 9. Good responses were obtained using 10{sup −3} M La(III) internal solution, which produced relatively high potential. ISE-La showed relatively good performances. The electrode had a response time of 29±4.5 second and could be use for 50 days. The linear range was between 10{sup −5} and 10{sup −1} M.

40 CFR 141.51 - Maximum contaminant level goals for inorganic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for inorganic contaminants. 141.51 Section 141.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.50 - Maximum contaminant level goals for organic contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for organic contaminants. 141.50 Section 141.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

40 CFR 141.52 - Maximum contaminant level goals for microbiological contaminants.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for microbiological contaminants. 141.52 Section 141.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Maximum Contaminant Level...

Temperature dependence of magnetoresistance in lanthanum manganite ceramics

International Nuclear Information System (INIS)

Gubkin, M.K.; Zalesskii, A.V.; Perekalina, T.M.

1996-01-01

Magnetoresistivity in the La0.9Na0.1Mn0.9(V,Co)0.1O3 and LaMnO3+δ ceramics was studied. The temperature dependence of magnetoresistance in these specimens was found to differ qualitatively from that in the La0.9Na0.1MnO3 single crystal (the magnetoresistance value remains rather high throughout the measurement range below the Curie temperature), with the maximum values being about the same (20-40% in the field of 20 kOe). Previously published data on magnetization, high frequency magnetic susceptibility, and local fields at the 139La nuclei of the specimens with similar properties attest to their magnetic inhomogeneity. The computation of the conductivity of the nonuniformly ordered lanthanum manganite was performed according to the mean field theory. The calculation results allow one to interpret qualitatively various types of experimental temperature dependences of magnetoresistance

Photocatalytic degradation of the Paracetamol drug using Lanthanum doped ZnO nanoparticles and their in-vitro cytotoxicity assay

International Nuclear Information System (INIS)

Shakir, Mohammad; Faraz, Mohd; Sherwani, Mohd Asif; Al-Resayes, Saud I.

2016-01-01

The doping of semiconductor by rare earth metals nanoparticles is an effective way for increasing photocatalytic activity. Zinc oxide and Lanthanum doped Zinc oxide nanoparticles were synthesized by modifying the gel-combustion method. It was found that La can greatly enhance the cytotoxicity and photocatalytic activity of ZnO nanoparticles towards various cell lines and Paracetamol drug. These nanoparticles were characterized by various spectroscopic and other techniques which clearly revealed the presence of lanthanum ions. The absorption edge shifts towards the visible region after doping with La ions. This shift shows that the doping of La ions is favorable for absorbing the visible light. The comparative photocatalytic and cytotoxicity activity revealed that La doped ZnO nanoparticles remarkably enhanced activities as compared to the ZnO nanoparticles. The outcome of these studies offers valuable for planning La doped ZnO nanoparticles having cytotoxicity and photocatalytic activities helpful for the formulation of anticancer product and waste water remediation.

Photocatalytic degradation of the Paracetamol drug using Lanthanum doped ZnO nanoparticles and their in-vitro cytotoxicity assay

Energy Technology Data Exchange (ETDEWEB)

Shakir, Mohammad, E-mail: shakir078@yahoo.com [Department of Chemistry, Aligarh Muslim University, Aligarh 202002 (India); Faraz, Mohd [Department of Chemistry, Aligarh Muslim University, Aligarh 202002 (India); Sherwani, Mohd Asif [Interdisciplinary Biotechnology Unit, Aligarh Muslim University, Aligarh 202002 (India); Al-Resayes, Saud I. [Department of Chemistry, College of Science, King Saud University, Riyadh 11451 (Saudi Arabia)

2016-08-15

The doping of semiconductor by rare earth metals nanoparticles is an effective way for increasing photocatalytic activity. Zinc oxide and Lanthanum doped Zinc oxide nanoparticles were synthesized by modifying the gel-combustion method. It was found that La can greatly enhance the cytotoxicity and photocatalytic activity of ZnO nanoparticles towards various cell lines and Paracetamol drug. These nanoparticles were characterized by various spectroscopic and other techniques which clearly revealed the presence of lanthanum ions. The absorption edge shifts towards the visible region after doping with La ions. This shift shows that the doping of La ions is favorable for absorbing the visible light. The comparative photocatalytic and cytotoxicity activity revealed that La doped ZnO nanoparticles remarkably enhanced activities as compared to the ZnO nanoparticles. The outcome of these studies offers valuable for planning La doped ZnO nanoparticles having cytotoxicity and photocatalytic activities helpful for the formulation of anticancer product and waste water remediation.

The influence of lake water alkalinity and humic substances on particle dispersion and lanthanum desorption from a lanthanum modified bentonite

DEFF Research Database (Denmark)

Reitzel, Kasper; Balslev, Kristiane Astrid; Jensen, Henning S

2017-01-01

A 12 days laboratory study on potential desorption of Lanthanum (La) from a commercial La modified clay (Phoslock) was conducted using lake water from 17 Danish lakes with alkalinities between 0.02 and 3.7 meq L-1and varying concentrations of DOC and humic acids (HA's). A similar study...... was conducted in artificial lake water with alkalinities from 0 to 2.5 meq L-1in order to exclude interference from dissolved HA's. To test if La in solution (FLa) was associated with fine particles, the water samples were filtered sequentially through three filter sizes (1.2 μm, 0.45 μm and 0.2 μm...... at low alkalinities. In addition, this study showed that HA's seem to increase the FLa concentrations in soft water lakes, most likely through complexation of La retained in the Phoslock matrix. In summary, we conclude that elevated La concentrations in lake water after a Phoslock treatment should only...

40 CFR 141.809 - Supplemental treatment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Supplemental treatment. 141.809... treatment. (a) Any supplemental drinking water treatment units installed onboard existing or new aircraft... the manufacturer's plans and specifications and FAA requirements. (b) Water supplemental treatment and...

40 CFR 141.803 - Coliform sampling.

Science.gov (United States)

2010-07-01

...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.803 Coliform sampling. (a... aircraft water system, the sampling frequency must be determined by the disinfection and flushing frequency... disinfection and flushing frequency recommended by the aircraft water system manufacturer, when available...

14 CFR Appendix B to Part 141 - Private Pilot Certification Course

Science.gov (United States)

2010-01-01

... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. B Appendix B to Part 141...) Accident reporting requirements of the National Transportation Safety Board; (3) Applicable subjects of the... checks and end-of-course tests in accordance with the school's approved training course, consisting of...

Polymorphisms at Amino Acid Residues 141 and 154 Influence Conformational Variation in Ovine PrP

Science.gov (United States)

Yang, Sujeong; Thackray, Alana M.; Hopkins, Lee; Monie, Tom P.; Burke, David F.; Bujdoso, Raymond

2014-01-01

Polymorphisms in ovine PrP at amino acid residues 141 and 154 are associated with susceptibility to ovine prion disease: Leu141Arg154 with classical scrapie and Phe141Arg154 and Leu141His154 with atypical scrapie. Classical scrapie is naturally transmissible between sheep, whereas this may not be the case with atypical scrapie. Critical amino acid residues will determine the range or stability of structural changes within the ovine prion protein or its functional interaction with potential cofactors, during conversion of PrPC to PrPSc in these different forms of scrapie disease. Here we computationally identified that regions of ovine PrP, including those near amino acid residues 141 and 154, displayed more conservation than expected based on local structural environment. Molecular dynamics simulations showed these conserved regions of ovine PrP displayed genotypic differences in conformational repertoire and amino acid side-chain interactions. Significantly, Leu141Arg154 PrP adopted an extended beta sheet arrangement in the N-terminal palindromic region more frequently than the Phe141Arg154 and Leu141His154 variants. We supported these computational observations experimentally using circular dichroism spectroscopy and immunobiochemical studies on ovine recombinant PrP. Collectively, our observations show amino acid residues 141 and 154 influence secondary structure and conformational change in ovine PrP that may correlate with different forms of scrapie. PMID:25126555

Solid-phase extraction (SPE) of Iron using Lanthanum Silicate ion exchange

International Nuclear Information System (INIS)

Kiarostami, V.; Husain, W.

2002-01-01

Solid-phase extraction (SPE) is gaining wide use as an effective and speedy technique which reduces solvent usage, disposal costs and extraction time. The analyte is adsorbed from solution onto a solid adsorbent, which is followed by elution of the analyte with a solvent appropriate for instrumental analysis. However, there is an increasing need for new selective adsorbents to expand the area of this technique. Lanthanum silicate ion exchanger, which shows unusual selectivity elements and in this study, it was employed to develop a SPE method for iron ion. Special experiments such as determination of distribution coefficient for iron ion in different solvent systems have been determined

Cerium-modified Aurivillius-type sodium lanthanum bismuth titanate with enhanced piezoactivities

International Nuclear Information System (INIS)

Wang Chunming; Zhao Liang; Wang Jinfeng; Zheng Limei; Du Juan; Zhao Minglei; Wang Chunlei

2009-01-01

The electrical, piezoelectric and dielectric properties of cerium-modified Aurivillius-type sodium lanthanum bismuth titanate (Na 0.5 La 0.5 Bi 4 Ti 4 O 15 , NLBT) ceramics were investigated. It was found the piezoelectric activities of NLBT ceramics were significantly improved by cerium modification. The piezoelectric coefficient d 33 and Curie temperature T c for the 0.50 wt.% cerium-modified NLBT were found to be 29 pC/N and 573 deg. C, respectively. The reasons for piezoelectric activities improvement by cerium modification were given. A small dielectric abnormity was observed in NLBT ceramics, which can be suppressed by cerium modification.

Enhanced electrocaloric analysis and energy-storage performance of lanthanum modified lead titanate ceramics for potential solid-state refrigeration applications.

Science.gov (United States)

Zhang, Tian-Fu; Huang, Xian-Xiong; Tang, Xin-Gui; Jiang, Yan-Ping; Liu, Qiu-Xiang; Lu, Biao; Lu, Sheng-Guo

2018-01-10

The unique properties and great variety of relaxer ferroelectrics make them highly attractive in energy-storage and solid-state refrigeration technologies. In this work, lanthanum modified lead titanate ceramics are prepared and studied. The giant electrocaloric effect in lanthanum modified lead titanate ceramics is revealed for the first time. Large refrigeration efficiency (27.4) and high adiabatic temperature change (1.67 K) are achieved by indirect analysis. Direct measurements of electrocaloric effect show that reversible adiabatic temperature change is also about 1.67 K, which exceeds many electrocaloric effect values in current direct measured electrocaloric studies. Both theoretical calculated and direct measured electrocaloric effects are in good agreements in high temperatures. Temperature and electric field related energy storage properties are also analyzed, maximum energy-storage density and energy-storage efficiency are about 0.31 J/cm 3 and 91.2%, respectively.

Effect of lead dioxide on the radiation decomposition of hydrated lanthanum nitrate (Preprint No. RES-05)

International Nuclear Information System (INIS)

Patil, S.F.; Bedekar, A.G.; Chiplunkar, N.R.

1988-02-01

The rate of radiation induced decomposition of lanthanum nitrate is found to increase in the presence of lead dioxide as a heterophase impurity. Further, the rate also increases with increasing mole percent of the oxide. The results are explained on the basis of energy transfer processes taking place at the interface between nitrate and oxide crystals. (aut hor). 9 refs

14 CFR Appendix A to Part 141 - Recreational Pilot Certification Course

Science.gov (United States)

2010-01-01

... rating for which the course applies. (b) Each student must demonstrate satisfactory proficiency prior to... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. A Appendix A to Part 141.... A person must hold a student pilot certificate prior to enrolling in the flight portion of the...

Electronic Conductivity of Doped-Lanthanum Gallate Electrolytes

Science.gov (United States)

Yamaji, Katsuhiko; Xiong, Yue Ping; Kishimoto, Haruo; Horita, Teruhisa; Sakai, Natsuko; Brito, Manuel E.; Yokokawa, Harumi

Electronic conductivity of doped lanthanum gallate electrolytes were determined by using a Hebb-Wagner type polarization cell. Electronic conductivity of cobalt-doped, La0.8Sr0.2Ga0.8Mg0.15Co0.5O3-δ (LSGMC), and non cobalt-doped, La0.8Sr0.2Ga0.8Mg0.2O2.8 (LSGM8282), were measured as a function of oxygen partial pressures. The electronic conductivity of LSGM8282 showed a linear dependence on p(O2)1/4 in the higher p(O2) region, which is attributed to the electronic hole conductivity. The electronic conductivity of LSGMC showed a linear dependence on p(O2)1/6 in the higher p(O2) region. LSGMC has higher electronic conductivity than LSGM, and the conductivity was not clearly changed with temperatures between 600 and 800 °C. In lower p(O2) region, the electronic conductivity data have poor reproducibility and did not show any dependence on p(O2) because of the degradation of the electrolytes in severe reducing atmospheres.

Mechanical properties of lanthanum and yttrium chromites

Energy Technology Data Exchange (ETDEWEB)

Paulik, S.W.; Armstrong, T.R. [Pacific Northwest National Lab., Richland, WA (United States)

1996-12-31

In an operating high-temperature (1000{degrees}C) solid oxide fuel cell (SOFC), the interconnect separates the fuel (P(O{sub 2}){approx}10{sup -16} atm) and the oxidant (P(O2){approx}10{sup 0.2} atm), while being electrically conductive and connecting the cells in series. Such severe atmospheric and thermal demands greatly reduce the number of viable candidate materials. Only two materials, acceptor substituted lanthanum chromite and yttrium chromite, meet these severe requirements. In acceptor substituted chromites (Sr{sup 2+} or Ca{sup 2+} for La{sup 3+}), charge compensation is primarily electronic in oxidizing conditions (through the formation of Cr{sup 4+}). Under reducing conditions, ionic charge compensation becomes significant as the lattice becomes oxygen deficient. The formation of oxygen vacancies is accompanied by the reduction of Cr{sup 4+} ions to Cr{sup 3+} and a resultant lattice expansion. The lattice expansion observed in large chemical potential gradients is not desirable and has been found to result in greatly reduced mechanical strength.

25 CFR 141.30 - Retaliation prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.30 Retaliation prohibited. No licensee may refuse service to any customer for the purpose of retaliating against that customer for...

Thermal stability and microstructure of catalytic alumina composite support with lanthanum species

Energy Technology Data Exchange (ETDEWEB)

Ozawa, Masakuni, E-mail: ozawa@numse.nagoya-u.ac.jp; Nishio, Yoshitoyo

2016-09-01

Highlights: • Thermal stability of La-modified γ-Al{sub 2}O{sub 3} with nanometer-scaled structure. • LaAlO{sub 3} particles are dispersed in the aggregated particles of alumina. • Increase of the surface basicity of La modified alumina using CO{sub 2}-TPD. - Abstract: Lanthanum (La) modified γ-alumina composite was examined for application toward thermostable catalytic support at elevated temperature. La added alumina was prepared through an aqueous process using lanthanum (III) nitrate and then characterized by surface area measurement, X-ray powder diffraction (XRD), differential thermal analysis (DTA), scanning electron microscope (SEM), transmission electron microscope (TEM), X-ray photoemission spectroscopy (XPS) and surface desorption of CO{sub 2}. It was found that the properties depended on the La content and heat treatment temperatures. The characterization of the surface, structural and chemical properties of La-Al{sub 2}O{sub 3} showed the existence of a strong interaction between the La species and alumina via formation of new phase and modified surface in Al{sub 2}O{sub 3} samples. LaAlO{sub 3} nanoparticle formed among alumina particles by the solid phase reaction of Al{sub 2}O{sub 3} and La{sub 2}O{sub 3}. The increase of the surface basicity of La modified alumina was demonstrated using CO{sub 2} temperature programmed desorption experiments. The controlled surface interaction between La oxide and alumina provide the unique surface and structural properties of the resulting mixed oxides as catalysts and catalytic supports.

25 CFR 141.22 - Subleasing prohibited.

Science.gov (United States)

2010-04-01

... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.22 Subleasing prohibited. No licensee may lease, sublet, rent, or sell any building that the licensee occupies for any purpose to any person...

Influence of tellurite on lifetime for samarium doped lanthanum lead borate glass

Science.gov (United States)

Madhu, A.; Eraiah, B.

2018-04-01

Samarium substituted tellurium lanthanum lead borate glass is prepared using melt quenching technique. Luminescence spectra have been recorded upon excitation with 402 nm various transitions from 4G5/2 level, for samarium doped tellurite glasses are studied and also lifetime for all the samples exhibit single exponential behaviour of decay curve. Luminescence spectra of present glasses show quenching effect due to cross-relation channels of samarium ions. The lifetime of glass samples decrease as the tellurite concentration is decreased. So, it evidences that to attain longer lifetime for lasing material one can tune the host by selecting concentration of tellurite.

Performance of planar single cell lanthanum gallate based solid oxide fuel cells

Energy Technology Data Exchange (ETDEWEB)

Maffei, N.; Kuriakose, A.K. [Materials Technology Labs., CANMET, Natural Resources Canada, Ottawa, ON (Canada)

1998-09-01

A novel synthesis of high purity, single phase strontium-magnesium doped lanthanum gallate through a nitrate route is described. The prepared powder is formed into planar monolithic elements by uniaxial pressing followed by isostatic pressing and sintering. XRD analysis of the sintered elements reveal no detectable secondary phases. The performance of the electrolyte in solid oxide fuel cells (SOFC) with three different anode/cathode combinations tested at 700 C with respect to the J-V and power density is reported. The data show that the characteristics of this SOFC are strongly dependent on the particular anode/cathode system chosen. (orig.)

Performance of planar single cell lanthanum gallate based solid oxide fuel cells

Science.gov (United States)

Maffei, N.; Kuriakose, A. K.

A novel synthesis of high purity, single phase strontium-magnesium doped lanthanum gallate through a nitrate route is described. The prepared powder is formed into planar monolithic elements by uniaxial pressing followed by isostatic pressing and sintering. XRD analysis of the sintered elements reveal no detectable secondary phases. The performance of the electrolyte in solid oxide fuel cells (SOFC) with three different anode/cathode combinations tested at 700°C with respect to the J- V and power density is reported. The data show that the characteristics of this SOFC are strongly dependent on the particular anode/cathode system chosen.

Specific heat studies of lanthanum and yttrium sesquicarbides

International Nuclear Information System (INIS)

Cort, B.; Stewart, G.R.; Giorgi, A.L.

1984-01-01

The specific heats of the sesquicarbides LaC/sub 1.35/ and La/sub 0.9/Th/sub 0.1/C/sub 1.6/ (prepared by arc melting) and YC/sub 1.35/ (prepared by a high-pressure technique) have been measured for the first time. No bulk specific heat anomaly appears in either lanthanum compounds, even though (1) inductively measured superconducting transition temperatures are respectively high (11.0 K for LaC/sub 1.35/ and 12.7 K for La/sub 0.9/Th/sub 0.1/C/sub 1.6/) and (2) YC/sub 1.35/ is a bulk superconductor with a T/sub c/ = 10.5 K and Y/sub 0.7/Th/sub 0.3/C/sub 1.58/ (also prepared by high pressure) was previously reported to be a bulk superconductor with a T/sub c/ = 17.1 K. The apparent correlation with preparation technique is discussed

Closure report for underground storage tank 141-R3U1 and its associated underground piping

Energy Technology Data Exchange (ETDEWEB)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks.

Closure report for underground storage tank 141-R3U1 and its associated underground piping

International Nuclear Information System (INIS)

Mallon, B.J.; Blake, R.G.

1994-03-01

Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks

33 CFR 141.30 - Evidence of status as a resident alien.

Science.gov (United States)

2010-07-01

... alien. 141.30 Section 141.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Evidence of status as a resident alien. For the purposes of this part, the employer may accept as sufficient evidence that a person is a resident alien any one of the following documents and no others: (a) A...

Lanthanum chloride impairs spatial memory through ERK/MSK1 signaling pathway of hippocampus in rats.

Science.gov (United States)

Liu, Huiying; Yang, Jinghua; Liu, Qiufang; Jin, Cuihong; Wu, Shengwen; Lu, Xiaobo; Zheng, Linlin; Xi, Qi; Cai, Yuan

2014-12-01

Rare earth elements (REEs) are used in many fields for their diverse physical and chemical properties. Surveys have shown that REEs can impair learning and memory in children and cause neurobehavioral defects in animals. However, the mechanism underlying these impairments has not yet been completely elucidated. Lanthanum (La) is often selected to study the effects of REEs. The aim of this study was to investigate the spatial memory impairments induced by lanthanum chloride (LaCl3) and the probable underlying mechanism. Wistar rats were exposed to LaCl3 in drinking water at 0 % (control, 0 mM), 0.25 % (18 mM), 0.50 % (36 mM), and 1.00 % (72 mM) from birth to 2 months after weaning. LaCl3 considerably impaired the spatial learning and memory of rats in the Morris water maze test, damaged the synaptic ultrastructure and downregulated the expression of p-MEK1/2, p-ERK1/2, p-MSK1, p-CREB, c-FOS and BDNF in the hippocampus. These results indicate that LaCl3 exposure impairs the spatial learning and memory of rats, which may be attributed to disruption of the synaptic ultrastructure and inhibition of the ERK/MSK1 signaling pathway in the hippocampus.

Cationic copolymerization of cycloaliphatic epoxy resin with an spirobislactone with lanthanum triflate as initiator

International Nuclear Information System (INIS)

Fernandez, Xavier; Ramis, Xavier; Salla, Josep M.

2005-01-01

3,4-Epoxycyclohexylmethyl 3,4-epoxycyclohexane carboxylate (ECH) was cured with different proportions of 1,6-dioxaspiro[4,4]nonane-2,7-dione (s(γ-BL)) using lanthanum triflate as a catalyst. DSC was used to obtain kinetic data associated to the curing process by means of series of non-isothermal experiments. Fourier transform infrared spectroscopy in attenuated total reflection mode (FT-IR/ATR) was used to study the evolution of the epoxide group in order to compare experimental isothermal data with simulated isothermal data. The complexity of the process itself enabled us to compare different procedures for obtaining isoconversional data and to determine the kinetic model that best describes the curing process. An increase in the proportion of s(γ-BL) increases the speed of the curing process. By means of applying isoconversional methods to dynamic experimental data, we observed that an increase in the proportion of s(γ-BL) leads to an overall decrease in the activation energy for the different formulations. Kinetic parameters that were determined using both differential and integral isoconversional procedures were compared. This allowed us to analyze and to discuss the usefulness of different methods in order to obtain a suitable kinetic triplet at each step of the curing of the ECH/s(γ-BL) system using lanthanum triflate as a catalyst

Contrasting roles of the ABCG2 Q141K variant in prostate cancer

Energy Technology Data Exchange (ETDEWEB)

Sobek, Kathryn M. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Cummings, Jessica L. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Critical Care Medicine, University of Pittsburgh, Pittsburgh, PA (United States); Bacich, Dean J. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States); O’Keefe, Denise S., E-mail: OKeefeD@uthscsa.edu [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States)

2017-05-01

ABCG2 is a membrane transport protein that effluxes growth-promoting molecules, such as folates and dihydrotestosterone, as well as chemotherapeutic agents. Therefore it is important to determine how variants of ABCG2 affect the transporter function in order to determine whether modified treatment regimens may be necessary for patients harboring ABCG2 variants. Previous studies have demonstrated an association between the ABCG2 Q141K variant and overall survival after a prostate cancer diagnosis. We report here that in patients with recurrent prostate cancer, those who carry the ABCG2 Q141K variant had a significantly shorter time to PSA recurrence post-prostatectomy than patients homozygous for wild-type ABCG2 (P=0.01). Transport studies showed that wild-type ABCG2 was able to efflux more folic acid than the Q141K variant (P<0.002), suggesting that retained tumoral folate contributes to the decreased time to PSA recurrence in the Q141K variant patients. In a seemingly conflicting study, it was previously reported that docetaxel-treated Q141K variant prostate cancer patients have a longer survival time. We found this may be due to less efficient docetaxel efflux in cells with the Q141K variant versus wild-type ABCG2. In human prostate cancer tissues, confocal microscopy revealed that all genotypes had a mixture of cytoplasmic and plasma membrane staining, with noticeably less staining in the two homozygous KK patients. In conclusion, the Q141K variant plays contrasting roles in prostate cancer: 1) by decreasing folate efflux, increased intracellular folate levels result in enhanced tumor cell proliferation and therefore time to recurrence decreases; and 2) in patients treated with docetaxel, by decreasing its efflux, intratumoral docetaxel levels and tumor cell drug sensitivity increase and therefore patient survival time increases. Taken together, these data suggest that a patient's ABCG2 genotype may be important when determining a personalized treatment

40 CFR 141.80 - General requirements.

Science.gov (United States)

2010-07-01

... service line replacement, and public education. These requirements are triggered, in some cases, by lead... requirements. (1) All water systems shall install and operate optimal corrosion control treatment as defined in... specified by the State under § 141.83. (f) Lead service line replacement requirements. Any system exceeding...

40 CFR 141.601 - Standard monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Standard monitoring. 141.601 Section... Standard monitoring. (a) Standard monitoring plan. Your standard monitoring plan must comply with paragraphs (a)(1) through (a)(4) of this section. You must prepare and submit your standard monitoring plan...

Non-natives: 141 scientists object

OpenAIRE

Simberloff, Daniel; Vilà, Montserrat

2011-01-01

Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative Biology, Zurich, Switzerland. Fred Allendorf University of Montana, Missoula, Montana, USA. James Aronson CEFE/CNRS, Montpellier, France. Pedro M. Antunes Algoma University, Sault Ste. Marie, Onta...

40 CFR 141.808 - Audits and inspections.

Science.gov (United States)

2010-07-01

... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.808 Audits and..., disinfection and flushing, and general maintenance and self-inspections of aircraft water system. (b) Air... delivery of safe drinking water. ...

Fabrication of Sr- and Co-doped lanthanum chromite interconnectors for SOFC

Energy Technology Data Exchange (ETDEWEB)

Setz, L.F.G. [Departamento de Engenharia de Materiais, Universidade Federal de Sao Carlos - DEMa/UFSCar (Brazil); Instituto de Pesquisas Energeticas e Nucleares - IPEN/CNEN (Brazil); Santacruz, I. [Departamento de Quimica Inorganica, Cristalografia y Mineralogia, Universidad de Malaga, 29071 Malaga (Spain); Colomer, M.T., E-mail: tcolomer@icv.csic.es [Instituto de Ceramica y Vidrio, ICV (CSIC), 28049 Madrid (Spain); Mello-Castanho, S.R.H. [Instituto de Pesquisas Energeticas e Nucleares - IPEN/CNEN (Brazil); Moreno, R. [Instituto de Ceramica y Vidrio, ICV (CSIC), 28049 Madrid (Spain)

2011-07-15

Graphical abstract: FESEM micrographs of the fresh fracture surfaces for the La{sub 0.80}Sr{sub 0.20}Cr{sub 0.92}Co{sub 0.08}O{sub 3} sintered specimens cast from optimised suspensions with 13.5, 15 and 17.5 vol.% solids loading. Aqueous suspensions were prepared using ammonium polyacrylate (PAA) as dispersant and tetramethylammonium hydroxide (TMAH) to assure a basic pH and providing stabilization. Sintering of the green discs was performed in air at 1600 {sup o}C for 4 h. Highlights: {yields} Optimum casting slips were achieved with 3 wt.% of ammonium polyacrylate and 1 wt.% of tetramethylammonium hydroxide. -- Abstract: Many studies have been performed dealing with the processing conditions of electrodes and electrolytes in solid oxide fuel cells (SOFCs). However, the processing of the interconnector material has received less attention. Lanthanum chromite (LaCrO{sub 3}) is probably the most studied material as SOFCs interconnector. This paper deals with the rheology and casting behaviour of lanthanum chromite based materials to produce interconnectors for SOFCs. A powder with the composition La{sub 0.80}Sr{sub 0.20}Cr{sub 0.92}Co{sub 0.08}O{sub 3} was obtained by combustion synthesis. Aqueous suspensions were prepared to solids loading ranging from 8 to 17.5 vol.%, using ammonium polyacrylate (PAA) as dispersant and tetramethylammonium hydroxide (TMAH) to assure a basic pH and providing stabilization. The influence of the additives concentrations and suspension ball milling time were studied. Suspensions prepared with 24 h ball milling, with 3 wt.% and 1 wt.% of PAA and TMAH, respectively, yielded the best conditions for successful slip casting. Sintering of the green discs was performed in air at 1600 {sup o}C for 4 h leading to relatively dense materials.

Direct Quantification of Rare Earth Elements Concentrations in Urine of Workers Manufacturing Cerium, Lanthanum Oxide Ultrafine and Nanoparticles by a Developed and Validated ICP-MS

Science.gov (United States)

Li, Yan; Yu, Hua; Zheng, Siqian; Miao, Yang; Yin, Shi; Li, Peng; Bian, Ying

2016-01-01

Rare earth elements (REEs) have undergone a steady spread in several industrial, agriculture and medical applications. With the aim of exploring a sensitive and reliable indicator of estimating exposure level to REEs, a simple, accurate and specific ICP-MS method for simultaneous direct quantification of 15 REEs (89Y, 139La, 140Ce, 141Pr, 146Nd, 147Sm, 153Eu, 157Gd, 159Tb, 163Dy, 165Ho, 166Er, 169Tm, 172Yb and 175Lu) in human urine has been developed and validated. The method showed good linearity for all REEs in human urine in the concentrations ranging from 0.001–1.000 μg∙L−1 with r2 > 0.997. The limits of detection and quantification for this method were in the range of 0.009–0.010 μg∙L−1 and 0.029–0.037 μg∙L−1, the recoveries on spiked samples of the 15 REEs ranged from 93.3% to 103.0% and the relative percentage differences were less than 6.2% in duplicate samples, and the intra- and inter-day variations of the analysis were less than 1.28% and less than 0.85% for all REEs, respectively. The developed method was successfully applied to the determination of 15 REEs in 31 urine samples obtained from the control subjects and the workers engaged in work with manufacturing of ultrafine and nanoparticles containing cerium and lanthanum oxide. The results suggested that only the urinary levels of La (1.234 ± 0.626 μg∙L−1), Ce (1.492 ± 0.995 μg∙L−1), Nd (0.014 ± 0.009 μg∙L−1) and Gd (0.023 ± 0.010 μg∙L−1) among the exposed workers were significantly higher (p < 0.05) than the levels measured in the control subjects. From these, La and Ce were the primary components, and accounted for 88% of the total REEs. Lanthanum comprised 27% of the total REEs while Ce made up the majority of REE content at 61%. The remaining elements only made up 1% each, with the exception of Dy which was not detected. Comparison with the previously published data, the levels of urinary La and Ce in workers and the control subjects show a higher trend

40 CFR 141.551 - What strengthened combined filter effluent turbidity limits must my system meet?

Science.gov (United States)

2010-07-01

... effluent turbidity limits must my system meet? 141.551 Section 141.551 Protection of Environment... Effluent Requirements § 141.551 What strengthened combined filter effluent turbidity limits must my system meet? Your system must meet two strengthened combined filter effluent turbidity limits. (a) The first...

26 CFR 31.3401(a)(14)-1 - Group-term life insurance.

Science.gov (United States)

2010-04-01

...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3401(a)(14)-1 Group-term life insurance. (a) The cost of... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Group-term life insurance. 31.3401(a)(14)-1...

40 CFR 60.141a - Definitions.

Science.gov (United States)

2010-07-01

... steel production cycle are also included when the hot metal transfer station or skimming station is an... Process Steelmaking Facilities for Which Construction is Commenced After January 20, 1983 § 60.141a... amended or in subpart A of this part. Basic oxygen process furnace (BOPF) means any furnace with a...

40 CFR 141.721 - Reporting requirements.

Science.gov (United States)

2010-07-01

... operational data for toolbox options. Microbial Toolbox Reporting Requirements Toolbox option Systems must... coagulant (iv) At least 0.5-log mean reduction of influent turbidity or compliance with alternative State... treatment compliance date in § 141.713. (ii) If monthly average of daily max turbidity is greater than 1 NTU...

Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

International Nuclear Information System (INIS)

Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

2013-01-01

Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

Doping and temperature dependence of incommensurate antiferromagnetism in underdoped lanthanum cuprates

International Nuclear Information System (INIS)

Yuan Feng; Feng Shiping; Su Zhaobin; Yu Lu

2001-08-01

The doping, temperature and energy dependence of the dynamical spin structure factors of the underdoped lanthanum cuprates in the normal state is studied within the t-J model using the fermion-spin transformation technique. Incommensurate peaks are found at [(1±δ)π, π], [π, (1±δ)π] at relatively low temperatures with δ linearly increasing with doping at the beginning and then saturating at higher dopings. These peaks broaden and weaken in amplitude with temperature and energy, in good agreement with experiments. The theory also predicts a rotation of these peaks by π/4 at even higher temperatures, being shifted to [(1±δ/√2)π, (1±δ/√2)π]. (author)

A meta-analysis of water quality and aquatic macrophyte responses in 18 lakes treated with lanthanum modified bentonite (PHOSLOCK®)

NARCIS (Netherlands)

Spears, B.M.; Mackay, E.; Yasseri, S.; Gunn, I.D.M.; Waters, K.E.; Andrews, C.; Cole, S.; Ville, de M.; Kelly, M.; Meis, S.; Moore, A.L.; Nurnberg, G.K.; Oosterhout, van Frank; Lurling, M.F.L.L.W.

2016-01-01

Lanthanum (La) modified bentonite is being increasingly used as a geo-engineering tool for the control of phosphorus (P) release from lake bed sediments to overlying waters. However, little is known about its effectiveness in controlling P across a wide range of lake conditions or of its potential

14 CFR 141.41 - Flight simulators, flight training devices, and training aids.

Science.gov (United States)

2010-01-01

..., and training aids. 141.41 Section 141.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... aids. An applicant for a pilot school certificate or a provisional pilot school certificate must show that its flight simulators, flight training devices, training aids, and equipment meet the following...

Variation in band gap of lanthanum chromate by transition metals doping LaCr0.9A0.1O3 (A:Fe/Co/Ni)

International Nuclear Information System (INIS)

Naseem, Swaleha; Khan, Wasi; Saad, A. A.; Shoeb, M.; Ahmed, Hilal; Naqvi, A. H.; Husain, Shahid

2014-01-01

Transition metal (Fe, Co, Ni) doped lanthanum chromate (LaCrO 3 ) nanoparticles (NPs) were prepared by gel combustion method and calcinated at 800°C. Microstructural studies were carried by XRD and SEM/EDS techniques. The results of structural characterization show the formation of all samples in single phase without any impurity. Optical properties were studied by UV- visible and photoluminescence techniques. The energy band gap was calculated and the variation was observed with the doping of transition metal ions. Photoluminescence spectra show the emission peak maxima for the pure LaCrO 3 at about 315 nm. Influence of Fe, Co, Ni doping was studied and compared with pure lanthanum chromate nanoparticles

Study of the Effect on Ionic Conductivity and Structral Morphology of the SR Doped Lanthanum Gallate Solid Electrolyte

Science.gov (United States)

Sood, Kapil; Singh, K.; Pandey, O. P.

2013-07-01

In the present study, lanthanum gallate and Sr-doped lanthanum gallate samples were prepared by conventional solid state reaction method. The phase conformation has been performed by using X-ray diffraction (XRD) study. The elemental composition has been confirmed using energy dispersive spectroscopy (EDS) analysis. Ac conductivity of the samples has been measured in the frequency range 0.1-106 Hz and from 50-800 °C. The impedance plots among real and complex impedances at particular temperature have been discussed. The behavior shows the effect of bulk and grain boundary effects of the doped sample. The impedance plots with frequency have been analyzed. The plots have been well fitted to equivalent circuit model. The conductivity shows the Arrhenius type of behavior. The activation energy has been calculated from the plots and represents that the conductivity through the material is mainly ionic. The structural morphology of the samples has been investigated using scanning electron microscope (SEM). The micrograph shows that the porosity and grain size both decreases with Sr-doping.

Synthesis of Ni nanoparticles in lanthanum chromite ceramic matrix

International Nuclear Information System (INIS)

Tinti, Victor Buratto; Florio, Daniel Zanetti de; Fonseca, Fabio Coral

2016-01-01

Full text: Lanthanum chromite is a well-known interconnector for solid oxide fuel cells. It presents electronic conductivity at high temperatures. Moreover it is very stable in oxidizing and reducing atmospheres. Due to its high stability this material is a promising matrix to produce and stabilize nanoparticles by exothermal reaction. The objective of the present work is to synthesize and stabilize nickel nanoparticles in a stable ceramic matrix. Compounds of (La 1-x Sr x ) a (Cr 1-y Ni y )O 3 (x and y = 0, 0.1, and 0.2; a = 1, and 0.8) were synthesized by Pechini method. The powders were heat treated in air at 1300 °C and 1600°C in attempt to solubilise NiO in the matrix. Then the samples were exposed to a reducing treatment in H 2(g) flux at 900°C per 8 hours. XRD measurements were made using a D8 Focus, Bruker AXS. The data was acquired in a range of 2θ from 20° to 90°, with a step of 0,02° per second. Magnetic properties were investigated utilizing a SQUIDVSM from Quantum Design. Magnetic moment at constant magnetic field (100 Oe and 1000 Oe) was measured in a range of 2K to 300K. Analyses with variable magnetic field were performed at 2K, 196K and 390K in a rage from -5 up to 5 T. Samples were observed using TEM technique. The XRD results showed that the stoichiometric samples achieved desiderate phase. Compounds without Sr and non-stoichiometric lanthanum site showed an incomplete nickel solid solution. The addition of 10% of Sr decreases the Neel temperature from 289 K to 285K. Ni doping created a stronger effect, lowering the temperature down to 267 K , in the sample with 10% of dopant. After reduction is possible to observe peaks of Ni in the XRD, indicating that nickel was exoluted form the matrix. Images of TEM confirm the presence of nanoparticles with an approximate diameter of 3 nm. The reducing treatment increased the magnetic response. (author)

High concentrations of cadmium, cerium and lanthanum in indoor air due to environmental tobacco smoke

International Nuclear Information System (INIS)

Böhlandt, Antje; Schierl, Rudolf; Diemer, Juergen; Koch, Christoph; Bolte, Gabriele; Kiranoglu, Mandy; Fromme, Hermann; Nowak, Dennis

2012-01-01

Background: Environmental tobacco smoke (ETS) is one of the most important sources for indoor air pollution and a substantial threat to human health, but data on the concentrations of the trace metals cerium (Ce) and lanthanum (La) in context with ETS exposure are scarce. Therefore the aim of our study was to quantify Ce and La concentrations in indoor air with high ETS load. Methods: In two subsequent investigations Ce, La and cadmium (Cd) in 3 smokers' (11 samples) and 7 non-smokers' (28 samples) households as well as in 28 hospitality venues in Southern Germany were analysed. Active sampling of indoor air was conducted continuously for seven days in every season in the smokers' and non-smokers' residences, and for 4 h during the main visiting hours in the hospitality venues (restaurants, pubs, and discotheques). Results: In terms of residences median levels of Cd were 0.1 ng/m 3 for non-smokers' and 0.8 ng/m 3 for smokers' households. Median concentrations of Ce were 0.4 ng/m 3 and 9.6 ng/m 3 , and median concentrations of La were 0.2 ng/m 3 and 5.9 ng/m 3 for non-smokers' and for smokers' households, respectively. In the different types of hospitality venues median levels ranged from 2.6 to 9.7 ng/m 3 for Cd, from 18.5 to 50.0 ng/m 3 for Ce and from 10.6 to 23.0 ng/m 3 for La with highest median levels in discotheques. Conclusions: The high concentrations of Ce and La found in ETS enriched indoor air of smokers' households and hospitality venues are an important finding as Ce and La are associated with adverse health effects and data on this issue are scarce. Further research on their toxicological, human and public health consequences is urgently required. - Highlights: ► We quantified cer, lanthanum and cadmium concentrations in indoor air. ► Cer and lanthanum concentrations were high in tobacco smoke enriched locations. ► Both elements can be considered as good markers for indoor air quality.

Accomplishment of highly porous-lithium lanthanum titanate through microwave treatment

Energy Technology Data Exchange (ETDEWEB)

Lakshmi, D.; Nalini, B., E-mail: jyothsnalalin99@gmail.com [Department of Physics, Avinashilingam University for Women, Coimbatore, Tamilnadu (India); Abhilash, K. P.; Selvin, P. Christopher [Department of Physics, NGM college for arts and science, Pollachi, Tamilnadu (India)

2016-05-23

Perovskite structured (ABO{sub 3}) lithium lanthanum titanate (LLTO) is a successful electrolyte reported by several scientists in the recent past. It is believed that intercalation and de-intercalation of Li ions inside solid electrolyte can be improved by increasing the porosity of the material. Hence in this research work, an attempt is made to increase the porosity of the LLTO electrolyte by rapid-microwave synthesis route. The microwave prepared LLTO is compared with the sol-gel synthesized LLTO. The prepared samples are analyzed with XRD, SEM, PL and cyclic Voltammetry studies. Morphological analysis proves that microwave synthesized LLTO contains much pores compared to the Sol-gel LLTO. A remarkable difference in its electrochemical property is also demonstrated and analysed with cyclic voltammetric studies and the results are presented.

Vaporization study on lanthanum-neodymium alloys by mass-spectrometry

International Nuclear Information System (INIS)

Shoji, Y.; Matsui, T.

1999-01-01

Partial vapor pressure of Nd(g) over La x Nd 1-x alloys (x = 0.10, 0.20, 0.30, 0.40, 0.50, 0.60, 0.70, 0.80 and 0.90) was measured with a time-of-flight mass-spectrometer equipped with a tungsten Knudsen cell over the temperature range of 1474-1767 K. Thermodynamic activity of neodymium in the liquid alloys was determined by comparing the partial vapor pressure of Nd(g) over the alloys with that over the pure metal. The thermodynamic activity of lanthanum in the alloys was calculated from that of neodymium obtained experimentally in this study by graphic integration using the Gibbs-Duhem equation. Both activities for each element, thus obtained, showed positive deviations from Raoult's law over the entire compositional range. Thermodynamic quantities such as Gibbs free energy of formation, excess enthalpy etc. were also calculated from the thermodynamic activities. (orig.)

40 CFR 141.174 - Filtration sampling requirements.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection... water system subject to the requirements of this subpart that provides conventional filtration treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Filtration sampling requirements. 141...

Ethanol Electrooxidation on Pt with Lanthanum Oxide as Cocatalyst in a DAFC

Directory of Open Access Journals (Sweden)

T. A. B. Santoro

2012-01-01

Full Text Available Electrocatalytic activity toward ethanol electrooxidation of Pt particles in PtLa/C catalysts with different Pt : La ratios has been studied with different electrochemical and spectroscopic techniques, and the results were compared to those of Pt/C catalyst. Significant enhancement in the electrocatalytic activity has been achieved by depositing the Pt particles with lanthanum oxides/hydroxides using an alcohol reduction method. Compared to Pt/C catalyst, PtLa/C materials exhibit a lower onset potential and a higher electron-transfer rate constant for the investigated reaction. These studies illustrate the possibility of utilizing Pt/C with La oxides/hidroxides as electrocatalyst for direct alcohol fuel cells (DAFCs.

19 CFR 141.14 - Deceased or insolvent consignees and court-appointed administrators.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Deceased or insolvent consignees and court-appointed administrators. 141.14 Section 141.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... administrators. The executor or administrator of the estate of a deceased consignee, the receiver or other legal...

Optical and photoemission studies of lanthanum hydrides

International Nuclear Information System (INIS)

Peterman, D.J.; Peterson, D.T.; Weaver, J.H.

1980-01-01

The results of optical absorptivity and photoemission measurements on lanthanum hydrides, LaH/sub x/ (1.98 less than or equal to x less than or equal to 2.89) are reported. The low energy (hν less than or equal to 0.5 eV) optical features in LaH/sub x/ are attributed to the filling of octahedral sites. Higher energy interband absorption involves states within the d-band complex, analogous to other dihydrides. As x increases above 2.0, the optical features change rapidly due to the increase in the number of occupied octahedral sites. Various band structure studies suggest that LaH 3 might be a semiconductor. Photoemission results show that as x increases, the d-derived states at E/sub F/ are drawn down and that for LaH 2 89 only very weak valence band emission is observed. The hydrogen-derived bonding bands are shown centered approx. 5 eV below E/sub F/. Observed chemical shifts in the La 5p/sub 1/2 3/2/ cores are discussed for 1.98 less than or equal to x less than or equal to 2.89

The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding

Energy Technology Data Exchange (ETDEWEB)

Nemčovičová, Ivana [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States); Slovak Academy of Sciences, Dúbravská cesta 9, SK 84505 Bratislava (Slovakia); Zajonc, Dirk M., E-mail: dzajonc@liai.org [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States)

2014-03-01

The crystal structure of Human cytomegalovirus immune modulator UL141 was solved at 3.25 Å resolution. Here, a detailed analysis of its intimate dimerization interface and the biophysical properties of its receptor (TRAIL-R2 and CD155) binding interactions are presented. Natural killer (NK) cells are critical components of the innate immune system as they rapidly detect and destroy infected cells. To avoid immune recognition and to allow long-term persistence in the host, Human cytomegalovirus (HCMV) has evolved a number of genes to evade or inhibit immune effector pathways. In particular, UL141 can inhibit cell-surface expression of both the NK cell-activating ligand CD155 as well as the TRAIL death receptors (TRAIL-R1 and TRAIL-R2). The crystal structure of unliganded HCMV UL141 refined to 3.25 Å resolution allowed analysis of its head-to-tail dimerization interface. A ‘dimerization-deficient’ mutant of UL141 (ddUL141) was further designed, which retained the ability to bind to TRAIL-R2 or CD155 while losing the ability to cross-link two receptor monomers. Structural comparison of unliganded UL141 with UL141 bound to TRAIL-R2 further identified a mobile loop that makes intimate contacts with TRAIL-R2 upon receptor engagement. Superposition of the Ig-like domain of UL141 on the CD155 ligand T-cell immunoreceptor with Ig and ITIM domains (TIGIT) revealed that UL141 can potentially engage CD155 similar to TIGIT by using the C′C′′ and GF loops. Further mutations in the TIGIT binding site of CD155 (Q63R and F128R) abrogated UL141 binding, suggesting that the Ig-like domain of UL141 is a viral mimic of TIGIT, as it targets the same binding site on CD155 using similar ‘lock-and-key’ interactions. Sequence alignment of the UL141 gene and its orthologues also showed conservation in this highly hydrophobic (L/A)X{sub 6}G ‘lock’ motif for CD155 binding as well as conservation of the TRAIL-R2 binding patches, suggesting that these host�

The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding

International Nuclear Information System (INIS)

Nemčovičová, Ivana; Zajonc, Dirk M.

2014-01-01

The crystal structure of Human cytomegalovirus immune modulator UL141 was solved at 3.25 Å resolution. Here, a detailed analysis of its intimate dimerization interface and the biophysical properties of its receptor (TRAIL-R2 and CD155) binding interactions are presented. Natural killer (NK) cells are critical components of the innate immune system as they rapidly detect and destroy infected cells. To avoid immune recognition and to allow long-term persistence in the host, Human cytomegalovirus (HCMV) has evolved a number of genes to evade or inhibit immune effector pathways. In particular, UL141 can inhibit cell-surface expression of both the NK cell-activating ligand CD155 as well as the TRAIL death receptors (TRAIL-R1 and TRAIL-R2). The crystal structure of unliganded HCMV UL141 refined to 3.25 Å resolution allowed analysis of its head-to-tail dimerization interface. A ‘dimerization-deficient’ mutant of UL141 (ddUL141) was further designed, which retained the ability to bind to TRAIL-R2 or CD155 while losing the ability to cross-link two receptor monomers. Structural comparison of unliganded UL141 with UL141 bound to TRAIL-R2 further identified a mobile loop that makes intimate contacts with TRAIL-R2 upon receptor engagement. Superposition of the Ig-like domain of UL141 on the CD155 ligand T-cell immunoreceptor with Ig and ITIM domains (TIGIT) revealed that UL141 can potentially engage CD155 similar to TIGIT by using the C′C′′ and GF loops. Further mutations in the TIGIT binding site of CD155 (Q63R and F128R) abrogated UL141 binding, suggesting that the Ig-like domain of UL141 is a viral mimic of TIGIT, as it targets the same binding site on CD155 using similar ‘lock-and-key’ interactions. Sequence alignment of the UL141 gene and its orthologues also showed conservation in this highly hydrophobic (L/A)X 6 G ‘lock’ motif for CD155 binding as well as conservation of the TRAIL-R2 binding patches, suggesting that these host–receptor interactions

Size effects of polycrystalline lanthanum modified Bi4Ti3O12 thin films

International Nuclear Information System (INIS)

Simoes, A.Z.; Riccardi, C.S.; Cavalcante, L.S.; Gonzalez, A.H.M.; Longo, E.; Varela, J.A.

2008-01-01

The film thickness dependence on the ferroelectric properties of lanthanum modified bismuth titanate Bi 3.25 La 0.75 Ti 3 O 12 was investigated. Films with thicknesses ranging from 230 to 404 nm were grown on platinum-coated silicon substrates by the polymeric precursor method. The internal strain is strongly influenced by the film thickness. The morphology of the film changes as the number of layers increases indicating a thickness dependent grain size. The leakage current, remanent polarization and drive voltage were also affected by the film thickness

The lanthanum(III molybdate(VI La4Mo7O27

Directory of Open Access Journals (Sweden)

Petra Becker

2009-08-01

Full Text Available Crystals of the orthorhombic phase La4Mo7O27 (lanthanum molybdenum oxide were obtained from a non-stoichiometric melt in the pseudo-ternary system La2O3–MoO3–B2O3. In the crystal structure, distorted square-antiprismatic [LaO8] and monocapped square-antiprismatic [LaO9] polyhedra are connected via common edges and faces into chains along [010]. These chains are arranged in layers that alternate with layers of [MoO4] and [MoO5] polyhedra parallel to (001. In the molybdate layers, a distorted [MoO5] trigonal bipyramid is axially connected to two [MoO4] tetrahedra, forming a [Mo3O11] unit.

9 CFR 319.141 - Fresh pork sausage.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Fresh pork sausage. 319.141 Section... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Sausage Generally: Fresh...

Evaluation and comparison of two complexometric titration methods for determining of lanthanum in cloridric solutions

International Nuclear Information System (INIS)

Menezes, M.F.; Santos, R.L.C. dos; Goes, M.A.C. de

1994-01-01

The fast determination of total rare earth concentration in aqueous solutions is based on titrimetric methods using EDTA as complexing agent. This paper evaluates two among several others titrimetric methods used in the determination of lanthanum in hydrochloric acid solutions, using xylenol orange and a mixture of methyl orange and xylenol orange as indicators. The applied statistical evaluation allowed the determination of the stability, accuracy and adequacy of these methods on a given technical specification. (author). 12 refs., 03 tabs., 01 fig

Decay mechanism of the fsub(7/2) isobaric analog state of 141Pr, (2)

International Nuclear Information System (INIS)

Uegaki, Junichi; Shoda, Katsufusa

1975-01-01

Experimental results on the f7/2 IAR(isobaric analog resonance) by 141 Pr (e, e'p) reaction were reported previously. This paper presents the results of further measurement on this reaction. The energy spectra of protons emitted by the 141 Pr (e, e'p) reaction, obtained at the electron energy Ee of 16.3, 15.5, 14.8 and 14.1 MeV, are shown. A peak seen at the proton energy Ep of 9.5 MeV in the spectrum taken at Ee=16.3 MeV shows the proton group decaying from the f7/2 isobaric analog state (IAS) to 140 Ce ground state, and the excitation energy of the f7/2 IAS was calculated as Ex=14.8 MeV. The cross-section of the reaction 141 Pr (γ, p 0 ) can be estimated from the spectra obtained, and was compared with that estimated from the 140 Ce (p, γ 0 ) reaction. The cross-section of the 141 Pr (e, e'p) reaction is shown as a function of incident electron energy, and the resonance intensity of the f7/2 IAR was estimated as (2.7 +- 1.3) x 10 -28 cm 2 MeV. The radiation width of the f7/2 IAR of 141 Pr was 25.8 eV, and this value is not in agreement with that obtained from 141 Pr (p, γ 0 ). The proton spectra of 141 Pr (γ, p) reaction can be obtained from the proton spectra of 141 Pr (e, e'p) reaction by assuming virtual photon spectra. The result was compared with the result of 140 Ce (p, p') reaction. The one particle-one hole state of neutrons distributed over the energy range between 5.3 and 6.3 MeV, and the first excited 2 + state was seen at Esub(p)=7.9 MeV. In the range between 6.3 and 7.8 MeV, a proton group existed, which did not agree with the data of proton scattering. More precise study is under consideration. (Kato, T.)

MicroRNA-141 inhibits migration of gastric cancer by targeting zinc finger E-box-binding homeobox 2.

Science.gov (United States)

Du, Ying; Wang, Lingfei; Wu, Honghai; Zhang, Yiyin; Wang, Kan; Wu, Dingting

2015-09-01

Human microRNA (miR)-141 is a member of the miR‑200 family, which has been reported to be downregulated in gastric cancer, and involved in the proliferation of gastric cancer cells. However, little is currently known regarding its role in the migration of gastric cancer. The present study investigated the function of miR‑141 in gastric cancer cell migration, and evaluated the contribution of zinc finger E‑box‑binding homeobox 1 and 2 (ZEB1/2) in miR‑141 mediated migration of gastric cancer cells. The expression levels of miR‑141 and its potential ZEB1/2 targets were examined by quantitative polymerase chain reaction (qPCR) and western blotting, respectively. The migration of SGC‑7901 and HGC‑27 gastric cancer cells, which had been transfected with an miRNA precursor, was examined by cell migration and wound healing assays. A luciferase activity assay was used to validate whether ZEB1/2 was a direct target of miR‑141. The results demonstrated that overexpression of miR‑141 markedly inhibited the migration of gastric cancer cells in vitro. Forced overexpression of miR‑141 significantly reduced the luciferase activity of the 3'‑untranslated region of ZEB2 in gastric cancer cells. Furthermore, the mRNA and protein expression levels of ZEB2 were reduced in cells overexpressing miR‑141, whereas the protein expression levels of E‑cadherin were increased. In gastric tumor samples the expression levels of ZEB2 were inversely correlated with the expression of miR‑141. These results suggest that miR‑141 may be involved in the inhibition of gastric cancer cell migration, and that ZEB2 is a target gene of miR-141.

33 CFR 209.141 - Coordination of hydroelectric power operations with power marketing agencies.

Science.gov (United States)

2010-07-01

... Commanders will develop, in coordination with their respective power marketing agency, a system for exchanging operating information. The system will include general operating information and information on... power operations with power marketing agencies. 209.141 Section 209.141 Navigation and Navigable Waters...

An i{sub 13/2} neutron intruder band in {sup 141}Gd

Energy Technology Data Exchange (ETDEWEB)

Mullins, S M; Omar, A; Persson, L; Prevost, D; Waddington, J C [McMaster Univ., Hamilton, ON (Canada); Andrews, H R; Ball, G C; Galindo-Uribarri, A; Janzen, V P; Radford, D C; Ward, D [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Drake, T E [Toronto Univ., ON (Canada). Dept. of Physics; Fossan, D B; Lafosse, D; Vaska, P; Waring, M [State Univ. of New York, Stony Brook, NY (United States). Dept. of Physics; Wadsworth, R [York Univ. (United Kingdom). Dept. of Physics

1992-08-01

The nucleus {sup 141}Gd has been investigated at high spins for the first time following the reactions {sup 112}Sn({sup 32}S,2pn){sup 141}Gd at 155 MeV and {sup 112}Sn({sup 33}S,2p2n){sup 141}Gd at 170 MeV. The methods of in-beam {gamma}-ray spectroscopy were used to establish a number of different structures, including a band which has been assigned as being based on the {nu}i{sub 13/2}[660]1/2{sup +} Nilsson intruder orbital. This is the heaviest nucleus thus far in which this type of intruder band has been identified. (author). 11 refs., 3 figs.

40 CFR 141.623 - Reduced monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Reduced monitoring. 141.623 Section....623 Reduced monitoring. (a) You may reduce monitoring to the level specified in the table in this paragraph (a) any time the LRAA is ≤0.040 mg/L for TTHM and ≤0.030 mg/L for HAA5 at all monitoring locations...

Sintering and electrical properties of strontium-doped lanthanum manganite

Energy Technology Data Exchange (ETDEWEB)

Tarrago, Diego Pereira; Sousa, Vania Caldas de [Universidade Federal do Rio Grande do Sul (LABIOMAT/PPGEM/UFRGS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Engenharia de Minas, Metalurgica e de Materiais. Lab. de Biomateriais], Email: dptarrago@gmail.com; Moreno Buriel, Berta; Chinarro Martini, Eva; Jurado Egea, Jose Ramon [Consejo Superior de Investigaciones Cientificas (ICV/CSIC), Madrid (Spain). Inst. de Ceramica y Vidrio; Malfatti, Celia de Fraga [Universidade Federal do Rio Grande do Sul (LAPEC/PPGEM/UFRGS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Engenharia de Minas, Metalurgica e de Materiais. Lab. de Pesquisa em Corrosao

2010-07-01

Lanthanum strontium manganites (LSM) are potential materials for cathode applications in solid oxide fuel cells (SOFC) due to their good catalytic activity, chemical stability and compatibility with electrolyte materials in high temperatures. The sinterability of single phase La{sub 1-x}Sr{sub x}Mn{sub O3} (x=0.18) perovskite powders and the electrical properties of the resulting samples are analyzed in this study. Using a heating microscope, the powders were pressed and sintered at different pressures and temperatures, resulting in an open porosity of 33.36% when compacted at 125 MPa and sintered at 1200 degree C. Top and cross-section s canning electron microscopy (SEM) micrographs revealed interconnected pores in the sintered body and, hence, a suitable microstructure for the application. The activation energy for conductance was 0.04 eV and the tested LSM bulk started to exhibit adequate electrical properties at about 500 degree C. (author)

40 CFR 141.802 - Coliform sampling plan.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Coliform sampling plan. 141.802... sampling plan. (a) Each air carrier under this subpart must develop a coliform sampling plan covering each... required actions, including repeat and follow-up sampling, corrective action, and notification of...

Schostakowitsch: Sinfonie N15, Op. 141 / Hanspeter Krellmann

Index Scriptorium Estoniae

Krellmann, Hanspeter

1990-01-01

Uuest heliplaadist "Schostakowitsch: Sinfonie N15, Op. 141, Oktober, Op. 131, Ouvertüre über russische und kirgisische Volksthemen, Op. 115. Göteborger Sinfonie-Orchester, Neeme Järvi". DG CD 427 616-2

40 CFR 141.571 - What records does subpart T require my system to keep?

Science.gov (United States)

2010-07-01

... records does subpart T require my system to keep? Your system must keep several types of records based on... Benchmarking(§§ 141.540-141.544) Benchmark (including raw data and analysis) Indefinitely. ...

14 CFR 141.18 - Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances. 141.18 Section 141.18 Aeronautics and Space FEDERAL AVIATION... General § 141.18 Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances...

Thermoluminescent dosimetric characterization of the perovskite, KMgF3, activated with lanthanum

International Nuclear Information System (INIS)

Sepulveda M, F.

2003-01-01

The new ICRP regulation about the Radiological Protection allows to the different groups to study new thermoluminescent materials highly sensitive for dosimetric applications (personal and environmental). This work reports the relative experimental results to the thermoluminescent characteristic of a new preparation of the fluorine perovskite activated with lanthanum absorbed in polytetrafluoroethylene (KMgF 3 : LaF 3 + Ptfe). The main thermoluminescent properties investigated were: the TL response like a function of the absorbed dose, the attainable accuracy in the dose measurement, the reproducibility of the TL readings and the threshold dose. The obtained results were compared with the requirements of the ANSI protocol for the environmental dosimetry, resulting in a very good agreement with the required yields. (Author)

27 CFR 24.141 - Bonded wine warehouse.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bonded wine warehouse. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Permanent Discontinuance of Operations § 24.141 Bonded wine warehouse. Where all operations at a bonded wine warehouse are to be permanently...

Effect of substituting cerium-rich mischmetal with lanthanum on high temperature properties of die-cast Mg-Zn-Al-Ca-RE alloys

International Nuclear Information System (INIS)

Anyanwu, Ifeanyi A.; Gokan, Yasuhiro; Suzuki, Atsuya; Kamado, Shigeharu; Kojima, Yo; Takeda, Suguru; Ishida, Taketoshi

2004-01-01

Mg-Zn-Al-Ca-RE alloys have been found to be promising materials for substituting aluminum alloys used for automatic transmission case applications in the automobile industry. Particularly, Mg-0.5%Zn-6%Al-1%Ca-3%RE (ZAXE05613) alloy exhibits comparable creep resistance as ADC12 die-casting aluminum alloy that is currently used for automatic transmission case applications. Changing the rare earth (RE) content of the alloy from mischmetal to lanthanum gives a further improvement in the creep properties of the alloy. Lanthanum addition results in the crystallization of a large amount of acicular Al 11 RE 3 (Al 11 La 3 ) compound along the grain boundaries as well as across the grain boundaries and this effectively controls grain boundary sliding and dislocation motion in the vicinity of the grain boundaries. As a result, die-cast ZAXLa05613 alloy exhibits a higher creep resistance than that of ZAXE05613 alloy

Study of the Durability of Doped Lanthanum Manganite and Cobaltite Cathode Materials under ''Real World'' Air Exposure Atmospheres

Energy Technology Data Exchange (ETDEWEB)

Singh, Prabhakar [Univ. of Connecticut, Storrs, CT (United States); Mahapatra, Manoj [Univ. of Connecticut, Storrs, CT (United States); Ramprasad, Rampi [Univ. of Connecticut, Storrs, CT (United States); Minh, Nguyen [Univ. of California, San Diego, CA (United States); Misture, Scott [Alfred Univ., NY (United States)

2014-11-30

The overall objective of the program is to develop and validate mechanisms responsible for the overall structural and chemical degradation of lanthanum manganite as well as lanthanum ferrite cobaltite based cathode when exposed to “real world” air atmosphere exposure conditions during SOFC systems operation. Of particular interest are the evaluation and analysis of degradation phenomena related to and responsible for (a) products formation and interactions with air contaminants, (b) dopant segregation and oxide exolution at free surfaces, (c) cation interdiffusion and reaction products formation at the buried interfaces, (d) interface morphology changes, lattice transformation and the development of interfacial porosity and (e) micro-cracking and delamination from the stack repeat units. Reaction processes have been studied using electrochemical and high temperature materials compatibility tests followed by structural and chemical characterization. Degradation hypothesis has been proposed and validated through further experimentation and computational simulation.

Formation of Lanthanum Hydroxide nano structures: Effect of NaOH and KOH solvents

International Nuclear Information System (INIS)

Mazloumi, M.; Zanganeh, S.; Kajbafvala, A.; Shayegh, M. R.; Sadrnezhaad, S. K.

2008-01-01

Lanthanum hydroxide (La(OH) 3 ) nano structures, including elliptical nanoparticles, octahedral rods and irregular nanoparticles were prepared chemically in NaOH and KOH solutions with 10 M concentration. The obtained powders were characterized with x-ray diffraction, scanning electron microscopy, transmission electron microscopy and differential thermal analysis. Crystallinities, morphologies and thermal behavior of the obtained nano structure powders were investigated under the influence of above mentioned solvents. The effect of chemical's temperature was also determined in one of the solvents (i.e. NaOH). The formation of growth in nano structure mechanism under the influence of alkali solutions (i.e., KOH and NaOH) have been discussed considerably in this paper

41 CFR 105-71.141 - Financial reporting.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... GOVERNMENTS 71.14-Post-Award Requirements/Reports, Records, Retention, and Enforcement § 105-71.141 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this section, grantees will...

A meta-analysis of water quality and aquatic macrophyte responses in 18 lakes treated with lanthanum modified bentonite (Phoslock®)

NARCIS (Netherlands)

Spears, Bryan M.; Mackay, Eleanor B.; Yasseri, Said; Gunn, Iain D.M.; Waters, Kate E.; Andrews, Christopher; Cole, Stephanie; De Ville, Mitzi; Kelly, Andrea; Meis, Sebastian; Moore, Alanna L.; Nürnberg, Gertrud K.; van Oosterhout, Frank; Pitt, Jo-Anne; Madgwick, Genevieve; Woods, Helen J.; Lürling, Miquel

2016-01-01

Abstract Lanthanum (La) modified bentonite is being increasingly used as a geo-engineering tool for the control of phosphorus (P) release from lake bed sediments to overlying waters. However, little is known about its effectiveness in controlling P across a wide range of lake conditions or of its

Lanthanum and cerium co-modified Ni/SiO2 catalyst for CO methanation from syngas

Science.gov (United States)

Gong, Dandan; Li, Shuangshuang; Guo, Shaoxia; Tang, Honggui; Wang, Hong; Liu, Yuan

2018-03-01

Sintering of active metal nanoparticles (NPs) and carbon deposition is critical problems for many metal catalysts, such as nickel based catalysts for generating methane from syngas. To improve the resistance to the sintering and carbon deposition, a new scheme was proposed in this work. Lanthanum and cerium co-modified Ni/SiO2 catalysts were synthesized by using perovskite type oxide of La1-xCexNiO3 loaded on SiO2 as the precursor. In a nanocrystallite of La1-xCexNiO3, ions of nickel, lanthanum and cerium are evenly mixed at atomic level and confined in the nanocrystallite, therefore, Ni NPs and the two promoters of La2O3 and CeO2 should be in close contact and highly dispersed on SiO2 after reduction. The catalysts were characterized by using XRD, TEM, BET, H2-TPD, XPS, TG and Raman techniques. Compared with the mono-promoted catalysts, the bi-promoted La0.75Ce0.25NiO3/SiO2 showed much better resistance to carbon deposition, higher resistance to sintering and higher activity for CO methanation, which are attributed to co-eliminating effect of the two promoters for the deposited carbon, confinement of the interacted two promoters for Ni NPs and the higher dispersion of Ni NPs derived from the smaller size of La0.75Ce0.25NiO3.

Carbon doped lanthanum aluminate (LaAlO3:C) synthesized by solid state reaction for application in UV thermoluminescent dosimetry

International Nuclear Information System (INIS)

Alves, N.

2015-01-01

In this work we discuss the TL output for LaAlO 3 :C crystals grown by using three different combinations of Al 2 O 3 , La 2 O 3 and carbon atoms during the synthesis process. Recently, LaAlO 3 single crystals, co-doped with Ce 3+ and Dy 3+ rare earth trivalent ions and grown under hydrothermal conditions, have been reported to show high thermoluminescent response (TL) when exposed to low levels of ultraviolet radiation (UVR). However, undoped LaAlO 3 synthesized by solid state reaction method from the 1:1 mixture of aluminum and lanthanum oxide under reducing atmosphere revealed to have still higher thermoluminescent sensitivity to UV photon fields than the co-doped with Ce 3+ and Dy 3+ . It is well known that carbon doped aluminum oxide monocrystals have excellent TL and photoluminescent response properties for X-rays, UV and gamma radiation fields. Thus, we conducted three different syntheses of LaAlO 3 by this solid state reaction method, doping the mixture with carbon. The lanthanum aluminate polycrystals were synthesized from the 1:1 mixture of aluminum and lanthanum oxide, adding 0.1wt.% carbon and annealed at 1700°C for two hours in hydrogen atmosphere. The X-ray diffraction analysis revealed the formation of rhombohedral LaAlO 3 crystallographic phase, however a small percentage (15%) of Al 2 O 3 has been also identified. The UV-Vis absorbance spectra were obtained and F and F + - center were ascribed. The UV irradiations were carried out using a commercial 8W UV lamp. Thermoluminescence measurements were performed at a Harshaw 4500 TL reader. All compositions investigated have shown high TL sensitivity to UVR. (author)

40 CFR 141.701 - Source water monitoring.

Science.gov (United States)

2010-07-01

... (a)(4) of this section based on the E. coli level that applies to the nearest surface water body. If no surface water body is nearby, the system must comply based on the requirements that apply to... Monitoring Requirements § 141.701 Source water monitoring. (a) Initial round of source water monitoring...

14 CFR 141.55 - Training course: Contents.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training course: Contents. 141.55 Section... Training course: Contents. (a) Each training course for which approval is requested must meet the minimum... trained in the room at one time; (2) A description of each type of audiovisual aid, projector, tape...

Variation in band gap of lanthanum chromate by transition metals doping LaCr{sub 0.9}A{sub 0.1}O{sub 3} (A:Fe/Co/Ni)

Energy Technology Data Exchange (ETDEWEB)

Naseem, Swaleha, E-mail: wasiamu@gmail.com; Khan, Wasi, E-mail: wasiamu@gmail.com; Saad, A. A., E-mail: wasiamu@gmail.com; Shoeb, M., E-mail: wasiamu@gmail.com; Ahmed, Hilal, E-mail: wasiamu@gmail.com; Naqvi, A. H. [Centre of Excellence in Materials Science (Nanomaterials), Department of Applied Physics, Z.H. College of Engg. and Technology, Aligarh Muslim University, Aligarh-202002 (India); Husain, Shahid [Department of Physics, Aligarh Muslim University, Aligarh-202002 (India)

2014-04-24

Transition metal (Fe, Co, Ni) doped lanthanum chromate (LaCrO{sub 3}) nanoparticles (NPs) were prepared by gel combustion method and calcinated at 800°C. Microstructural studies were carried by XRD and SEM/EDS techniques. The results of structural characterization show the formation of all samples in single phase without any impurity. Optical properties were studied by UV- visible and photoluminescence techniques. The energy band gap was calculated and the variation was observed with the doping of transition metal ions. Photoluminescence spectra show the emission peak maxima for the pure LaCrO{sub 3} at about 315 nm. Influence of Fe, Co, Ni doping was studied and compared with pure lanthanum chromate nanoparticles.

27 CFR 70.141 - Lien for taxes.

Science.gov (United States)

2010-04-01

... intangible, belonging to such person. The lien attaches to all property and rights to property belonging to such person at any time during the period of the lien, including any property or rights to property... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Lien for taxes. 70.141...

Polarization of lanthanum nucleus by dynamic polarization method

International Nuclear Information System (INIS)

Adachi, Toshikazu; Ishimoto, Shigeru; Masuda, Yasuhiro; Morimoto, Kimio

1989-01-01

Preliminary studies have been carried out concerning the application of a dynamic polarization method to polarizing lanthanum fluoride single crystal to be employed as target in experiments with time reversal invariance. The present report briefly outlines the dynamic polarization method and describes some preliminary studies carried out so far. Dynamic polarization is of particular importance because no techniques are currently available that can produce highly polarized static nucleus. Spin interaction between electrons and protons (nuclei) plays a major role in the dynamic polarization method. In a thermal equilibrium state, electrons are polarized almost completely while most protons are not polarized. Positively polarized proton spin is produced by applying microwave to this system. The most hopeful candidate target material is single crystal of LaF 3 containing neodymium because the crystal is chemically stable and easy to handle. The spin direction is of great importance in experiments with time reversal invariance. The spin of neutrons in the target can be cancelled by adjusting the external magnetic field applied to a frozen polarized target. In a frozen spin state, the polarity decreases slowly with a relaxation time that depends on the external magnetic field and temperature. (N.K.)

7 CFR 1703.141 - Approved purposes for loans.

Science.gov (United States)

2010-01-01

..., DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Loan Program § 1703.141... the project, including vehicles utilizing distance learning and telemedicine technology to deliver...) Providing links between teachers and students or medical professionals who are located at the same facility...

40 CFR 141.203 - Tier 2 Public Notice-Form, manner, and frequency of notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 2 Public Notice-Form, manner, and frequency of notice. 141.203 Section 141.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...., house renters, apartment dwellers, university students, nursing home patients, prison inmates, etc...

40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 3 Public Notice-Form, manner, and frequency of notice. 141.204 Section 141.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...., house renters, apartment dwellers, university students, nursing home patients, prison inmates, etc...

Production and processing of spinel semi-porous sintered blocks to CAD-CAM with lanthanum-glass infiltration for dental applications

International Nuclear Information System (INIS)

Lourenco, A.A.C.; Ogasawara, T.; Costa Neto, C.A.; Santos, F.V.C.

2009-01-01

The objective of this research was to obtain direct synthesis and sintering spinel by using powder mixing method for CAD-CAM ceramics manufacturing. Powders of alumina and magnesia (71.8 wt% Al2O3 and 28.2 wt% MgO) were mixed with 5 wt% of PVA and PEG binders and homogenized using ball mill (12h), then deagglomerated and submitted to uniaxial pressing into discs and plates (54 to 221.96 MPa), followed by isostatic pressing (186.03 MPa) and sintering at 1500 deg C(GrI) , 1600 C(GrII) and 1700 deg C(GrIII). Characterizations: XRD, density and four-point flexural strength and (for GrIII) elasticity modulus and Vickers microhardness. Lanthanum-glass was infiltrated into samples from all three Groups. Conclusions: (1) Plenty success for the pediatrician method; (2) Maximum density achieved for GrIII, best mechanical strength for GrII (compared to that of commercial product ), this last one being the most indicated for In-Ceram manufacturing via CAD-CAM route; (3) The flexural strength of GrI might be improved a lot after Lanthanum-glass infiltration. (author)

Development of proton conducting materials and membranes based on lanthanum tungstate for hydrogen separation from gas mixtures

International Nuclear Information System (INIS)

Seeger, Janka

2013-01-01

Lanthanum tungstate La 6-x WO 12-δ (named LWO) is a ceramic material with mixed protonic electronic conductivity. Thereby it is a good candidate membrane material for hydrogen separation from synthesis gas in a fossil pre-combustion power plant. This work shows a material optimization by substitution targeted to clearly enhance the mixed conductivity and thereby the hydrogen flow through the LWO membrane. The first part of the work shows the synthesis and characterization of unsubstituted LWO. It points out that monophase LWO powder can be reproducibly synthesized. The La/W-ratio has to be considerably smaller than the nominal ratio of La/W = 6.0. It also depends on the used sintering conditions. Different relevant properties of LWO like stability in conditions close to application, thermal expansion, sintering behavior or microstructure were determined. Furthermore, the electrical conductivity of the material was investigated. LWO exhibits a prevailing protonic conductivity up to 750 C in wet atmospheres. Under dry atmospheres n-type conductivity was dominating. Oxygen ion and n-type conductivity dominated in wet and dry atmospheres above 750 C. The main part of the work is concerned with the development of new LWO based materials by substitutions. The aim is to achieve an improved mixed protonic electronic conductivity. Substitution elements for lanthanum side were Mg, Ca, Sr, Ba, Ce, Nd, Tb, Y and Al, while for the tungsten side Mo, Re and Ir were used. The total conductivity of the developed materials was investigated and compared to that of the unsubstituted LWO. The substitution of lanthanum led to no appreciable enhancement of the conductivity whereas the substitution of tungsten with 20 mol% molybdenum or 20 mol% rhenium clearly improved it. This caused a hydrogen flow about seven times higher for 20 mol% molybdenum- and about ten times higher for 20 mol% rhenium-substituted LWO in comparison with the unsubstituted LWO at 700 C. In the last part of the

18 CFR 141.51 - FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report.

Science.gov (United States)

2010-04-01

..., Annual Electric Balancing Authority Area and Planning Area Report. 141.51 Section 141.51 Conservation of...) § 141.51 FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report. (a) Who... Policies Act, 16 U.S.C. 2602, operating a balancing authority area, and any group of electric utilities...

miR-141-3p inhibits human stromal (mesenchymal) stem cell proliferation and differentiation

DEFF Research Database (Denmark)

Qiu, Weimin; Kassem, Moustapha

2014-01-01

Wnt signaling determines human stromal (mesenchymal) stem cell (hMSC) differentiation fate into the osteoblast or adipocyte lineage. microRNAs (miRNAs) are small RNA molecules of 21-25 nucleotides that regulate many aspects of osteoblast biology. Thus, we examined miRNAs regulated by Wnt signaling...... in hMSC. We identified miRNA (miR)-141-3p as a Wnt target which in turn inhibited Wnt signaling. Moreover, miR-141-3p inhibited hMSC proliferation by arresting cells at the G1 phase of the cell cycle. miR-141-3p inhibited osteoblast differentiation of hMSC as evidenced by reduced alkaline phosphatase...... activity, gene expression and in vitro mineralized matrix formation. Bioinformatic studies, Western blot analysis and 3'UTR reporter assay demonstrated that cell division cycle 25A (CDC25A) is a direct target of miR-141-3p. siRNA-mediated knock-down of CDC25A inhibited hMSC proliferation and osteoblast...

40 CFR 141.75 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.75... reporting requirements, as appropriate, until filtration is in place. A public water system that uses a ground water source under the direct influence of surface water and does not provide filtration treatment...

40 CFR 141.175 - Reporting and recordkeeping requirements.

Science.gov (United States)

2010-07-01

...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and... representative samples of filtered water in a system using conventional filtration treatment or direct filtration... addition to the reporting and recordkeeping requirements in § 141.75, a public water system subject to the...

Gene-Targeted Mice with the Human Troponin T R141W Mutation Develop Dilated Cardiomyopathy with Calcium Desensitization.

Directory of Open Access Journals (Sweden)

Mohun Ramratnam

Full Text Available Most studies of the mechanisms leading to hereditary dilated cardiomyopathy (DCM have been performed in reconstituted in vitro systems. Genetically engineered murine models offer the opportunity to dissect these mechanisms in vivo. We generated a gene-targeted knock-in murine model of the autosomal dominant Arg141Trp (R141W mutation in Tnnt2, which was first described in a human family with DCM. Mice heterozygous for the mutation (Tnnt2R141W/+ recapitulated the human phenotype, developing left ventricular dilation and reduced contractility. There was a gene dosage effect, so that the phenotype in Tnnt2R141W/+mice was attenuated by transgenic overexpression of wildtype Tnnt2 mRNA transcript. Male mice exhibited poorer survival than females. Biomechanical studies on skinned fibers from Tnnt2R141W/+ hearts showed a significant decrease in pCa50 (-log[Ca2+] required for generation of 50% of maximal force relative to wildtype hearts, indicating Ca2+ desensitization. Optical mapping studies of Langendorff-perfused Tnnt2R141W/+ hearts showed marked increases in diastolic and peak systolic intracellular Ca2+ ([Ca2+]i, and prolonged systolic rise and diastolic fall of [Ca2+]i. Perfused Tnnt2R141W/+ hearts had slower intrinsic rates in sinus rhythm and reduced peak heart rates in response to isoproterenol. Tnnt2R141W/+ hearts exhibited a reduction in phosphorylated phospholamban relative to wildtype mice. However, crossing Tnnt2R141W/+ mice with phospholamban knockout (Pln-/- mice, which exhibit increased Ca2+ transients and contractility, had no effect on the DCM phenotype. We conclude that the Tnnt2 R141W mutation causes a Ca2+ desensitization and mice adapt by increasing Ca2+-transient amplitudes, which impairs Ca2+ handling dynamics, metabolism and responses to β-adrenergic activation.

Polarization study on doped lanthanum gallate electrolyte using impedance spectroscopy

Science.gov (United States)

Gong, Wenquan; Gopalan, Srikanth; Pal, Uday B.

2004-06-01

Alternating current complex impedance spectroscopy studies were conducted on symmetrical cells of the type [gas, electrode/La1-x Sr x Ga1-y Mg y O3 (LSGM) electrolyte/electrode, gas]. The electrode materials were slurry-coated on both sides of the LSGM electrolyte support. The electrodes selected for this investigation are candidate materials for solid oxide fuel cell (SOFC) electrodes. Cathode materials include La1-x Sr x MnO3 (LSM), La1-x Sr x Co y Fe1-y O3 (LSCF), a two-phase particulate composite consisting of LSM and doped-lanthanum gallate (LSGM), and LSCF + LSGM. Pt metal electrodes were also used for the purpose of comparison. Anode material investigated was the Ni + Ce0.85Gd0.15O2 composite. The study revealed important details pertaining to the charge-transfer reactions that occur in such electrodes. The information obtained can be used to design electrodes for intermediate temperature SOFCs based on LSGM electrolytes.

Molten salt synthesis of lead lanthanum zirconate titanate ceramic powders

International Nuclear Information System (INIS)

Cai Zongying; Xing Xianran; Li Lu; Xu Yeming

2008-01-01

Lead lanthanum zirconate titanate (Pb 0.95 La 0.03 )(Zr 0.52 Ti 0.48 )O 3 (PLZT) was synthesized by one step molten salt method with the starting materials of PbC 2 O 4 , La 2 O 3 , ZrO(NO 3 ) 2 .2H 2 O and TiO 2 in the NaCl-KCl eutectic mixtures in the temperature range of 700-1000 deg. C. The single phase of (Pb 0.95 La 0.03 )(Zr 0.52 Ti 0.48 )O 3 powders was prepared at a temperature as low as 850 deg. C for 5 h. The effects of process parameters, such as soaking temperature and time, salt species, and the amount of flux with respect to the starting materials were investigated. The growth process of the PLZT particles in the molten salt undergoes a transition from a diffusion controlled mechanism to an interfacial reaction controlled mechanism at 900 deg. C

Microstructural development and characterization of lanthanum chromite-based ceramics to application in solid oxide fuel cells; Desenvolvimento microestrutural e caracterizacao de ceramicas a base de cromita de lantanio para aplicacao em celulas a combustivel de oxido solido

Energy Technology Data Exchange (ETDEWEB)

Oliveira, R.N.; Furtado, J.G. de M.; Soares, C.M.; Serra, E.T. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)], e-mail: rnunes@cepel.br

2006-07-01

This work has for objective to investigate and to characterize the microstructural development of lanthanum chromite-based ceramics (LaCrO{sub 3}) doped with earth alkaline metals, correlating the microstructural parameters (mainly the densification level) and processing parameters with the electrothermal properties reached. Lanthanum chromite-based ceramic systems doped with earth-alkaline metals (Ca, Mg and Sr) had been produced from respective metallic nitrates by solid state reactions process. The phase compositions were evaluated by X-ray diffraction and the densification level by Archimedes method. The microstructural characterization was effected by scanning electron microscopy, energy dispersive X-ray spectroscopy and thermal analysis techniques. Electrical tests were used to evaluate the electrical conductivity of the studied ceramics. The obtained results corroborate the literature comments concerning the difficulty of lanthanum chromite-based ceramics with high densification level and evidence the great influence of the nature of the dopants on the sintering mechanism and the microstructural and electric characteristics of the produced ceramics. The best ones results, in terms of densification and electrical conductivity, had been gotten through multiple doping with calcium and strontium, and in sintering temperature conditions lower that the normally considered to pure or monodoped lanthanum chromite-based ceramics. (author)

Linear Optical Properties of Zinc Borotellurite Glass Doped with Lanthanum Oxide Nanoparticles for Optoelectronic and Photonic Application

Directory of Open Access Journals (Sweden)

Faznny Mohd Fudzi

2017-01-01

Full Text Available Enhancing the optical properties of glasses for the sake of optical application in various fields is an ongoing challenge in materials science and technology. Thus, the optical properties of zinc borotellurite glass doped with lanthanum oxide nanoparticles (La2O3 NPs with the chemical composition of {[(TeO20.7(B2O30.3]0.7(ZnO0.3}1−x (La2O3 NPsx, where x = 0.01, 0.02, 0.03, 0.04, and 0.05 molar fraction, have been investigated. Characterization techniques such as x-ray diffraction, Fourier Transform Infrared Spectroscopy, and Ultraviolet-Visible Spectroscopy are employed to yield the structural properties and optical parameter of the glass. The amorphous nature of the fabricated glasses is confirmed with the presence of a broad hump via XRD diffraction pattern. The decreasing amount of high polarizable nonbridging oxygen as the concentration of La2O3 NPs increases has contributed to the increasing trend of energy band gap in the range of 2.70 to 3.52 eV and decreasing value of refractive index between 2.34 and 2.48. The fabricated glasses that have a higher refractive index than the widely used fiber material, pure silica glass, indicate that zinc borotellurite glass doped with lanthanum nanoparticles is a promising material to be applied as optical fibers.

25 CFR 141.23 - Posted statement of ownership.

Science.gov (United States)

2010-04-01

... legible to customers stating the form of the business entity, the names and addresses of all other... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.23 Posted statement of...

25 CFR 141.17 - Health and sanitation requirements.

Science.gov (United States)

2010-04-01

... handling any food sold by a reservation business. (d) Any person whom the Service Unit Director of the... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.17 Health and sanitation...

Bio-accumulation of lanthanum from lanthanum modified bentonite treatments in lake restoration.

Science.gov (United States)

Waajen, G; van Oosterhout, F; Lürling, M

2017-11-01

Lanthanum (La) modified bentonite (LMB) is one of the available mitigating agents used for the reduction of the phosphorus (P) recycling in eutrophic lakes. The potential toxicity of the La from LMB to aquatic organisms is a matter of concern. In this study the accumulation of La was investigated in the macrophyte Elodea nuttallii, in chironomid larvae and in several fish species during periods up to five years following in situ LMB applications. The application of LMB increased the La concentration of exposed plants and animals. During the first growing season following LMB applications, the La content of E. nuttallii increased 78 fold (3.98-310.68 μg La g -1 DW) to 127 fold (2.46-311.44 μg La g -1 ). During the second growing season following application, the La content decreased but was still raised compared to plants that had not been exposed. The La content of chironomids was doubled in the two years following LMB application, although the increase was not significant. Raised La concentrations in fish liver, bone, muscle and skin were observed two and five years following to LMB application. Liver tissues showed the highest La increase, ranging from 6 fold (0.046-0.285 μg La g -1 DW) to ∼20 fold (0.080-1.886 μg La g -1 , and 0.122-2.109 μg La g -1 ) two years following application and from 6 fold (0.046-0.262 μg La g -1 ) to 13 fold (0.013-0.167 μg La g -1 ) after five years in pelagic and littoral fish. The La content of the liver from Anguilla anguilla (eel) had increased 94 fold (0.034-3.176 μg La g -1 ) two years and 133 fold (0.034-4.538 μg La g -1 ) five years following LMB application. No acute and chronic effects of La accumulation were observed and human health risks are considered negligible. We advocate the long-term study of effects of La accumulation following future LMB applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

27 CFR 25.141 - Barrels and kegs.

Science.gov (United States)

2010-04-01

... OF THE TREASURY LIQUORS BEER Marks, Brands, and Labels § 25.141 Barrels and kegs. (a) General... shown on the bung or on the tap cover, or on a label securely affixed to each barrel or keg, the place... production: (i) May be shown as the only location on the bung, or on the tap cover, or on a separate label...

Lanthanum titanium perovskite compound: Thin film deposition and high frequency dielectric characterization

International Nuclear Information System (INIS)

Le Paven, C.; Lu, Y.; Nguyen, H.V.; Benzerga, R.; Le Gendre, L.; Rioual, S.; Benzegoutta, D.; Tessier, F.; Cheviré, F.

2014-01-01

Perovskite lanthanum titanium oxide thin films were deposited on (001) MgO, (001) LaAlO 3 and Pt(111)/TiO 2 /SiO 2 /(001)Si substrates by RF magnetron sputtering, using a La 2 Ti 2 O 7 homemade target sputtered under oxygen reactive plasma. The films deposited at 800 °C display a crystalline growth different than those reported on monoclinic ferroelectric La 2 Ti 2 O 7 films. X-ray photoelectron spectroscopy analysis shows the presence of titanium as Ti 4+ ions, with no trace of Ti 3+ , and provides a La/Ti ratio of 1.02. The depositions being performed from a La 2 Ti 2 O 7 target under oxygen rich plasma, the same composition (La 2 Ti 2 O 7 ) is proposed for the deposited films, with an unusual orthorhombic cell and Cmc2 1 space group. The films have a textured growth on MgO and Pt/Si substrates, and are epitaxially grown on LaAlO 3 substrate. The dielectric characterization displays stable values of the dielectric constant and of the losses in the frequency range [0.1–20] GHz. No variation of the dielectric constant has been observed when a DC electric field up to 250 kV/cm was applied, which does not match a classical ferroelectric behavior at high frequencies and room temperature for the proposed La 2 Ti 2 O 7 orthorhombic phase. At 10 GHz and room temperature, the dielectric constant of the obtained La 2 Ti 2 O 7 films is ε ∼ 60 and the losses are low (tanδ < 0.02). - Highlights: • Lanthanum titanium oxide films were deposited by reactive magnetron sputtering. • A La 2 Ti 2 O 7 chemical composition is proposed, with an unusual orthorhombic cell. • At 10 GHz, the dielectric losses are lower than 0.02. • No variation of the dielectric constant is observed under DC electric biasing

40 CFR 141.71 - Criteria for avoiding filtration.

Science.gov (United States)

2010-07-01

... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.71 Criteria for avoiding filtration. A public water system that uses a surface water source must meet all of...)(C)(iii), that filtration is required. A public water system that uses a ground water source under...

Evaluating of electronic structure of Lanthanum chromite under doping of divalent ion using density functional theory

International Nuclear Information System (INIS)

Saievar, E.; Gharleghi, A.

2006-01-01

Doping Calcium in Lanthanum site of LaCrO 3 compound increasing the density of states in valance band and decreasing the band gap width because of increases of S electrons in valance band and variety of interaction energies from Cr +3 -Cr +4 couple in valance band. We have used Wien2k software for evaluating this mechanisms. Using of 0.25 percent of dopant and a kind of the space group of cell, let us to use one cell in calculations. We have used GGA approximation in this calculations.

Lanthanum(III) and praseodymium(III) complexes with bidentate and tetradentate Schiff base ligands containing indole ring

International Nuclear Information System (INIS)

Rai, Anita; Sengupta, Soumitra Kumar; Pandey, Om Prakash

2000-01-01

Complexes of lanthanum(III) and praseodymium(III) with Schiff bases, prepared from isatin with aniline, 4-chloroaniline, 2- bromoaniline, 2-nitroaniline (Hl), ethylenediamine, o- phenylenediamine and 4-methyl-o-phenylenediamine (H 2 L') have been synthesised and their physico-chemical properties investigated using elemental analysis, molar conductivities, magnetic susceptibility measurements and spectral (visible, infrared and 1 H NMR) data. The Schiff bases HL bind in a bidentate manner while schiff bases H 2 L' bind in a tetradentate manner. The probable structures of the complexes are proposed. (author)

40 CFR 141.81 - Applicability of corrosion control treatment steps to small, medium-size and large water systems.

Science.gov (United States)

2010-07-01

... treatment steps to small, medium-size and large water systems. 141.81 Section 141.81 Protection of... WATER REGULATIONS Control of Lead and Copper § 141.81 Applicability of corrosion control treatment steps...). (ii) A report explaining the test methods used by the water system to evaluate the corrosion control...

40 CFR 141.26 - Monitoring frequency and compliance requirements for radionuclides in community water systems.

Science.gov (United States)

2010-07-01

... identified in the finished water. (iii) Annual monitoring for strontium-90 and tritium shall be conducted by... requirements for radionuclides in community water systems. 141.26 Section 141.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER...

N-acetylcysteine Ameliorates Prostatitis via miR-141 Regulating Keap1/Nrf2 Signaling.

Science.gov (United States)

Wang, Liang-Liang; Huang, Yu-Hua; Yan, Chun-Yin; Wei, Xue-Dong; Hou, Jian-Quan; Pu, Jin-Xian; Lv, Jin-Xing

2016-04-01

Chronic prostatitis was the most common type of prostatitis and oxidative stress was reported to be highly elevated in prostatitis patients. In this study, we determined the effect of N-acetylcysteine (NAC) on prostatitis and the molecular mechanism involved in it. Male Sprague-Dawley rats were divided into three groups: control group (group A, n = 20), carrageenan-induced chronic nonbacterial prostatitis (CNP) model group (group B, n = 20), and carrageenan-induced CNP model group with NAC injection (group C, n = 20). Eye score, locomotion score, inflammatory cell count, cyclooxygenase 2 (COX2) expression, and Evans blue were compared in these three groups. The expression of miR-141 was determined by quantitative real-time PCR (qRT-PCR). Moreover, protein expressions of Kelch-like ECH-associated protein-1 (Keap1) and nuclear factor erythroid-2 related factor 2 (Nrf2) and its target genes were examined by Western blot. Luciferase reporter assay was performed in RWPE-1 cells transfected miR-141 mimic or inhibitor and the plasmid carrying 3'-UTR of Keap1. The value of eye score, locomotion score, inflammatory cell count, and Evans blue were significantly decreased in group C, as well as the expression of COX2, when comparing to that of group B. These results indicated that NAC relieved the carrageenan-induced CNP. Further, we found that NAC increased the expression of miR-141 and activated the Keap1/Nrf2 signaling. Luciferase reporter assay revealed that miR-141 mimic could suppress the activity of Keap1 and stimulate the downstream target genes of Nrf2. In addition, miR-141 inhibitor could reduce the effect of NAC on prostatitis. NAC ameliorates the carrageenan-induced prostatitis and prostate inflammation pain through miR-141 regulating Keap1/Nrf2 signaling.

40 CFR 80.141 - Interim detergent gasoline program.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Interim detergent gasoline program. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.141 Interim detergent gasoline... apply to: (i) All gasoline sold or transferred to a party who sells or transfers gasoline to the...

19 CFR 141.18 - Entry by nonresident corporation.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Entry by nonresident corporation. 141.18 Section....18 Entry by nonresident corporation. A nonresident corporation (i.e., one which is not incorporated... entry is located who is authorized to accept service of process against that corporation or, in the case...

Phytotoxic Effects of Lanthanum Oxide Nanoparticles on Maize (Zea mays L.)

Science.gov (United States)

Liu, Yinglin; Xu, Lina; Dai, Yanhui

2018-02-01

The use of lanthanum oxide nanoparticles (La2O3 NPs) in life products have increased dramatically in the past decades, which are inevitable released into natural environment. In this study, we determined the phytotoxicity of La2O3 NPs to maize (Zea mays L.) grown in one-fourth strength Hoagland solution. After being exposed for two weeks, the biomass, roots length and the relative chlorophyll content were measured. La2O3 NPs had phytotoxicity to maize at 5 mg/L. La2O3 NPs decreased shoot biomass (≥10 mg/L), the root biomass and length (≥5 mg/L). Moreover, La2O3 NPs had adverse effects on the chlorophyll content (≥10 mg/L). The decreased chlorophyll content may reduce net photosynthetic rate. This research offers vital information about the phytotoxicity of La2O3 NPs.

Carbon doped lanthanum aluminate (LaAlO3:C) UV thermoluminescent properties synthesized by solid state reaction with three different mixing methodologies

International Nuclear Information System (INIS)

Alves, N.

2017-01-01

In this work we discuss the thermoluminescent (TL) response for LaAlO 3 :C crystals grown by using three different combinations of Al 2 O 3 , La 2 O 3 and carbon atoms during the synthesis process. Recently, LaAlO 3 single crystals, co-doped with Ce 3+ and Dy 3+ rare earth trivalent ions and grown under hydrothermal conditions, have been reported to show high thermoluminescent response (TL) when exposed to low levels of ultraviolet radiation (UVR). However, undoped LaAlO 3 synthesized by solid state reaction method from the 1:1 mixture of aluminum and lanthanum oxide under reducing atmosphere revealed to have still higher thermoluminescent sensitivity to UV photon fields than the co-doped with Ce 3+ and Dy 3+ . It is well known that carbon doped aluminum oxide monocrystals have excellent TL and photoluminescent response properties for X-rays, UV and gamma radiation fields. Thus, we conducted three different syntheses of LaAlO 3 by the solid state reaction method, doping the mixture with carbon. The lanthanum aluminate polycrystals were synthesized from the 1:1 mixture of aluminum and lanthanum oxide, adding 0.1wt.% carbon and annealed at 1700°C for two hours in hydrogen atmosphere. The X-ray diffraction analysis revealed the formation of rhombohedral LaAlO 3 crystallographic phase, however a small percentage (15%) of Al 2 O 3 has been also identified. The UV-Vis absorbance spectra were obtained and F and F + - center were ascribed. The UV irradiations were carried out using a commercial 8W UV lamp. Thermoluminescence measurements were performed at a Harshaw 4500 TL reader. All compositions investigated have shown high TL sensitivity to UVR. (author)

Ductility of Mo–12Si–8.5B alloys doped with lanthanum oxide by the liquid–liquid doping method

Energy Technology Data Exchange (ETDEWEB)

Li, Wenhu [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); School of Materials Science & Engineering, Shaanxi University of Technology, Hanzhong 723000 (China); Zhang, Guojun, E-mail: zhangguojun@xaut.edu.cn [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); Wang, Shixiong [School of Materials Science & Engineering, Xi’an University of Technology, Xi’an 710048 (China); Li, Bin; Sun, Jun [State Key Laboratory for Mechanical Behavior of Materials, Xi’an Jiaotong University, Xi’an 710049 (China)

2015-09-05

Highlights: • Alloys doping lanthanum oxide by L–L doped method were prepared by hot pressing. • The compression strength of alloys are superior. • The fracture toughness of alloys is improved by L–L doped method. - Abstract: Mo–12Si–8.5B (Mo–Si–B) alloys doped with different mass fractions (0.3 wt%, 0.6 wt%, and 0.9 wt%) of lanthanum oxide (La{sub 2}O{sub 3}) were prepared by liquid–liquid (L–L) doping, mechanical alloying and hot pressing sintering techniques. The observation of the microstructures of the Mo–Si–B alloys reveals that the grain sizes of the alloys were refined with the increase in La{sub 2}O{sub 3} doping. The fracture toughness values of the alloys of over 10 MPa m{sup 1/2} reveal that the addition of La{sub 2}O{sub 3} via the L–L doping method can obviously improve the alloy fracture toughness compared to the alloys doped with La{sub 2}O{sub 3} via the solid–solid (S–S) doping method. In addition, compression tests indicate that the compression strength of the alloys was improved compared to Mo–12Si–8.5B alloys.

40 CFR 141.563 - What follow-up action is my system required to take based on continuous turbidity monitoring?

Science.gov (United States)

2010-07-01

... required to take based on continuous turbidity monitoring? 141.563 Section 141.563 Protection of... Individual Filter Turbidity Requirements § 141.563 What follow-up action is my system required to take based on continuous turbidity monitoring? Follow-up action is required according to the following tables...

Molecular dynamics study of the coordination sphere of trivalent lanthanum in a highly concentrated LiCl aqueous solution: A combined classical and ab initio approach

International Nuclear Information System (INIS)

Vuilleumier, R.; Petit, L.; Maldivi, P.; Adamo, C.

2008-01-01

The first coordination sphere of trivalent lanthanum in a highly concentrated (14 M) lithium chloride solution is studied with a combination of classical molecular dynamics and density functional theory based first principle molecular dynamics. This method enables us to obtain a solvation shell of La 3+ containing 2 chloride ions and 6 water molecules. After refinement using first principle molecular dynamics, the resulting cation-water and cation-anion distances are in very good agreement with experiment. The 2 Cl - and the 6 water molecules arrange in a square anti-prism around La 3+ . Exchange of water molecules was also observed in the first-principle simulation, with an intermediate structure comprising 7 water molecules stable for 2.5 ps. Finally, evaluation of dipole moments using maximally localized Wannier functions shows a substantial polarization of the chloride anions and the water molecules in the first solvation shell of trivalent lanthanum. (authors)

Selective dehydration of bio-ethanol to ethylene catalyzed by lanthanum-phosphorous-modified HZSM-5: influence of the fusel.

Science.gov (United States)

Hu, Yaochi; Zhan, Nina; Dou, Chang; Huang, He; Han, Yuwang; Yu, Dinghua; Hu, Yi

2010-11-01

Bio-ethanol dehydration to ethylene is an attractive alternative to oil-based ethylene. The influence of fusel, main byproducts in the fermentation process of bio-ethanol production, on the bio-ethanol dehydration should not be ignored. We studied the catalytic dehydration of bio-ethanol to ethylene over parent and modified HZSM-5 at 250°C, with weight hourly space velocity (WHSV) equal to 2.0/h. The influences of a series of fusel, such as isopropanol, isobutanol and isopentanol, on the ethanol dehydration over the catalysts were investigated. The 0.5%La-2%PHZSM-5 catalyst exhibited higher ethanol conversion (100%), ethylene selectivity (99%), and especially enhanced stability (more than 70 h) than the parent and other modified HZSM-5. We demonstrated that the introduction of lanthanum and phosphorous to HZSM-5 could weaken the negative influence of fusel on the formation of ethylene. The physicochemical properties of the catalysts were characterized by ammonia temperature-programmed desorption (NH(3)-TPD), nitrogen adsorption and thermogravimetry (TG)/differential thermogravimetry (DTG)/differential thermal analysis (DTA) (TG/DTG/DTA) techniques. The results indicated that the introduction of lanthanum and phosphorous to HZSM-5 could inhibit the formation of coking during the ethanol dehydration to ethylene in the presence of fusel. The development of an efficient catalyst is one of the key technologies for the industrialization of bio-ethylene.

41 CFR 105-53.141 - Office of Policy Analysis.

Science.gov (United States)

2010-07-01

... Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 53-STATEMENT OF ORGANIZATION AND FUNCTIONS Central Offices § 105-53.141 Office of Policy Analysis. The Office of Policy Analysis, headed by..., independent, objective information concerning management policies and programs, and technical and analytical...

Lanthanum triflate triggered synthesis of tetrahydroquinazolinone derivatives of N-allyl quinolone and their biological assessment

Directory of Open Access Journals (Sweden)

Jardosh Hardik H.

2012-01-01

Full Text Available A series of 24 derivatives of tetrahydroquinazolinone has been synthesized by one-pot cyclocondensation reaction of N-allyl quinolones, cyclic β-diketones and (thiourea/N-phenylthiourea in presence of lanthanum triflate catalyst. This methodology allowed us to achieve the products in excellent yield by stirring at room temperature. All the synthesized compounds were investigated against a representative panel of pathogenic strains using broth microdilution MIC (minimum inhibitory concentration method for their in vitro antimicrobial activity. Amongst these sets of heterocyclic compounds 5h, 6b, 6h, 5f, 5l, 5n and 6g found to have admirable activity.

Estimation of cerium and lanthanum content in core material of high intensity carbon arc electrodes by x-ray fluorescence method

International Nuclear Information System (INIS)

Nagpal, K.C.; Bhavalkar, R.H.

1977-01-01

The X-ray fluorescence method has been used to determine the weight percentages of cerium and lanthanum in the core material of high intensity carbon arc electrodes from the calibration curves plotted between the weight percentages of these elements and the peak-intensity ratios of CeLsub(α1), and LaLsub(α1) peaks to the neighbouring peak SnLsub(α1) due to an internal standard element. (author)

Influence of crystal phases on electro-optic properties of epitaxially grown lanthanum-modified lead zirconate titanate films

Science.gov (United States)

Masuda, Shin; Seki, Atsushi; Masuda, Yoichiro

2010-02-01

We describe here how we have improved the crystal qualities and controlled the crystal phase of the lanthanum-modified lead zirconate titanate (PLZT) film without changing the composition ratio using an oxygen-pressure crystallization process. A PLZT film deposited on a SrTiO3 substrate with the largest electro-optic (EO) coefficient of 498 pm/V has been achieved by controlling the crystal phase of the film. Additionally, a fatigue-free lead zirconate titanate (PZT) capacitor with platinum electrodes has been realized by reducing the oxygen vacancies in the films.

Deposition of Lanthanum Strontium Cobalt Ferrite (LSCF) Using Suspension Plasma Spraying for Oxygen Transport Membrane Applications

Science.gov (United States)

Fan, E. S. C.; Kesler, O.

2015-08-01

Suspension plasma spray deposition was utilized to fabricate dense lanthanum strontium cobalt ferrite oxygen separation membranes (OSMs) on porous metal substrates for mechanical support. The as-sprayed membranes had negligible and/or reversible material decomposition. At the longer stand-off distance (80 mm), smooth and dense membranes could be manufactured using a plasma with power below approximately 81 kW. Moreover, a membrane of 55 μm was observed to have very low gas leakage rates desirable for OSM applications. This thickness could potentially be decreased further to improve oxygen diffusion by using metal substrates with finer surface pores.

Lanthanum-silicon-substituted hydroxyapatite: Mechanochemical synthesis and prospects for medical applications

Energy Technology Data Exchange (ETDEWEB)

Chaikina, M. V., E-mail: chaikinam@solid.nsc.ru; Bulina, N. V., E-mail: bulina@solid.nsc.ru; Prosanov, I. Yu., E-mail: prosanov@mail.ru [Institute of Solid State Chemistry and Mechanochemistry SB RAS, Kutateladze Street 18, Novosibirsk, 630128 (Russian Federation); Komarova, E. G., E-mail: katerina@ispms.tsc.ru; Sharkeev, Yu. P., E-mail: sharkeev@ispms.tsc.ru [Institute of Strength Physics and Materials Science SB RAS, Academicheskii Pr. 2/4, Tomsk, 634055 (Russian Federation)

2016-08-02

The paper presents the results of mechanochemical synthesis of hydroxyapatite (HAP) with simultaneous substitutions of lanthanum (La{sup 3+}) for calcium ions and silicate ((SiO{sub 4}){sup 4−}-group) for the phosphate group with the substituent concentrations in the range 0.2–2.0 mol per HAP mol. The use of Si-substituted HAP as a coating material promotes accelerated osteosynthesis and osteointegration of implants into the bone tissue. The replacement of calcium ions by La{sup 3+} in the HAP structure plays an antimicrobial role preventing inflammatory processes. Annealing-induced variations in the lattice parameters of synthesized samples indicate the substituent incorporation into the HAP structure. It is known that complex compounds with lanthanides are used for cancer chemotherapy. In particular, La plays a key role in the course of treatment of injured defects of bone tissue. In addition, La-substituted HAP can be used for filling bone defects and coating implants in postoperational areas affected by bone cancer.

Effects of lanthanum and acid rain stress on the bio-sequestration of lanthanum in phytoliths in germinated rice seeds

Science.gov (United States)

Si, Yong; Wang, Lihong; Huang, Xiaohua

2018-01-01

REEs in the environment can be absorbed by plants and sequestered by plant phytoliths. Acid rain can directly or indirectly affect plant physiological functions. Currently, the effects of REEs and acid rain on phytolith-REEs complex in plants are not yet fully understood. In this study, a high-silicon accumulation crop, rice (Oryza sativa L.), was selected as a representative of plants, and orthogonal experiments were conducted under various levels of lanthanum [La(III)] and pH. The results showed that various La(III) concentrations could significantly improve the efficiency and sequestration of phytolith La(III) in germinated rice seeds. A pH of 4.5 promoted phytolith La(III) sequestration, while a pH of 3.5 inhibited sequestration. Compared with the single treatment with La(III), the combination of La(III) and acid rain inhibited the efficiency and sequestration of phytolith La(III). Correlation analysis showed that the efficiency of phytolith La(III) sequestration had no correlation with the production of phytolith but was closely correlated with the sequestration of phytolith La(III) and the physiological changes of germinated rice seeds. Phytolith morphology was an important factor affecting phytolith La(III) sequestration in germinated rice seeds, and the effect of tubes on sequestration was more significant than that of dumbbells. This study demonstrated that the formation of the phytolith and La(III) complex could be affected by exogenous La(III) and acid rain in germinated rice seeds. PMID:29763463

Energy transfer driven tunable emission of Tb/Eu co-doped lanthanum molybdate nanophosphors

Science.gov (United States)

Thomas, Kukku; Alexander, Dinu; Sisira, S.; Gopi, Subash; Biju, P. R.; Unnikrishnan, N. V.; Joseph, Cyriac

2018-06-01

Tb3+/Eu3+ co-doped lanthanum molybdate nanophosphors were synthesized by conventional co-precipitation method. The Powder X-ray diffractogram revealed the formation of highly crystalline tetragonal nanocrystals with space group I41/a and the detailed analysis of the small variation of lattice parameters with Tb/Eu co-doping on the host lattice were carried out based on the ionic radii of the dopants. The FTIR spectra is employed to identify the fundamental vibrational modes in La2-x-y (MoO4)3:xTb, yEu nanocrystals. The formation of nanocrystals by oriented attachment was recognized from the HR TEM images and the d-spacing calculated was in accordance with that corresponding to highest intensity diffraction peak in the XRD patterns. The constituent elements present in the samples were identified with the aid of EDAX and elemental mapping analysis. The broad Mo6+- O2- CTB and the sharp excitation peaks of Tb and Eu identified from the UV-Vis absorption spectra facilitates the suitability of exciting the phosphors effectively over NUV and visible region of the spectra. The possibility of energy transfer from host to Tb3+/Eu3+ ions and from Tb3+ to Eu3+ ions were confirmed from the PL excitation spectra monitoring 5D0→7F2 transition of Eu3+ ions around 615 nm. The correlated analysis of PL emission spectra, life time measurements and CIE diagram, upon different excitation channels elucidate the excellent luminescent properties of La2-x-y (MoO4)3:xTb, yEu nanophosphors with tunable emission colours in a wide range varying from yellow green region to reddish orange region and the efficient energy transfer from Tb3+ to Eu3+ ions in lanthanum molybdate host lattice. The Tb→Eu energy transfer efficiency and probability were calculated from the decay measurements and the values were found to be satisfactory for exploiting the prepared nanophosphors for the development of multifunctional luminescent nanophosphors.

Lanthanum hexaboride as advanced structural refiner/getter in TiAl-based refractory intermetallics

Energy Technology Data Exchange (ETDEWEB)

Kartavykh, A.V., E-mail: karta@korolev-net.ru [Technological Institute for Superhard and Novel Carbon Materials (TISNCM), 7a Centralnaya str., 142190 Troitsk, Moscow (Russian Federation); National University of Science and Technology “MISIS”, Leninsky pr. 4, 119049 Moscow (Russian Federation); Asnis, E.A.; Piskun, N.V.; Statkevich, I.I. [The E.O. Paton Electric Welding Institute, 11 Bozhenko str., 03680 Kyiv (Ukraine); Gorshenkov, M.V.; Tcherdyntsev, V.V. [National University of Science and Technology “MISIS”, Leninsky pr. 4, 119049 Moscow (Russian Federation)

2014-03-05

Highlights: • Fist application of LaB{sub 6} additive in TiAl-based intermetallics casting. • Pilot synthesis/casting and study of selected TiAl(Nb,Cr,Zr)B,La alloys set. • Dual effect observed: phase structure refinement and oxygen impurity removal. • Co-precipitation of TiB and La{sub 2}O{sub 3} in melt: 2LaB{sub 6} + 12Ti + 3O → 12TiB↓ + La{sub 2}O{sub 3}↓. • Features of structure refinement and oxygen gettering mechanisms reported. -- Abstract: The work is aimed at the study of the formation and refinement of microstructure appearing in the solidifying refractory TiAl-based intermetallics being inoculated with precise boron addition. The novelty of research consists in test application of lanthanum hexaboride (LaB{sub 6}) ligature within semi-continuous electron beam casting process of selected alloys. Two ingots with nominal compositions Ti–44Al–5Nb–2Cr–1.5Zr–0.4B–0.07La and Ti–44Al–5Nb–1Cr–1.5Zr–1B–0.17La (at.%) have been synthesized and cast along with the reference alloy Ti–44Al–5Nb–3Cr–1.5Zr. Their comparative examination suggests (i) essential microstructural phase refinement effect coupled with (ii) threefold/fourfold decrease of background content of undesirable residual oxygen impurity in both alloys containing LaB{sub 6}. This advanced dual activity (i–ii) of LaB{sub 6} is explained by its complete dissolution, dissociation and following re-precipitation of effective Ti-based monoboride nucleants of orthorhombic B27 structure, those being accompanied by strong internal gettering of dissolved oxygen from the melt and from boride-inoculated solid α{sub 2}-Ti{sub 3}Al phase with liberated elemental lanthanum. The phase composition and structure of cast alloys; state and characterization of newly precipitated TiB boride; features of La{sub 2}O{sub 3} micro/nano-dimensional precipitation and oxygen gettering mechanism are reported and discussed.

Structural stability of the smectite-doped lanthanum under high pressures and high temperatures

International Nuclear Information System (INIS)

Stefani, Vicente Fiorini

2012-01-01

Smectites are phyllosilicates that have a tetrahedron: octahedron structure ratio of 2:1, with high cation exchange capacity (CEC) in the interlayers. For these and other features, smectites have been used in many parts of the world as secondary barriers with the goal of containing a possible leak of radioactive elements in final disposal facilities for radioactive waste through cation exchange. Our aim in this work is to reach the cation exchange in calcium montmorillonite (smectite dioctahedral) by lanthanum to simulate trivalent radionuclides and to study the stability of this structure under high pressure and high temperature. To achieve high pressure it was used two different technique: DAC (Diamond Anvil Cell), achieving pressures up to 12GPa at room temperature and hydraulic press with a toroidal chamber profile to achieve pressures up to 7,7GPa and temperatures up to 900 degree C. The heating is achieved simultaneously by an electric system coupled in the hydraulic press. The outcomes show that the smectite structure doped with lanthanum remains stable under 12GPa at room temperature and 2.5GPa at 200 degree C. However, above 300 degree C at 2.5GPa the structure becomes a new phase of muscovite-like, rich of La, where it loses its interlayer water and turns out to be irreversible. Furthermore, it is important to point out that the higher temperature the better ordered is the structure and it is still stable under 7.7GPa and 900 degree C. Moreover, after all experiments the structure continues being dioctahedral. The new phase of muscovite-like, rich of La, in contact with a calcium solution remains partially unchanged, whereas the other part returns to the original structure (montmorillonite-Ca). The following analyses were performed: X-ray diffraction (XRD) for evaluating the spatial structure; Fourier transform infrared spectroscopy (FTIR) for getting information about the vibrational modes; scanning electron microscopy with dispersive Xray spectroscopy

Carbon doped lanthanum aluminate (LaAlO{sub 3}:C) UV thermoluminescent properties synthesized by solid state reaction with three different mixing methodologies

Energy Technology Data Exchange (ETDEWEB)

Alves, N., E-mail: neire.radiologia@yahoo.com.br, E-mail: farialo@cdtn.br [Universidade Federal do Estado de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Ferraz, W.B.; Faria, L.O., E-mail: ferrazw@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

2017-07-01

In this work we discuss the thermoluminescent (TL) response for LaAlO{sub 3}:C crystals grown by using three different combinations of Al{sub 2}O{sub 3}, La{sub 2}O{sub 3} and carbon atoms during the synthesis process. Recently, LaAlO{sub 3} single crystals, co-doped with Ce{sup 3+} and Dy{sup 3+} rare earth trivalent ions and grown under hydrothermal conditions, have been reported to show high thermoluminescent response (TL) when exposed to low levels of ultraviolet radiation (UVR). However, undoped LaAlO{sub 3} synthesized by solid state reaction method from the 1:1 mixture of aluminum and lanthanum oxide under reducing atmosphere revealed to have still higher thermoluminescent sensitivity to UV photon fields than the co-doped with Ce{sup 3+} and Dy{sup 3+}. It is well known that carbon doped aluminum oxide monocrystals have excellent TL and photoluminescent response properties for X-rays, UV and gamma radiation fields. Thus, we conducted three different syntheses of LaAlO{sub 3} by the solid state reaction method, doping the mixture with carbon. The lanthanum aluminate polycrystals were synthesized from the 1:1 mixture of aluminum and lanthanum oxide, adding 0.1wt.% carbon and annealed at 1700°C for two hours in hydrogen atmosphere. The X-ray diffraction analysis revealed the formation of rhombohedral LaAlO{sub 3} crystallographic phase, however a small percentage (15%) of Al{sub 2}O{sub 3} has been also identified. The UV-Vis absorbance spectra were obtained and F and F{sup +}- center were ascribed. The UV irradiations were carried out using a commercial 8W UV lamp. Thermoluminescence measurements were performed at a Harshaw 4500 TL reader. All compositions investigated have shown high TL sensitivity to UVR. (author)

14 CFR Appendix J to Part 141 - Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate J Appendix J to Part 141 Aeronautics and Space FEDERAL... PILOT SCHOOLS Pt. 141, App. J Appendix J to Part 141—Aircraft Type Rating Course, For Other Than an...

Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells

Directory of Open Access Journals (Sweden)

Wernet Peter

2010-08-01

Full Text Available Abstract Background The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. Findings We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. Conclusions The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.

Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells.

Science.gov (United States)

Neves, Rui; Scheel, Christina; Weinhold, Sandra; Honisch, Ellen; Iwaniuk, Katharina M; Trompeter, Hans-Ingo; Niederacher, Dieter; Wernet, Peter; Santourlidis, Simeon; Uhrberg, Markus

2010-08-03

The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT) process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE) was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.

The production of grain oriented lanthanum titanate (La2Ti2O7) ceramics by uniaxial hot-forging process for improved fracture toughness

International Nuclear Information System (INIS)

Ceylan, Ali

2008-01-01

The layered-structural ceramics, such as lanthanum titanate (La 2 Ti 2 O 7 ), have been known for their good electrical and optical properties at high frequencies and temperatures. However, few studies have been conducted on the mechanical properties of these ceramics. The interest in ceramic hot-forging (HF) has been greatly increased recently due to the enhancement in fracture toughness via bridging effect of oriented grains. In this study, grain oriented lanthanum titanate was produced by the hot-forging process. The characterizations of the samples were achieved by density measurement, scanning electron microscopy (SEM), optical microscopy, X-ray diffraction (XRD), Vickers indentation and three-point bending test. According to X-ray diffraction patterns, the orientation factor (f) was found to be 0.73 for certain hot-forging conditions resulting an improved fracture toughness. The improved fracture toughness of La 2 Ti 2 O 7 (3.2 MPa m 1/2 ) reached to the value of monolithic alumina (Al 2 O 3 ) between 3 and 4 MPa m 1/2

40 CFR 141.717 - Pre-filtration treatment toolbox components.

Science.gov (United States)

2010-07-01

... surface water or GWUDI source. (c) Bank filtration. Systems receive Cryptosporidium treatment credit for... paragraph. Systems using bank filtration when they begin source water monitoring under § 141.701(a) must... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Pre-filtration treatment toolbox...

40 CFR 141.22 - Turbidity sampling and analytical requirements.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Turbidity sampling and analytical... § 141.22 Turbidity sampling and analytical requirements. The requirements in this section apply to... the water distribution system at least once per day, for the purposes of making turbidity measurements...

42 CFR 410.141 - Outpatient diabetes self-management training.

Science.gov (United States)

2010-10-01

... 42 Public Health 2 2010-10-01 2010-10-01 false Outpatient diabetes self-management training. 410...-Management Training and Diabetes Outcome Measurements § 410.141 Outpatient diabetes self-management training... Part B covers outpatient diabetes self-management training for a beneficiary who has been diagnosed...

Red, green, and blue lanthanum phosphate phosphors obtained via surfactant-controlled hydrothermal synthesis

International Nuclear Information System (INIS)

Sousa Filho, Paulo C. de; Serra, Osvaldo A.

2009-01-01

A new solution route for the obtainment of highly pure luminescent rare-earth orthophosphates in hydrothermal conditions was developed. By starting from soluble precursors (lanthanide tripolyphosphato complexes, i.e. with P 3 O 10 5- as a complexing agent and as an orthophosphate source) and by applying surfactants in a water/toluene medium, the precipitations are confined to reverse micelle structures, thus yielding nanosized and homogeneous orthophosphates. The method was employed to obtain lanthanide-activated lanthanum phosphates, which can be applied as red (LaPO 4 :Eu 3+ ), green (LaPO 4 :Ce 3+ ,Tb 3+ ) and blue (LaPO 4 :Tm 3+ ) phosphors. The produced materials were analyzed by powder X-ray diffractometry, scanning electron microscopy, infrared spectroscopy and luminescence spectroscopy (emission, excitation, lifetimes and chromaticity coordinates).

Fabrication of large-volume, low-cost ceramic lanthanum halide scintillators for gamma ray detection : final report for DHS/DNDO/TRDD project TA-01-SL01.

Energy Technology Data Exchange (ETDEWEB)

Boyle, Timothy J.; Ottley, Leigh Anna M.; Yang, Pin; Chen, Ching-Fong; Sanchez, Margaret R.; Bell, Nelson Simmons

2008-10-01

This project uses advanced ceramic processes to fabricate large, optical-quality, polycrystalline lanthanum halide scintillators to replace small single crystals produced by the conventional Bridgman growth method. The new approach not only removes the size constraint imposed by the growth method, but also offers the potential advantages of both reducing manufacturing cost and increasing production rate. The project goal is to fabricate dense lanthanum halide ceramics with a preferred crystal orientation by applying texture engineering and solid-state conversion to reduce the thermal mechanical stress in the ceramic and minimize scintillation light scattering at grain boundaries. Ultimately, this method could deliver the sought-after high sensitivity and <3% energy resolution at 662 keV of lanthanum halide scintillators and unleash their full potential for advanced gamma ray detection, enabling rapid identification of radioactive materials in a variety of practical applications. This report documents processing details from powder synthesis, seed particle growth, to final densification and texture development of cerium doped lanthanum bromide (LaBr{sub 3}:Ce{sup +3}) ceramics. This investigation demonstrated that: (1) A rapid, flexible, cost efficient synthesis method of anhydrous lanthanum halides and their solid solutions was developed. Several batches of ultrafine LaBr{sub 3}:Ce{sup +3} powder, free of oxyhalide, were produced by a rigorously controlled process. (2) Micron size ({approx} 5 {micro}m), platelet shape LaBr{sub 3} seed particles of high purity can be synthesized by a vapor phase transport process. (3) High aspect-ratio seed particles can be effectively aligned in the shear direction in the ceramic matrix, using a rotational shear-forming process. (4) Small size, highly translucent LaBr{sub 3} (0.25-inch diameter, 0.08-inch thick) samples were successfully fabricated by the equal channel angular consolidation process. (5) Large size, high density

Medium-spin states in the N=80 nuclei 139Pr and 141Pm

International Nuclear Information System (INIS)

Piiparinen, M.; Kortelahti, M.; Pakkanen, A.; Komppa, T.; Komu, R.

1979-10-01

The level structures of 139 Pr and 141 Pm have been investigated using (p,2n), ( 3 He,3n) and (α,4n) reactions and methods of in-beam γ-ray and electron spectroscopy. Fourteen new levels with spins up to (23 + /2) were observed in 139 Pr and seventeen new levels with spins up to 19 - /2 in 141 Pm. The level structures in both nuclei can be described by coupling the odd-proton intrinsic states to the excitations of the doubly even core. The ordering of the levels in the πhsub(11/2)x2 + multiplet is discussed on the basis of the triaxial rotor-plus-particle model calculations. The calculations suggest that a transition from a basically prolate to an oblate triaxial shape takes place between the neutron numbers N = 78 and N = 80. A γ deformation of 34 was deduced for both 139 Pr and 141 Pm. (author)

Lanthanum titanium perovskite compound: Thin film deposition and high frequency dielectric characterization

Energy Technology Data Exchange (ETDEWEB)

Le Paven, C., E-mail: claire.lepaven@univ-rennes1.fr [Institut d' Electronique et de Télécommunications de Rennes (IETR, UMR-CNRS 6164), Equipe Matériaux Fonctionnels, IUT Saint Brieuc, Université de Rennes 1, 22000 Saint Brieuc (France); Lu, Y. [Institut d' Electronique et de Télécommunications de Rennes (IETR, UMR-CNRS 6164), Equipe Matériaux Fonctionnels, IUT Saint Brieuc, Université de Rennes 1, 22000 Saint Brieuc (France); Nguyen, H.V. [Institut d' Electronique et de Télécommunications de Rennes (IETR, UMR-CNRS 6164), Equipe Matériaux Fonctionnels, IUT Saint Brieuc, Université de Rennes 1, 22000 Saint Brieuc (France); CEA LETI, Minatec Campus, 38054 Grenoble (France); Benzerga, R.; Le Gendre, L. [Institut d' Electronique et de Télécommunications de Rennes (IETR, UMR-CNRS 6164), Equipe Matériaux Fonctionnels, IUT Saint Brieuc, Université de Rennes 1, 22000 Saint Brieuc (France); Rioual, S. [Laboratoire de Magnétisme de Brest (EA CNRS 4522), Université de Bretagne Occidentale, 29000 Brest (France); Benzegoutta, D. [Institut des Nanosciences de Paris (INSP, UMR CNRS 7588), Université Pierre et Marie Curie, 75005 Paris (France); Tessier, F.; Cheviré, F. [Institut des Sciences Chimiques de Rennes (ISCR, UMR-CNRS 6226), Equipe Verres et Céramiques, Université de Rennes 1, 35000 Rennes (France); and others

2014-02-28

Perovskite lanthanum titanium oxide thin films were deposited on (001) MgO, (001) LaAlO{sub 3} and Pt(111)/TiO{sub 2}/SiO{sub 2}/(001)Si substrates by RF magnetron sputtering, using a La{sub 2}Ti{sub 2}O{sub 7} homemade target sputtered under oxygen reactive plasma. The films deposited at 800 °C display a crystalline growth different than those reported on monoclinic ferroelectric La{sub 2}Ti{sub 2}O{sub 7} films. X-ray photoelectron spectroscopy analysis shows the presence of titanium as Ti{sup 4+} ions, with no trace of Ti{sup 3+}, and provides a La/Ti ratio of 1.02. The depositions being performed from a La{sub 2}Ti{sub 2}O{sub 7} target under oxygen rich plasma, the same composition (La{sub 2}Ti{sub 2}O{sub 7}) is proposed for the deposited films, with an unusual orthorhombic cell and Cmc2{sub 1} space group. The films have a textured growth on MgO and Pt/Si substrates, and are epitaxially grown on LaAlO{sub 3} substrate. The dielectric characterization displays stable values of the dielectric constant and of the losses in the frequency range [0.1–20] GHz. No variation of the dielectric constant has been observed when a DC electric field up to 250 kV/cm was applied, which does not match a classical ferroelectric behavior at high frequencies and room temperature for the proposed La{sub 2}Ti{sub 2}O{sub 7} orthorhombic phase. At 10 GHz and room temperature, the dielectric constant of the obtained La{sub 2}Ti{sub 2}O{sub 7} films is ε ∼ 60 and the losses are low (tanδ < 0.02). - Highlights: • Lanthanum titanium oxide films were deposited by reactive magnetron sputtering. • A La{sub 2}Ti{sub 2}O{sub 7} chemical composition is proposed, with an unusual orthorhombic cell. • At 10 GHz, the dielectric losses are lower than 0.02. • No variation of the dielectric constant is observed under DC electric biasing.

Lanthanum gallate and ceria composite as electrolyte for solid oxide fuel cells

International Nuclear Information System (INIS)

Li Shuai; Li Zhicheng; Bergman, Bill

2010-01-01

The composite of doped lanthanum gallate (La 0.9 Sr 0.1 Ga 0.8 Mg 0.2 O 2.85 , LSGM) and doped ceria (Ce 0.8 Sm 0.2 O 1.9 , CSO) was investigated as an electrolyte for solid oxide fuel cell (SOFC). The LSGM-CSO composite was examined by X-ray diffraction (XRD) and impedance spectroscopy. It was found that the sintered LSGM-CSO composite contains mainly fluorite CeO 2 phase and a minority impurity phase, Sm 3 Ga 5 O 12 . The LSGM-CSO composite electrolyte shows a small grain boundary response in the impedance spectroscopy as compared to LSGM and CSO pellets. The composite electrolyte exhibits the highest conductivity in the temperature range of 250-600 o C, compared to LSGM and CSO. The LSGM-CSO composite can be expected to be an attractive intermediate temperature electrolyte material for solid oxide fuel cells.

Volatile mixed-ligand lanthanum (3) complex with acetylacetone and 1,10-phenanthroline

International Nuclear Information System (INIS)

Kuz'mina, N.P.; Chuparov, N.V.; Pisarevskij, A.P.; Martynenko, L.I.

1997-01-01

La(Acac) 3 Phen complex is synthetized, its X-tray structure analysis is carried out. Crystals are monoclinic ones, sp.gr. P2 1 /n, a=17.11 (12), b=18.16 (3), c=17.86 (2) A, β=91.32 (2) deg, V=5548 (13) A 3 , Z=8. Structure contains two crystallographically non-equivalent types of molecules differing in interatomic distances and valent angles, as well as, in angles between ligand planes. Behaviour of La(Acac) 3 Phen at heating in vacuum (0.1-0.01 mm Hg) is studied. It is shown that under those conditions processes of Phen splitting, of sublimation and polymerization of La(Acac) 3 lanthanum acetylacetonate formed following Phen splitting and that under 220 deg C during 30 min quantitative transition of La(Acac) 3 Phen into gas phase is reached. 10 refs., 2 figs., 3 tabs

Influence of La/W ratio on electrical conductivity of lanthanum tungstate with high La/W ratio

International Nuclear Information System (INIS)

Kojo, Gen; Shono, Yohei; Ushiyama, Hiroshi; Oshima, Yoshito; Otomo, Junichiro

2017-01-01

The proton-conducting properties of lanthanum tungstates (LWOs) with high La/W ratios were investigated using electrochemical measurements and quantum chemical calculations. Single phases of LWOs with high La/W ratios (6.3≤La/W≤6.7) were synthesized by high-temperature sintering at around 1700 °C. The electrical conductivity of LWO increased with increasing La/W ratio in the single-phase region. The LWO synthesized at the optimum sintering temperature and time, and with the optimum La/W ratio gave the maximum conductivity, i.e., 2.7×10 −3 S cm −1 with La/W=6.7 at 500 °C. Density functional theory calculations, using the nudged elastic band method, were performed to investigate the proton diffusion barrier. The results suggest that the proton diffusion paths around La sites have the lowest proton diffusion barrier. These findings improve our understanding of LWO synthesis and the proton-conducting mechanism and provide a strategy for improving proton conduction in LWOs. - Graphical abstract: The LWOs with high La/W ratios were synthesized for the first time. The optimum La/W ratio gave the maximum conductivity with La/W=6.7 at 500 °C. The proton diffusion paths were also considered with density functional theory calculations. - Highlights: • The proton-conducting properties of lanthanum tungstates (LWOs) were investigated. • Single phase LWOs with high La/W ratios (6.3≤La/W≤6.7) were synthesized successfully. • LWOs with the high La/W ratios showed high proton conductivity. • The DFT calculation suggested the lowest proton diffusion barrier in the path around La sites.

Growth and characterization of magnesium chloride and lanthanum chloride doped strontium tartrate crystals - gel method

International Nuclear Information System (INIS)

Kalaiarasi, S.; Jaikumar, D.

2014-01-01

Growth of single crystals of doped strontium tartrate by controlled diffusion of strontium chloride into the silica gel charged with tartaric acid at room temperature is narrated. In this study, we synthesized magnesium chloride (5% and 10%) doped strontium tartrate crystals and Lanthanum chloride (5%, 10% and 15%) doped strontium tartrate crystals are grown. The crystal structure of the compound crystals was confirmed by single crystal X-ray diffraction. The Fourier transform infrared spectrum of pure and doped crystals are recorded and analyzed. The UV-Vis-NIR spectrum analysis reveals that the optical study of the grown crystals. The second harmonic generation efficiency was measured by using Kurtz powder technique with Nd:YAG laser of wavelength 1064 nm. (author)

40 CFR 141.111 - Treatment techniques for acrylamide and epichlorohydrin.

Science.gov (United States)

2010-07-01

... (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Treatment Techniques § 141.111 Treatment techniques for acrylamide and epichlorohydrin. Each public water system must certify... and epichlorohydrin are used in drinking water systems, the combination (or product) of dose and...

Structural, microstructural and transport properties study of lanthanum lithium titanium perovskite thin films grown by Pulsed Laser Deposition

International Nuclear Information System (INIS)

Maqueda, O.; Sauvage, F.; Laffont, L.; Martinez-Sarrion, M.L.; Mestres, L.; Baudrin, E.

2008-01-01

Lanthanum lithium titanate thin films were grown by Pulsed Laser Deposition. La 0.57 Li 0.29 TiO 3 dense films with smooth surfaces were obtained after optimization of the growth parameters. Such films deposited at 700 deg. C under 15 Pa are nano-crystalline with domains corresponding to the cubic and tetragonal modifications of this phase. In relation to the measured conductivities/activation energy and to previous works, we clearly underlined that the films of practical interest, prepared at relatively low temperature, are predominantly formed from the tetragonal ordered phase

14 CFR 141.25 - Business office and operations base.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Business office and operations base. 141.25... operations base. (a) Each holder of a pilot school or a provisional pilot school certificate must maintain a... or the operations base, each certificate holder must notify the FAA Flight Standards District Office...

Influence of lanthanum distribution on dielectric and ferroelectric properties of BaBi4-xLaxTi4O15 ceramics

International Nuclear Information System (INIS)

Khokhar, Anita; Goyal, Parveen K.; Thakur, O.P.; Shukla, A.K.; Sreenivas, K.

2015-01-01

Structural and electrical properties of Lanthanum substituted barium bismuth titanate BaBi 4-x La x Ti 4 O 15 (0 ≤ x ≤ 0.50) ceramics prepared by conventional solid-state reaction method have been investigated. Raman spectra reveals the distribution of lanthanum into the perovskite layers and (Bi 2 O 2 ) 2+ layers of BaBi 4 Ti 4 O 15 ceramics. Room temperature dielectric constant (ε′) increases and considerable reduction in the low frequency (10 −2 to 10 Hz) dielectric losses and in dc conductivity (σ dc ) are seen with lanthanum substitution. A critical La content of x ∼0.20 in BaBi 4-x La x Ti 4 O 15 exhibits a well-defined relaxor behavior as seen from the temperature and frequency dependence of the dielectric parameters ε′(T) and ε″(T). The dielectric data fit well to the modified Curie–Weiss law and the Lorentz-type relation and show increasing diffuseness in the phase transition with increasing La content. The temperature dependence of the characteristic relaxation time obtained from the Cole–Cole model shows a good fit to the non-linear Vogel–Fulcher relation. Improvements in the remnant polarization and a stable piezoelectric charge coefficient are seen up to a La content of x ∼0.20. The observed increase in dielectric loss and σ dc in addition to the diminished ferroelectric/piezoelectric properties for higher La content are explained in terms of changing oxygen vacancy concentration and structural relaxation due to the preferential incorporation of La into the (Bi 2 O 2 ) 2+ layers as evidenced through the Raman spectroscopy. - Highlights: • La distribution in BaBi 4-x La x Ti 4 O 15 ceramics is analyzed through Raman spectroscopy. • Low and a nearly constant loss over wide frequency range (10 −2 –10 7  Hz) obtained. • Critical La content x = 0.2 identified for high resistivity and ideal relaxor characteristics. • Improved P-E hysteresis loops and large remnant polarization measured. • Changes in the

The influence of lake water alkalinity and humic substances on particle dispersion and lanthanum desorption from a lanthanum modified bentonite.

Science.gov (United States)

Reitzel, Kasper; Balslev, Kristiane Astrid; Jensen, Henning S

2017-11-15

A 12 days laboratory study on potential desorption of Lanthanum (La) from a commercial La modified clay (Phoslock) was conducted using lake water from 17 Danish lakes with alkalinities between 0.02 and 3.7 meq L -1 and varying concentrations of DOC and humic acids (HA's). A similar study was conducted in artificial lake water with alkalinities from 0 to 2.5 meq L -1 in order to exclude interference from dissolved HA's. To test if La in solution (FLa) was associated with fine particles, the water samples were filtered sequentially through three filter sizes (1.2 μm, 0.45 μm and 0.2 μm), and finally, ultracentrifugation was used in an attempt to separate colloidal La from dissolved La. The study showed that higher FLa (up to 2.5 mg L -1 or 14% of the total La in the Phoslock) concentrations were found in soft water lakes compared to hard water lakes, probably due to dispersion of the clay at low alkalinities. In addition, this study showed that HA's seem to increase the FLa concentrations in soft water lakes, most likely through complexation of La retained in the Phoslock matrix. In summary, we conclude that elevated La concentrations in lake water after a Phoslock treatment should only be expected in soft water lakes rich in DOC and HA's. Copyright © 2017 Elsevier Ltd. All rights reserved.

Memory phenomenon in a lanthanum based bulk metallic glass

Energy Technology Data Exchange (ETDEWEB)

Zhou, Ye [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Huang, Wei Min, E-mail: mwmhuang@ntu.edu.sg [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Zhao, Yong [School of Chemistry and Chemical Engineering, Jiangsu University, 301 Xuefu Road, Zhenjiang 212013 (China); Ding, Zhen [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Li, Yan [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Tor, Shu Beng; Liu, Erjia [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore)

2016-07-05

In this paper, we experimentally investigate two memory phenomena in a lanthanum based bulk metallic glass (BMG). While the temperature memory effect (TME) is not found by differential scanning calorimeter (DSC) test, shape recovery is observed in samples indented at both low and high temperatures. In terms of shape memory related characteristics, this BMG shares some features of shape memory alloys (SMAs) due to its metal nature, and some other features of shape memory polymers (SMPs) owing to its glassy–rubbery transition. The formation of protrusion in the polished sample after heating to super-cooled liquid region (SCLR) indicates that surface tension is not a necessarily positive contributor for shape recovery. Release of internal elastic stress is concluded as the major player. Although the amorphous nature of BMGs enables for storing appreciable amount of internal elastic stress upon deformation, without the presence of cross-linker as in typical SMPs, the shape recovery in BMGs is rather limited. - Highlights: • Experimental investigation of shape recovery in BMG. • Surface tension is not the major reason for shape recovery in BMG. • Release of internal stress is the major contributor for shape recovery. • Comparison of shape memory features of BMG with other shape memory materials.

Memory phenomenon in a lanthanum based bulk metallic glass

International Nuclear Information System (INIS)

Zhou, Ye; Huang, Wei Min; Zhao, Yong; Ding, Zhen; Li, Yan; Tor, Shu Beng; Liu, Erjia

2016-01-01

In this paper, we experimentally investigate two memory phenomena in a lanthanum based bulk metallic glass (BMG). While the temperature memory effect (TME) is not found by differential scanning calorimeter (DSC) test, shape recovery is observed in samples indented at both low and high temperatures. In terms of shape memory related characteristics, this BMG shares some features of shape memory alloys (SMAs) due to its metal nature, and some other features of shape memory polymers (SMPs) owing to its glassy–rubbery transition. The formation of protrusion in the polished sample after heating to super-cooled liquid region (SCLR) indicates that surface tension is not a necessarily positive contributor for shape recovery. Release of internal elastic stress is concluded as the major player. Although the amorphous nature of BMGs enables for storing appreciable amount of internal elastic stress upon deformation, without the presence of cross-linker as in typical SMPs, the shape recovery in BMGs is rather limited. - Highlights: • Experimental investigation of shape recovery in BMG. • Surface tension is not the major reason for shape recovery in BMG. • Release of internal stress is the major contributor for shape recovery. • Comparison of shape memory features of BMG with other shape memory materials.

Europium-Doped Lanthanum Hafnate Nanoparticles: Structure, Photoluminescence, and Radioluminescence

Science.gov (United States)

Wahid, Kareem; Pokhrel, Madhab; Mao, Yuanbing

Due to their novel physical properties, nanostructured phosphors are of interest for radiation-based imaging and therapeutics. Herein, the structural and luminescent properties of europium-doped lanthanum hafnate (La2Hf2O7:xmol%Eu3+, x = 0 - 35) nanoparticles are investigated for use as scintillators. X-ray diffraction, Raman spectroscopy, and scanning electron microscopy confirm samples prepared through a combined co-precipitation and low-temperature molten salt synthetic process homogenously form spherical nanocrystals of 36 nm in the ordered pyrochlore phase. Ultraviolet and X-ray excitation of these samples induce strong red emissions in the 580 - 590 and 612 - 630 nm range corresponding to the 5D0->7 F1 magnetic dipole and 5D0->7 F2 electric dipole transitions of Eu3+. Optical response and quantum yield are optimized at 5% Eu3+; a proposed trade-off between quenching mechanisms (defect-states/cross-relaxation) and dopant concentration is discussed. Owing to their high density, large effective atomic number, and bright luminescence, these La2Hf2O7:xmol%Eu3+ nanoparticles warrant further investigation for scintillator applications. The authors thank the support from the Defense Threat Reduction Agency of the U.S. Department of Defense (award #HDTRA1- 10-1-0114).

Rare Earth Doped Lanthanum Calcium Borate Polycrystalline Red Phosphors

Directory of Open Access Journals (Sweden)

H. H. Xiong

2014-01-01

Full Text Available Single-phased Sm3+ doped lanthanum calcium borate (SmxLa2−xCaB10O19, SLCB, x=0.06 polycrystalline red phosphor was prepared by solid-state reaction method. The phosphor has two main excitation peaks located at 398.5 nm and 469.0 nm, which are nicely in accordance with the emitting wavelengths of commercial near-UV and blue light emitting diode chips. Under the excitation of 398.0 nm, the dominant red emission of Sm3+ in SLCB phosphor is centered at 598.0 nm corresponding to the transition of 4G5/2 → 6H7/2. The Eu3+ fluorescence in the red spectral region is applied as a spectroscopic probe to reveal the local site symmetry in the host lattice and, hence, Judd-Ofelt parameters Ωt  (t=2, 4 of Eu3+ in the phosphor matrix are derived to be 3.62×10-20 and 1.97×10-20 cm2, indicating a high asymmetrical and strong covalent environment around rare earth luminescence centers. Herein, the red phosphors are promising good candidates employed in white light emitting diodes (LEDs illumination.

Loss of miR-141/200c ameliorates hepatic steatosis and inflammation by reprogramming multiple signaling pathways in NASH

Science.gov (United States)

Tran, Melanie; Lee, Sang-Min; Shin, Dong-Ju

2017-01-01

Accumulation of lipid droplets and inflammatory cell infiltration is the hallmark of nonalcoholic steatohepatitis (NASH). The roles of noncoding RNAs in NASH are less known. We aim to elucidate the function of miR-141/200c in diet-induced NASH. WT and miR-141/200c–/– mice were fed a methionine and choline deficient (MCD) diet for 2 weeks to assess markers of steatosis, liver injury, and inflammation. Hepatic miR-141 and miR-200c RNA levels were highly induced in human patients with NASH fatty liver and in WT MCD mice. miR-141/200c–/– MCD mice had reduced liver weights and triglyceride (TG) levels, which was associated with increased microsomal TG transfer protein (MTTP) and PPARα but reduced SREBP1c and FAS expression. Inflammation was attenuated and F4/80 macrophage activation was suppressed in miR-141/200c–/– mice, as evidenced by decreased serum aminotransferases and IL-6 and reduced hepatic proinflammatory, neutrophil, and profibrotic genes. Treatment with LPS in BM-derived macrophages isolated from miR-200c/141–/– mice polarized macrophages toward the M2 antiinflammatory state by increasing Arg1 and IL-10 levels while decreasing the M1 marker iNOS. In addition, elevated phosphorylated AMPK (p-AMPK), p-AKT, and p-GSK3β and diminished TLR4 and p-mTOR/p-4EBP1 proteins were observed. Lipidomics and metabolomics revealed alterations of TG and phosphatidylcholine (PC) lipid species by miR-141/200c deficiency. In summary, miR-141/200c deficiency diminished NASH-associated hepatic steatosis and inflammation by reprogramming lipid and inflammation signaling pathways. PMID:29093267

40 CFR 141.723 - Requirements to respond to significant deficiencies identified in sanitary surveys performed by EPA.

Science.gov (United States)

2010-07-01

... deficiencies identified in sanitary surveys performed by EPA. 141.723 Section 141.723 Protection of Environment... performed by EPA, systems must respond in writing to significant deficiencies identified in sanitary survey... will address significant deficiencies noted in the survey. (d) Systems must correct significant...

26 CFR 1.141-5 - Private loan financing test.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Private loan financing test. 1.141-5 Section 1... loan financing test. (a) In general. Bonds of an issue are private activity bonds if more than the... determining whether the private loan financing test is met. In determining whether the proceeds of an issue...

How angry was the ancient Greek god Poseidon in 141/142 A.D.?

Science.gov (United States)

Şahin, Murat; Elitez, İrem; Yaltırak, Cenk

2017-04-01

Poseidon, also known as "God of Sea" or "Earth-Shaker", was one of the Olympian's Gods in the Greek mythology. It was a common belief that Poseidon shows his rage by tsunamis and earthquakes. So, the how angry Poseidon in 141/142 A.D.? According to the historical records, the whole area including Lycian cities and Rhodes was affected by a destructive earthquake and a following tsunami in 141/142. After these events the emperor of Greeks made donations to the Lycian cities and Rhodes for their recovery with relative to the damage and importance of the city. 141/142 earthquake had a considerable amount of damage on 28 ancient cities. With respect to the historical catalogues, this earthquake had at least 9-10 intensity and caused a tsunami in Rhodes and harbour of the ancient city of Patara. In this study, we try to restrict the magnitude of the event by using PGA (peak ground acceleration), MMI (Modified Mercalli Intensity), tsunami modelling and amount of aids. Our preliminary results suggest that this event has to be bigger or equal magnitude 8.

Lanthanum gallate and ceria composite as electrolyte for solid oxide fuel cells

Energy Technology Data Exchange (ETDEWEB)

Li Shuai, E-mail: shuail@kth.s [Department of Materials Science and Engineering, School of Industrial Engineering and Management, Royal Institute of Technology, SE 10044 Stockholm (Sweden); Li Zhicheng [School of Materials Science and Engineering, Central South University, 410083 Changsha, Hunan (China); Bergman, Bill [Department of Materials Science and Engineering, School of Industrial Engineering and Management, Royal Institute of Technology, SE 10044 Stockholm (Sweden)

2010-03-04

The composite of doped lanthanum gallate (La{sub 0.9}Sr{sub 0.1}Ga{sub 0.8}Mg{sub 0.2}O{sub 2.85}, LSGM) and doped ceria (Ce{sub 0.8}Sm{sub 0.2}O{sub 1.9}, CSO) was investigated as an electrolyte for solid oxide fuel cell (SOFC). The LSGM-CSO composite was examined by X-ray diffraction (XRD) and impedance spectroscopy. It was found that the sintered LSGM-CSO composite contains mainly fluorite CeO{sub 2} phase and a minority impurity phase, Sm{sub 3}Ga{sub 5}O{sub 12}. The LSGM-CSO composite electrolyte shows a small grain boundary response in the impedance spectroscopy as compared to LSGM and CSO pellets. The composite electrolyte exhibits the highest conductivity in the temperature range of 250-600 {sup o}C, compared to LSGM and CSO. The LSGM-CSO composite can be expected to be an attractive intermediate temperature electrolyte material for solid oxide fuel cells.

Gelcasting of strontium doped lanthanum manganite for solid oxide fuel cell applications

International Nuclear Information System (INIS)

Abdul Haleem, B.; Bhuvana, R.; Udayakumar, A.

2009-01-01

Solid oxide fuel cells (SOFCs) are devices that offer high efficiency power output with negligible emissions. Cathode supported tubular SOFCs consist of porous cathode tubes made up of strontium doped lanthanum manganite, La 1-x Sr x MnO 3 (LSM) that work as functional component as well as structural support for the rest of the cell components. Gelcasting is one of the most suitable methods for the fabrication of porous ceramics. This paper describes the fabrication of porous LSM cathode by gelcasting process. Gelcasting parameters such as monomer concentration, powder volume fraction, pH of the slurry, etc were optimized. Slow drying of green specimens minimized warpage and cracking. Sintered specimens with controlled porosity were obtained by the use of suitable pore-forming agents. The coefficient of thermal expansion (CTE) of sintered specimens was measured, which was found matching with the CTE values of cell components reported in the literature. These results have shown the suitability of the gelcast generated LSM cathodes for SOFC applications. (author)

Suppression of cavitation in melted tungsten by doping with lanthanum oxide

International Nuclear Information System (INIS)

Yuan, Y.; Lu, G.H.; Xu, B.; Fu, B.Q.; Xu, H.Y.; Li, C.; Jia, Y.Z.; Qu, S.L.; Liu, W.; Greuner, H.; Böswirth, B.; Luo, G.-N.

2014-01-01

Melting and boiling behaviour of pure tungsten and 1 wt% lanthanum-oxide-doped tungsten (WL10) are investigated, focusing on the material selection with respect to material loss induced by cavitation. Melting experiments under high heat loads are carried out in the high heat flux facility GLADIS. Pulsed hydrogen neutral beams with heat flux of 10 and 23 MW m −2 are applied onto the adiabatically loaded samples for intense surface melting. Melt layer of the two tungsten grades exhibit different microstructure characteristics. Substantive voids owing to cavitation in the liquid phase are observed in pure W and lead to porous resolidified material. However, little cavitation bubbles can be found in the dense resolidified layer of WL10. In order to find out the gaseous sources, vapour collection is performed and the components are subsequently detected. Based on the observations and analyses, the microstructure evolutions corresponding to melting and vapourization behaviour of the two tungsten grades are tentatively described, and furthermore, the underlying mechanisms of cavitation in pure W and its suppression in WL10 are discussed. (paper)

Role for DNA methylation in the regulation of miR-200c and miR-141 expression in normal and cancer cells

Energy Technology Data Exchange (ETDEWEB)

Vrba, Lukas; Jensen, Taylor J.; Garbe, James C.; Heimark, Ronald L.; Cress, Anne E.; Dickinson, Sally; Stampfer, Martha R.; Futscher, Bernard W.

2009-12-23

BACKGROUND: The microRNA-200 family participates in the maintenance of an epithelial phenotype and loss of its expression can result in epithelial to mesenchymal transition (EMT). Furthermore, the loss of expression of miR-200 family members is linked to an aggressive cancer phenotype. Regulation of the miR-200 family expression in normal and cancer cells is not fully understood. METHODOLOGY/ PRINCIPAL FINDINGS: Epigenetic mechanisms participate in the control of miR-200c and miR-141 expression in both normal and cancer cells. A CpG island near the predicted mir-200c/mir-141 transcription start site shows a striking correlation between miR-200c and miR-141 expression and DNA methylation in both normal and cancer cells, as determined by MassARRAY technology. The CpG island is unmethylated in human miR-200/miR-141 expressing epithelial cells and in miR-200c/miR-141 positive tumor cells. The CpG island is heavily methylated in human miR-200c/miR-141 negative fibroblasts and miR-200c/miR-141 negative tumor cells. Mouse cells show a similar inverse correlation between DNA methylation and miR-200c expression. Enrichment of permissive histone modifications, H3 acetylation and H3K4 trimethylation, is seen in normal miR-200c/miR-141-positive epithelial cells, as determined by chromatin immunoprecipitation coupled to real-time PCR. In contrast, repressive H3K9 dimethylation marks are present in normal miR-200c/miR-141-negative fibroblasts and miR-200c/miR-141 negative cancer cells and the permissive histone modifications are absent. The epigenetic modifier drug, 5-aza-2'-deoxycytidine, reactivates miR-200c/miR-141 expression showing that epigenetic mechanisms play a functional role in their transcriptional control. CONCLUSIONS/ SIGNIFICANCE: We report that DNA methylation plays a role in the normal cell type-specific expression of miR-200c and miR-141 and this role appears evolutionarily conserved, since similar results were obtained in mouse. Aberrant DNA methylation

40 CFR 141.87 - Monitoring requirements for water quality parameters.

Science.gov (United States)

2010-07-01

... § 141.87 Monitoring requirements for water quality parameters. All large water systems, and all small- and medium-size systems that exceed the lead or copper action level shall monitor water quality... methods. (i) Tap samples shall be representative of water quality throughout the distribution system...

Structural phase transition in lanthanum gallate as studied by Raman and X-ray diffraction measurements

Energy Technology Data Exchange (ETDEWEB)

Dhak, P.; Pramanik, P. [Department of Chemistry, Indian Institute of Technology, Kharagpur 721302 (India); Bhattacharya, S.; Roy, Anushree [Department of Physics, Indian Institute of Technology, Kharagpur 721302 (India); Achary, S.N.; Tyagi, A.K. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India)

2011-08-15

Lanthanum gallate (LaGaO{sub 3}) is known to undergo orthorhombic to rhombohedral first order phase transition at 150 C. In this article we have shown that by introducing 2% La deficiency in the system, coexistence of above two phases can be obtained at lower temperature and a complete phase transition occurs at 200 C. The evolution of structural parameters of the system with temperature is reported from X-ray diffraction measurements and Rietveld analysis of the diffraction patterns. The change in local octahedral distortion due to 2% La deficiency is revealed through the shift in the phonon modes of GaO{sub 6} octahedra, in both orthorhombic and rhombohedral phase. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Resident CD141 (BDCA3)+ dendritic cells in human skin produce IL-10 and induce regulatory T cells that suppress skin inflammation.

Science.gov (United States)

Chu, Chung-Ching; Ali, Niwa; Karagiannis, Panagiotis; Di Meglio, Paola; Skowera, Ania; Napolitano, Luca; Barinaga, Guillermo; Grys, Katarzyna; Sharif-Paghaleh, Ehsan; Karagiannis, Sophia N; Peakman, Mark; Lombardi, Giovanna; Nestle, Frank O

2012-05-07

Human skin immune homeostasis, and its regulation by specialized subsets of tissue-residing immune sentinels, is poorly understood. In this study, we identify an immunoregulatory tissue-resident dendritic cell (DC) in the dermis of human skin that is characterized by surface expression of CD141, CD14, and constitutive IL-10 secretion (CD141(+) DDCs). CD141(+) DDCs possess lymph node migratory capacity, induce T cell hyporesponsiveness, cross-present self-antigens to autoreactive T cells, and induce potent regulatory T cells that inhibit skin inflammation. Vitamin D(3) (VitD3) promotes certain phenotypic and functional properties of tissue-resident CD141(+) DDCs from human blood DCs. These CD141(+) DDC-like cells can be generated in vitro and, once transferred in vivo, have the capacity to inhibit xeno-graft versus host disease and tumor alloimmunity. These findings suggest that CD141(+) DDCs play an essential role in the maintenance of skin homeostasis and in the regulation of both systemic and tumor alloimmunity. Finally, VitD3-induced CD141(+) DDC-like cells have potential clinical use for their capacity to induce immune tolerance.

40 CFR 141.709 - Developing the disinfection profile and benchmark.

Science.gov (United States)

2010-07-01

... Cryptosporidium Disinfection Profiling and Benchmarking Requirements § 141.709 Developing the disinfection profile...) of the water before or at the first customer and prior to each additional point of disinfectant...) before or at the first customer during peak hourly flow. (ii) Determine successive CTcalc/CT99.9 values...

26 CFR 1.141-7 - Special rules for output facilities.

Science.gov (United States)

2010-04-01

.... (b) Definitions. For purposes of this section and § 1.141-8, the following definitions and rules... legislature in State X to own and operate certain power generating facilities, sells all of the power from its... generation, transmission and distribution facilities. In 2003, D transfers operating control of its...

Conductivity and hydration trends in disordered fluorite and pyrochlore oxides: A study on lanthanum cerate–zirconate based compounds

DEFF Research Database (Denmark)

Besikiotis, Vasileios; Ricote, Sandrine; Jensen, Molly Hjorth

2012-01-01

In the present contribution we discuss the influence of order/disorder on the concentration and mobility of ionic charge carriers in undoped and acceptor (calcium) doped fluorite and pyrochlore structured lanthanum cerate–zirconate solid solutions: (La1−yCay)2(Ce1−xZrx)2O7−δ (y=0, 0.02, 0.10; x=0...... enthalpy becomes more exothermic with higher cerium content, i.e. with more disordered materials. The proton conductivity decreases upon acceptor substitution of La3+ with Ca2+ which is attributed to trapping of the charge carriers by the effectively negative acceptor....

MIR141 expression differentiates Hashimoto Thyroiditis from PTC and benign thyrocytes in Irish archival thyroid tissues

Directory of Open Access Journals (Sweden)

Emma R Dorris

2012-09-01

Full Text Available MicroRNAs (miRNAs are small non-coding RNAs approximately 22 nucleotides in length that function as regulators of gene expression. Dysregulation of miRNAs has been associated with initiation and progression of oncogenesis in humans. Our group has previously described a unique miRNA expression signature, including the MIR200 family member MIR141, which can differentiate papillary thyroid cancer (PTC cell lines from a control thyroid cell line. An investigation into the expression of MIR141 in a series of archival thyroid malignancies (n=140; classic PTC, follicular variant PTC, follicular thyroid carcinoma (FTC, Hashimoto thyroiditis (HT, or control thyrocytes was performed. Each cohort had a minimum of 20 validated samples surgically excised within the period 1980 - 2009. A subset of the HT and cPTC cohorts (n=3 were also analysed for expression of TGFβR1, a key member of the TGFβ pathway and known target of MIR141. Laser capture microdissection was used to specifically dissect target cells from formalin-fixed paraffin-embedded archival tissue. Thyrocyte- and lymphocyte-specific markers (TSHR and LSP1 respectively confirmed the integrity of cell populations in the HT cohort. RNA was extracted and quantitative RT-PCR was performed using comparative CT (ΔΔCT analysis. Statistically significant (p<0.05 differential expression profiles of MIR141 were found between tissue types. HT samples displayed significant downregulation of MIR141 compared to both classic PTC and control thyrocytes. Furthermore, TGFβR1 expression was detected in cPTC samples but not in HT thyrocytes. It is postulated that the down-regulation of this miRNA is due, at least in part, to its involvement in regulating the TGFβ pathway. This pathway is exquisitely involved in T-cell autoimmunity and has previously been linked with HT. In conclusion, HT epithelium can be distinguished from cPTC epithelium and control epithelium based on the relative expression of MIR141.

Ugilec 141, PCB's en dioxinen in paling uit de Roer

NARCIS (Netherlands)

Wammes JIJ; Linders SHMA; Liem AKD; Velde EG van der; LOC

1997-01-01

Questions about the health risk of consumption of eel from the river Rur for anglers, were the reason for an investigation into the occurrence of PCBs, dioxins and Ugilec 141 in this eel. Methods developed at the Laboratory of Organic-analytical Chemistry have been used for the analysis of Ugilec

Cerium doped lanthanum halides: fast scintillators for medical imaging

International Nuclear Information System (INIS)

Selles, O.

2006-12-01

This work is dedicated to two recently discovered scintillating crystals: cerium doped lanthanum halides (LaCl 3 :Ce 3+ and LaBr 3 :Ce 3+ ).These scintillators exhibit interesting properties for gamma detection, more particularly in the field of medical imaging: a short decay time, a high light yield and an excellent energy resolution. The strong hygroscopicity of these materials requires adapting the usual experimental methods for determining physico-chemical properties. Once determined, these can be used for the development of the industrial manufacturing process of the crystals. A proper comprehension of the scintillation mechanism and of the effect of defects within the material lead to new possible ways for optimizing the scintillator performance. Therefore, different techniques are used (EPR, radioluminescence, laser excitation, thermally stimulated luminescence). Alongside Ce 3+ ions, self-trapped excitons are involved in the scintillation mechanism. Their nature and their role are detailed. The knowledge of the different processes involved in the scintillation mechanism leads to the prediction of the effect of temperature and doping level on the performance of the scintillator. A mechanism is proposed to explain the thermally stimulated luminescence processes that cause slow components in the light emission and a loss of light yield. Eventually the study of afterglow reveals a charge transfer to deep traps involved in the high temperature thermally stimulated luminescence. (author)

Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl

International Nuclear Information System (INIS)

Ovchar, L.A.; Poluehktov, N.S.

1980-01-01

The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru

Data for effects of lanthanum complex on the thermo-oxidative aging of natural rubber

Directory of Open Access Journals (Sweden)

Wei Zheng

2015-12-01

Full Text Available Novel mixed antioxidants composed of antioxidant IPPD and lanthanum (La complex were added as a filler to form natural rubber (NR composites. By mechanical testing, Fourier transform infrared spectroscopy with attenuated total reflectance (FTIR-ATR and thermogravimetric analysis (TGA, a string of data, including the mechanical properties, the variation of internal groups and the thermal and thermo-oxidative decompositions of NR, was presented in this data article. The data accompanying its research article [1] studied the thermo-oxidative aging properties of NR in detail. The density function theoretical (DFT calculations were also used as an assistant to study the thermo-oxidative aging mechanism of NR. The data revealed that this new rare-earth antioxidant could indeed enhance the thermo-oxidative aging resistance of NR, which is associated with its different function mechanism from that of the pure antioxidant IPPD.

Data for effects of lanthanum complex on the thermo-oxidative aging of natural rubber.

Science.gov (United States)

Zheng, Wei; Liu, Li; Zhao, Xiuying; He, Jingwei; Wang, Ao; Chan, Tung W; Wu, Sizhu

2015-12-01

Novel mixed antioxidants composed of antioxidant IPPD and lanthanum (La) complex were added as a filler to form natural rubber (NR) composites. By mechanical testing, Fourier transform infrared spectroscopy with attenuated total reflectance (FTIR-ATR) and thermogravimetric analysis (TGA), a string of data, including the mechanical properties, the variation of internal groups and the thermal and thermo-oxidative decompositions of NR, was presented in this data article. The data accompanying its research article [1] studied the thermo-oxidative aging properties of NR in detail. The density function theoretical (DFT) calculations were also used as an assistant to study the thermo-oxidative aging mechanism of NR. The data revealed that this new rare-earth antioxidant could indeed enhance the thermo-oxidative aging resistance of NR, which is associated with its different function mechanism from that of the pure antioxidant IPPD.

Data for effects of lanthanum complex on the thermo-oxidative aging of natural rubber

Science.gov (United States)

Zheng, Wei; Liu, Li; Zhao, Xiuying; He, Jingwei; Wang, Ao; Chan, Tung W.; Wu, Sizhu

2015-01-01

Novel mixed antioxidants composed of antioxidant IPPD and lanthanum (La) complex were added as a filler to form natural rubber (NR) composites. By mechanical testing, Fourier transform infrared spectroscopy with attenuated total reflectance (FTIR-ATR) and thermogravimetric analysis (TGA), a string of data, including the mechanical properties, the variation of internal groups and the thermal and thermo-oxidative decompositions of NR, was presented in this data article. The data accompanying its research article [1] studied the thermo-oxidative aging properties of NR in detail. The density function theoretical (DFT) calculations were also used as an assistant to study the thermo-oxidative aging mechanism of NR. The data revealed that this new rare-earth antioxidant could indeed enhance the thermo-oxidative aging resistance of NR, which is associated with its different function mechanism from that of the pure antioxidant IPPD. PMID:26693513

18 CFR 141.100 - Original cost statement of utility property.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original cost statement... POLICIES ACT OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.100 Original cost statement of utility... predecessors of an electric operating unit or system, the original cost, estimated, if not known, the cost of...

Spectroscopic properties of Sm{sup 3+}-doped lanthanum borogermanate glass

Energy Technology Data Exchange (ETDEWEB)

Rajaramakrishna, R. [Department of Physics, Bangalore University, Bangalore 560056 (India); Knorr, Brian; Dierolf, Volkmar [Department of Physics, Lehigh University Bethlehem, PA 18015 (United States); Anavekar, R.V., E-mail: anavekar_271@yahoo.co.in [Department of Physics, Bangalore University, Bangalore 560056 (India); Jain, H. [Department of Materials Science and Engineering, Lehigh University Bethlehem, PA 18015 (United States)

2014-12-15

Ultraviolet–visible–near infrared (UV–vis–NIR) absorption and photoluminescence of (25−x) La{sub 2}O{sub 3}–25B{sub 2}O{sub 3}–50GeO{sub 2} glass series have been studied with different concentrations (x=0.1–1.0 wt%) of Sm{sub 2}O{sub 3} as an optically active dopant. The values of Judd–Ofelt (JO) parameters (Ω{sub t}) follow the trend Ω{sub 2}>Ω{sub 4}>Ω{sub 6}. Visible emission and decay times from the {sup 4}G{sub 5/2} level and its relative quantum efficiencies are measured. Intense reddish-orange emission corresponding to {sup 4}G{sub 5/2}→{sup 6}H{sub 7/2} transition has been observed in these glasses under 488 nm excitation. A decrease in the quantum yield is observed with increasing Sm{sup 3+} ion concentration beyond 1% doping level. - Highlights: • Lanthanum boro-germanate glasses doped with samarium ions are good laser host matrix. • These glasses show large emission cross-sections (σ{sub P}) values. • These glasses show large gain bandwidth and optical gain parameters. • These glasses are suitable candidate for reddish-orange laser applications.

A multi-scale study of the adsorption of lanthanum on the (110) surface of tungsten

International Nuclear Information System (INIS)

Samin, Adib J.; Zhang, Jinsuo

2016-01-01

In this study, we utilize a multi-scale approach to studying lanthanum adsorption on the (110) plane of tungsten. The energy of the system is described from density functional theory calculations within the framework of the cluster expansion method. It is found that including two-body figures up to the sixth nearest neighbor yielded a reasonable agreement with density functional theory calculations as evidenced by the reported cross validation score. The results indicate that the interaction between the adsorbate atoms in the adlayer is important and cannot be ignored. The parameterized cluster expansion expression is used in a lattice gas Monte Carlo simulation in the grand canonical ensemble at 773 K and the adsorption isotherm is recorded. Implications of the obtained results for the pyroprocessing application are discussed.

A multi-scale study of the adsorption of lanthanum on the (110) surface of tungsten

Energy Technology Data Exchange (ETDEWEB)

Samin, Adib J.; Zhang, Jinsuo [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, 201W 19th Avenue, Columbus, Ohio 43210 (United States)

2016-07-28

In this study, we utilize a multi-scale approach to studying lanthanum adsorption on the (110) plane of tungsten. The energy of the system is described from density functional theory calculations within the framework of the cluster expansion method. It is found that including two-body figures up to the sixth nearest neighbor yielded a reasonable agreement with density functional theory calculations as evidenced by the reported cross validation score. The results indicate that the interaction between the adsorbate atoms in the adlayer is important and cannot be ignored. The parameterized cluster expansion expression is used in a lattice gas Monte Carlo simulation in the grand canonical ensemble at 773 K and the adsorption isotherm is recorded. Implications of the obtained results for the pyroprocessing application are discussed.

26 CFR 31.3121(b)(14)-1 - Services in delivery or distribution of newspapers, shopping news, or magazines.

Science.gov (United States)

2010-04-01

... newspapers, shopping news, or magazines. 31.3121(b)(14)-1 Section 31.3121(b)(14)-1 Internal Revenue INTERNAL... distribution of newspapers, shopping news, or magazines. (a) Services of individuals under age 18. Services... the time of, the sale of newspapers or magazines to ultimate consumers under an arrangement under...

Back bombardment for dispenser and lanthanum hexaboride cathodes

Directory of Open Access Journals (Sweden)

Mahmoud Bakr

2011-06-01

Full Text Available The back bombardment (BB effect limits wide usage of thermionic rf guns. The BB effect induces not only ramping-up of a cathode’s temperature and beam current, but also degradation of cavity voltage and beam energy during a macropulse. This paper presents a comparison of the BB effect for the case of dispenser tungsten-base (DC and lanthanum hexaboride (LaB_{6} thermionic rf gun cathodes. For each, particle simulation codes are used to simulate the BB effect and electron beam dynamics in a thermionic rf gun cathode. A semiempirical equation is also used to investigate the stopping range and deposited heat power of BB electrons in the cathode material. A numerical simulation method is used to calculate the change of the cathode temperature and current density during a single macropulse. This is done by solving two differential equations for the rf gun cavity equivalent circuit and one-dimensional thermal diffusion equation. High electron emission and small beam size are required for generation of a high-brightness electron beam, and so in this work the emission properties of the cathode are taken into account. Simulations of the BB effect show that, for a pulse of 6  μs duration, the DC cathode experiences a large change in the temperature compared with LaB_{6}, and a change in current density 6 times higher. Validation of the simulation results is performed using experimental data for beam current beyond the gun exit. The experimental data is well reproduced using the simulation method.

Rare earth impurities in high purity lanthanum oxide determined by neutron activation analysis

International Nuclear Information System (INIS)

Nguyen Van Suc; Desai, H.B.; Parthasarathy, R.; Gangadharan, S.

1992-01-01

Individual rare earth impurities in high purity La 2 O 3 (≥99.9%) have been determined by NAA after pre-separation of the matrix (La). The separation is carried out on an anion exchanger (Dowex 1x8) using different mixtures of methanol/nitric acid as eluants. The rare earth elements from Dy to Lu are eluted quantitatively using a 10% 1M HNO 3 - 90% methanol mixture, while the light rare earths from Ce to Gd are eluted quantitatively using a 10% 0.05M HNO 3 - 90% methanol mixture. La, which is retained on the column, is eluted using 0.1M HNO 3 . The recoveries of the various rare earth elements have been checked using radiotracers and also by spiking the sample with known amount of elements, and the recoveries are found to be quantitative. Results obtained on a typical high purity lanthanum oxide are reported here. (author) 5 refs.; 1 fig

14 CFR Appendix F to Part 141 - Flight Instructor Certification Course

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight Instructor Certification Course F Appendix F to Part 141 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION...) Takeoffs, landings, and go-arounds; (viii) Fundamentals of flight; (ix) Performance maneuvers; (x) Ground...

Synthesis and luminescence studies of novel rare earth activated lanthanum pentaborate

International Nuclear Information System (INIS)

Nagpure, P.A.; Bajaj, N.S.; Omanwar, S.K.; Sonekar, R.P.

2011-01-01

The lanthanum pentaborate (LaB 5 O 9 ) is a novel material which exhibits excellent luminescence when doped with rare earth ions. It was prepared by a novel technique which is a slight variation of solution combustion synthesis. The synthesis is based on the exothermic reaction between the fuel (urea) and oxidizer (ammonium nitrate). The structure of the prepared material was confirmed by powder XRD technique. The photoluminescence of rare earth ions (Ce 3+ , Eu 3+ ) and sensitized luminescence of Gd 3+ (Pr 3+ -Gd 3+ and Bi 3+ -Gd 3+ ) in LaB 5 O 9 have been studied. LaB 5 O 9 :Ce 3+ shows broad band UV emission at 317 nm and LaB 5 O 9 :Eu 3+ shows orange red emission. LaB 5 O 9 : Pr 3+ -Gd 3+ and LaB 5 O 9 : Bi 3+ -Gd 3+ exhibit efficient luminescence of Gd 3+ in narrow UVB region at 310 nm. The material (La 0.5 Pr 0.4 )B 5 O 9 :Gd 0.1 exhibits intense narrow band UVB emission at 310 nm and could be a potential candidate for UVB phosphors used in phototherapy lamps. (author)

RM1 Semiempirical Quantum Chemistry: Parameters for Trivalent Lanthanum, Cerium and Praseodymium.

Directory of Open Access Journals (Sweden)

José Diogo L Dutra

Full Text Available The RM1 model for the lanthanides is parameterized for complexes of the trications of lanthanum, cerium, and praseodymium. The semiempirical quantum chemical model core stands for the [Xe]4fn electronic configuration, with n =0,1,2 for La(III, Ce(III, and Pr(III, respectively. In addition, the valence shell is described by three electrons in a set of 5d, 6s, and 6p orbitals. Results indicate that the present model is more accurate than the previous sparkle models, although these are still very good methods provided the ligands only possess oxygen or nitrogen atoms directly coordinated to the lanthanide ion. For all other different types of coordination, the present RM1 model for the lanthanides is much superior and must definitely be used. Overall, the accuracy of the model is of the order of 0.07Å for La(III and Pr(III, and 0.08Å for Ce(III for lanthanide-ligand atom distances which lie mostly around the 2.3Å to 2.6Å interval, implying an error around 3% only.

Effect of the melting conditions on the properties of radiation color centers in lanthanum phosphate glasses

Energy Technology Data Exchange (ETDEWEB)

Karapetyan, G.O.; Rusan, V.V.; Yashchurzhinskaya, O.A.

1986-01-01

The authors investigate the spatial effects of ionizing radiation on the radiation processes in phosphate glasses to make a comparative estimate of the radiation yield from the radiation color centers (RCC) of different types. A study is made of their behavior under thermal decoloration. The results of a comparison of the integrated intensities of the ESR signal from trapping centers are given. The ESR spectrum of the glasses are presented--one differs slightly from the others. On the basis of the result of processing the ESR and optical spectra of gamma-irradiated lanthanum phosphate glasses synthesized under various conditions, the radiation yield of the RCC and the behavior of the intensity of their absorption under thermodecoloration are significantly affected by the conditions of synthesis of the glass.

18 CFR 141.400 - FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas...

Science.gov (United States)

2010-04-01

..., Quarterly financial report of electric utilities, licensees, and natural gas companies. 141.400 Section 141..., licensees, and natural gas companies. (a) Prescription. The quarterly report of electric utilities, licensees, and natural gas companies, designated as FERC Form No. 3-Q, is prescribed for the reporting...

40 CFR 141.562 - My system only has two or fewer filters-is there any special provision regarding individual...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 22 2010-07-01 2010-07-01 false My system only has two or fewer filters-is there any special provision regarding individual filter turbidity monitoring? 141.562 Section 141.562 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

Completion summary for boreholes USGS 140 and USGS 141 near the Advanced Test Reactor Complex, Idaho National Laboratory, Idaho

Science.gov (United States)

Twining, Brian V.; Bartholomay, Roy C.; Hodges, Mary K.V.

2014-01-01

In 2013, the U.S. Geological Survey, in cooperation with the U.S. Department of Energy, drilled and constructed boreholes USGS 140 and USGS 141 for stratigraphic framework analyses and long-term groundwater monitoring of the eastern Snake River Plain aquifer at the Idaho National Laboratory in southeast Idaho. Borehole USGS 140 initially was cored to collect continuous geologic data, and then re-drilled to complete construction as a monitor well. Borehole USGS 141 was drilled and constructed as a monitor well without coring. Boreholes USGS 140 and USGS 141 are separated by about 375 feet (ft) and have similar geologic layers and hydrologic characteristics based on geophysical and aquifer test data collected. The final construction for boreholes USGS 140 and USGS 141 required 6-inch (in.) diameter carbon-steel well casing and 5-in. diameter stainless-steel well screen; the screened monitoring interval was completed about 50 ft into the eastern Snake River Plain aquifer, between 496 and 546 ft below land surface (BLS) at both sites. Following construction and data collection, dedicated pumps and water-level access lines were placed to allow for aquifer testing, for collecting periodic water samples, and for measuring water levels. Borehole USGS 140 was cored continuously, starting from land surface to a depth of 543 ft BLS. Excluding surface sediment, recovery of basalt and sediment core at borehole USGS 140 was about 98 and 65 percent, respectively. Based on visual inspection of core and geophysical data, about 32 basalt flows and 4 sediment layers were collected from borehole USGS 140 between 34 and 543 ft BLS. Basalt texture for borehole USGS 140 generally was described as aphanitic, phaneritic, and porphyritic; rubble zones and flow mold structure also were described in recovered core material. Sediment layers, starting near 163 ft BLS, generally were composed of fine-grained sand and silt with a lesser amount of clay; however, between 223 and 228 ft BLS, silt

41 CFR 302-9.141 - What is the “authorized point of origin” when I transport a POV to my post of duty?

Science.gov (United States)

2010-07-01

... point of originâ when I transport a POV to my post of duty? 302-9.141 Section 302-9.141 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND... Transportation Pov Transportation at Time of Assignment § 302-9.141 What is the “authorized point of origin” when...

25 CFR 141.18 - Availability of employee authorized to transact business.

Science.gov (United States)

2010-04-01

... hours an employee authorized in writing to engage in all business transactions that the licensee... 25 Indians 1 2010-04-01 2010-04-01 false Availability of employee authorized to transact business... ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.18...

Tm3+ activated lanthanum phosphate: a blue PDP phosphor

International Nuclear Information System (INIS)

Rao, R.P.

2005-01-01

Plasma display panels (PDPs) are gaining attention due to their high performance and scalability as a medium for large format TVs. The performance and life of a PDP strongly depends upon the nature of phosphors. Currently, Eu 2+ activated barium magnesium aluminate (BAM) is being used as a blue component. Because of its low life, efforts are being made to explore new blue emitting phosphors. One of the alternatives to BAM is Tm 3+ activated lanthanum phosphate (LPTM) phosphor. LPTM phosphor samples are prepared by a solid-state as well as sol-gel process in presence of flux. The phosphor of the present investigation, having uniform and spherical shape particles in the range of 0.1-2 μm, is appropriate for thin phosphor screens required for PDP applications. It exhibits a narrow band emission in the blue region, peaking at 452 nm and also a number of narrow bands in the UV region when excited by 147 and 173 nm radiation from a xenon gas mixture. Various possible transitions responsible for UV and visible emission from Tm 3+ ion are presented. These phosphors also exhibit good color saturation and better stability when excited with VUV radiation. To achieve higher brightness, they are blended with other UV excited blue emitting phosphors such as BAM. Results related to morphology, excitation, after glow decay, emission and degradation of these phosphors in the powder form as well as in plasma display panels are presented and discussed

Kinetics and thermodynamic for sorption of arsenate by Lanthanum-exchanged zeolite

International Nuclear Information System (INIS)

Mohd Jelas Haron; Saiful Adli Masdan; Mohd Zobir Hussein; Zulkarnain Zainal; Anuar Kassim

2007-01-01

Zeolites are crystalline, hydrated aluminosilicate containing exchangeable alkaline and alkaline earth cations in their structural frameworks. Since zeolites have permanent negative charges on their surfaces, they have no affinity for anions. However recent studies have shown that modification of zeolites with certain surfactants or metal cations yield sorbents with a strong affinity for many anions. In this paper, modification of zeolites (zeolite A, X and ZSM5) were performed by exchange of naturally occurring cations with lanthanum ion that forms low solubility arsenate salt. The exchanged zeolites were used to sorb arsenate from aqueous solution. Among parameters investigated were effect of pH, arsenate initial concentrations, contact time and temperature. The maximum exchanged capacity of La (III) ion was obtained when using solution with initial pH of 4. Zeolite X gives the highest La (III) exchanged capacity compared to other zeolites. The results showed that As (V) sorption by La-zeolites occurred at about pH 6.5 and increased as pH increased and reaching maximum at equilibrium pH about 7.8. On the other hand, almost no arsenate sorption occurred on un exchanged zeolites. This indicates that La (III) ion on the exchanged zeolites is taking part on the As(V) sorption via surface precipitation. The results also showed that the sorption capacities increased with increasing initial As (V) concentrations. The sorption followed Langmuir model with maximum sorption capacities of 0.41, 0.21 and 0.19 mmol/g at 25 degree Celsius for La exchanged zeolite X (La-ZX), La exchanged zeolite ZSM5 (La-ZSM) and La exchanged zeolite A (La-ZA), respectively. The amounts of sorption of As (V) by La exchanged zeolite increased as temperature increased from 25 to 70 degree Celsius indicating that the process is endothermic. The free energy changes ( ΔG degree) for the sorption at 25 degree Celsius were -10.25, -9.65 and -8.49 kJ/ mol for La-ZX, La-ZSM and La-ZA, respectively. The

Sierra Leone Journal of Biomedical Research Vol. 2 (2) pp. 135-141 ...

African Journals Online (AJOL)

Owner

135-141, December, 2010. ISSN 2219-3170(Online) ... 72 hours of unprotected sex to prevent unwanted pregnancy. ... purchase it from pharmacies since it is sold as an over-counter ..... However 65.9% signified their intention to participate if ...

Yttrium and lanthanum recovery from low cerium carbonate, yttrium carbonate and yttrium concentrate; Aproveitamento de itrio e lantanio de um carbonato de terras raras de baixo teor em cerio, de um carbonato de itrio e de um oxido de terras itricas

Energy Technology Data Exchange (ETDEWEB)

Vasconcelos, Mari Estela de

2006-07-01

In this work, separation, enrichment and purification of lanthanum and yttrium were performed using as raw material a commercial low cerium rare earth concentrate named LCC (low cerium carbonate), an yttrium concentrate named 'yttrium carbonate', and a third concentrated known as 'yttrium earths oxide. The first two were industrially produced by the late NUCLEMON - NUCLEBRAS de Monazita e Associados Ltda, using Brazilian monazite. The 'yttrium earths oxide' come from a process for preparation of lanthanum during the course of the experimental work for the present thesis. The following techniques were used: fractional precipitation with urea; fractional leaching of the LCC using ammonium carbonate; precipitation of rare earth peroxycarbonates starting from the rare earth complex carbonates. Once prepared the enriched rare earth fractions the same were refined using the ion exchange chromatography with strong cationic resin without the use of retention ion and elution using the ammonium salt of ethylenediaminetetraacetic acid. With the association of the above mentioned techniques were obtained pure oxides of yttrium (>97,7%), lanthanum (99,9%), gadolinium (96,6%) and samarium (99,9%). The process here developed has technical and economic viability for the installation of a large scale unity. (author)

Investigation of thermal transformation of lanthanum and neodymium hydroxides by IK-spectroscopy

International Nuclear Information System (INIS)

Filippova, A.A.; Davydov, A.A.; Shchekochikhin, Yu.M.

1976-01-01

The spectral polymorphic transformations of lanthanum and neodymium oxides at the thermal decomposition of the hydroxides and carbonates of these elements are studied. The thermal decomposition was observed during 3-5 hours. The i.r. spectra of the decomposition products were measured for temperatures of 100-1000 0 C. The i.r. spectra of C-Nd 2 O 3 , of A-Nd 2 O 3 , of C-La 2 O 3 and of A-La 2 O 3 were obtained in the range of 250-4000cm -1 . The spectral consequences of the C→A-Nd 2 O 3 polymorphic transformation were also studied for the decomposition of the neodymium carbonate. The spectra of the calcination products of the hydroxides (400-700 0 C) are similar to characteristic spectra of cubic rare earth oxides in the spectral range of 250-700cm -1 . An increase of the calcination temperature (800-1000 0 C) leads to changes in the oxide spectrum. New maxima appear at 260, 360 and 450cm -1 . The absorption bands characteristic for cubic oxide lattices disappear. From spectral data it can be concluded that neodymium carbonate begins to decompose at 450 0 C if it is heated in vacuum. The decomposition products are oxycarbonate and oxide. The maximum at 520cm -1 confirms the crystallization of the oxide in the cubic C-form. At 800 0 C the polymorphic transformation C→A-Nd 2 O 3 sets in. In the oxide spectra traces of the carbonate can still be detected up to the polymorphic transformation temperature. From a comparison of X-ray and spectral data it is followed that the i.r. spectra of the decomposition product of the lanthanum hydroxide at 500 0 C are essentially the spectra of C-La 2 O 3 which are characterized by the absorption bands at 320, 340, 380 and 495cm -1 . The absorption band of A-La 2 O 3 , which is present in the sample, is not observed. I.r. spectra of C-La 2 O 3 are very similar to the spectra of the cubic form of rare earth oxides in the range of 250-600cm -1 . Changes in the spectrum at 600 0 C can be explained by the polymorphic transformation

Spark plasma sintering of hydrothermally derived ultrafine Ca doped lanthanum chromite powders

Directory of Open Access Journals (Sweden)

Rendón-Angeles, J. C.

2006-08-01

Full Text Available Lanthanum chromite nano-particles, with a composition of La0.9Ca0.1CrO3 and La0.8Ca0.2CrO3, were produced by 1 h of hydrothermal reaction at 400 and 425°C respectively. The sintering of the powders was conducted using a spark plasma apparatus over the temperature range 1300-1550ºC for 1 min with a constant loading pressure of 45 MPa. Additional sintering experiments using conventional firing were carried out for comparison. Fully densified (98 % r.d. lanthanum chromite pellets with fine equiaxial grains 2.3 μm in size were obtained using the SPS (spark plasma sintering method. In contrast, a maximum relative density of 97 % was produced using La0.8Ca0.2CrO3 sintered conventionally at 1400ºC for 300 min, and the average grain size of the resulting sintered sample was 6 μm.

Partículas ultrafinas de cromita de lantano, con una composición de La0.9Ca0.1CrO3 y La0.8Ca0.2CrO3, se obtuvieron después de 1 hora de síntesis hidrotermal a las temperaturas de 400 y 425°C respectivamente. Los compuestos obtenidos, con un tamaño de partícula de ~ 200 nm, se caracterizaron utilizando las técnicas de DRX, MEB y MET. La sinterización de estos polvos se efectuó en un equipo de chispa de plasma en el rango de temperatura de 1300-1500°C durante 1 min, y a una presión de compactación de 45 MPa. Ambos polvos también se sinterizaron siguiendo un tratamiento térmico convencional, en aire, con el propósito de comparar ambos métodos de sinterización. Las muestras de cromita de lantano sinterizadas por plasma presentaban una densidad relativa del 98 % (/t; y una microestructura monofásica con granos equaxiales con un tamaño medio de grano menor de 2.3 μm. En contraste, la composición La0.8Ca0.2CrO3, sinterizada a 1400°C/300 min, por métodos convencionales alcanzó una densidad relativa máxima del 97 % y su microestructura estaba formada por una sola fase con un tamaño medio de grano de 6 μm.

Spectroscopic properties of Er/Nd co-doped yttrium lanthanum oxide transparent ceramics pumped at 980 nm

Energy Technology Data Exchange (ETDEWEB)

Shao, Yingjie; Yang, Qiuhong, E-mail: yangqiuhong@shu.edu.cn; Gui, Yan; Yuan, Ye; Lu, Qing

2016-05-15

(Er{sub 0.01}Nd{sub x}Y{sub 0.89-x}La{sub 0.1}){sub 2}O{sub 3} (x = 0, 0.001, 0.002, 0.005, 0.01) transparent ceramics were prepared by conventional ceramic processing. The Nd{sup 3+} content dependencies of mid-infrared, near infrared and up-conversion emission of Er{sup 3+} pumped at 980 nm were fully presented. Mechanism of energy transfer between Er{sup 3+} and Nd{sup 3+} was also demonstrated. The results showed that co-doping 0.1 at% Nd{sup 3+} into 1 at% Er{sup 3+} doped yttrium lanthanum oxide transparent ceramic enhanced the 2.7 μm emission significantly and meanwhile suppressed the 1.5 μm emission effectively which indicated an improvement in population inversion between Er:{sup 4}I{sub 11/2} and Er:{sup 4}I{sub 13/2}. Moreover, green up-conversion emission of Er{sup 3+} ion also showed a great improvement by co-doping 0.1 at% Nd{sup 3+}. Those great results were attributed to energy recycle from Er:{sup 4}I{sub 13/2} to Er:{sup 4}I{sub 11/2}. The energy recycle was mainly built by the two energy transfer between Er{sup 3+} and Nd{sup 3+} (one is from Er to Nd, another is in opposite way). So, Er/Nd co-doped yttrium lanthanum oxide transparent ceramic with Nd in low concentration can be considered as a promising laser material for ∼3 μm and up-conversion laser application. - Highlights: • (Er{sub 0.01}Nd{sub x}Y{sub 0.89-x}La{sub 0.1}){sub 2}O{sub 3} transparent ceramics were prepared. • The emission of 2.7 μm of Er{sup 3+} ion was significantly enhanced as x was 0.001. • The emission of 1.5 μm of Er{sup 3+} ion was suppressed greatly by co-doping Nd{sup 3+} ion. • Mechanism of Er–Nd energy transfer was discussed by the energy sketch.

Effects of DTPA aerosol on lung contamination by lanthanum; Influence du DTPA en aerosol sur les contaminations pulmonaires au lanthane

Energy Technology Data Exchange (ETDEWEB)

Pasquier, C; Voisin, D; Thieblement, P; Perrault, G; Bayard, J [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1969-07-01

Applying DTPA aerosol for the treatment of lung contamination by lanthanum we were able to determine its effectiveness as a function of time. Provided it was administered early during the two hours after exposure, over 50 per cent could be removed using lower therapeutic doses than those prescribed for other routes of administration. Its association with some enzymes did not enhance the chelator therapeutic effect. We also calculated the constant of passage of lanthanum through the alveolar wall and found a value of 0.016 mn{sup -1}. Finally, as we have discovered a large part cannot be mobilized by DTPA, we shall now study the physico-chemical mechanisms involved in this protection. (authors) [French] L'emploi du DTPA en aerosol dans le traitement des contaminations pulmonaires par le lanthane, nous a permis d'etablir et d'evaluer son efficacite en fonction du temps. A condition d'etre utilise precocement, dans les deux heures qui suivent la contamination, une fraction superieure a 50 pour cent peut etre eliminee et ceci avec des doses therapeutiques inferieures a celles preconisees pour les autres voies d'administration. L'association avec quelques autres enzymes n'a pas permis d'ameliorer l'effet therapeutique de ce chelateur. Nous avons egalement chiffre la constante de passage du lanthane a travers la barriere alveolaire dont la valeur est de l'ordre de 0.016 mn{sup -1} Enfin, la decouverte d'une importante partie non piegeable par le DTPA nous amene maintenant a etudier les mecanismes physico-chimiques de cette protection. (auteurs)

Structural transition in lanthanum gallate and transformation of the fine structure of the EPR spectrum of a Gd3+ impurity center

Science.gov (United States)

Vazhenin, V. A.; Guseva, V. B.; Fokin, A. V.; Potapov, A. P.; Artyomov, M. Yu.

2011-04-01

Abrupt changes in resonance positions, hysteretic temperature behavior, and coexistence of phases, which indicate a first-order phase transition, have been revealed from measurements of temperature dependences of the EPR spectra of Gd3+ and Mn4+ centers in the vicinity of the structural transition of lanthanum gallate. The transformation of monoclinic Gd3+ centers into trigonal Gd3+ centers upon the phase transition has been used to estimate the adequacy of two approximations of the superposition model for parameters of the zero-field splitting of the ground state.

7 CFR 400.141 - Internal Revenue Service (IRS) Tax Refund Offset.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Internal Revenue Service (IRS) Tax Refund Offset. 400...-Regulations for the 1986 and Succeeding Crop Years § 400.141 Internal Revenue Service (IRS) Tax Refund Offset... debt owing to any Federal agency by offset against a taxpayer's Federal income tax refund. This section...

Mixed ionic-electronic conduction in Ni doped lanthanum gallate perovskites

Energy Technology Data Exchange (ETDEWEB)

Long, N.J.; Tuller, H.L.

1998-07-01

Lanthanum gallate is a promising material for monolithic fuel cells or oxygen pumps, i.e., one in which the electrolyte and electrodes are formed from a common phase. The authors have investigated La{sub 1{minus}x}Sr{sub x}Ga{sub 1{minus}y}Ni{sub y}O{sub 3} (LSGN{sub x{minus}y}) with x = 0.1 and y = 0.2 and 0.5 as a potential cathode material for such an electrochemical device. The {sigma}(PO{sub 2},T) for LSGN{sub 10--20} points to a p-type electronic conductivity at high PO{sub 2} and predominantly ionic conductivity at low PO{sub 2}. LSGN{sub 10-50} has an electronic conductivity suitable for SOFC applications of approximately 50 S/cm in air at high temperature. AC impedance spectroscopy on an electron blocking cell of the form M/LSG/LSGN/LSG/M was used to isolate the ionic conductivity in the LSGN{sub 10--20} material. The ionic conductivity was found to have a similar magnitude and activation energy to that of undoped LSG material with {sigma}{sub i} = 0.12 S/cm at 800 C and E{sub A} = 1.0 {+-} 0.1 eV. Thermal expansion measurements on the LSGN materials were characterized as a function of temperature and dopant level and were found to match that of the electrolyte under operating conditions.

Removing Phosphorus from Aqueous Solutions Using Lanthanum Modified Pine Needles.

Directory of Open Access Journals (Sweden)

Xianze Wang

Full Text Available The renewable pine needles was used as an adsorbent to remove phosphorus from aqueous solutions. Using batch experiments, pine needles pretreated with alkali-isopropanol (AI failed to effectively remove phosphorus, while pine needles modified with lanthanum hydroxide (LH showed relatively high removal efficiency. LH pine needles were effective at a wide pH ranges, with the highest removal efficiency reaching approximately 85% at a pH of 3. The removal efficiency was kept above 65% using 10 mg/L phosphorus solutions at desired pH values. There was no apparent significant competitive behavior between co-existing anions of sulfate, nitrate, and chloride (SO4(2-, NO3(- and Cl(-; however, CO3(2- exhibited increased interfering behavior as concentrations increased. An intraparticle diffusion model showed that the adsorption process occurred in three phases, suggesting that a boundary layer adsorption phenomena slightly affected the adsorption process, and that intraparticle diffusion was dominant. The adsorption process was thermodynamically unfavorable and non-spontaneous; temperature increases improved phosphorus removal. Total organic carbon (TOC assays indicated that chemical modification reduced the release of soluble organic compounds from 135.6 mg/L to 7.76 mg/L. This new information about adsorption performances provides valuable information, and can inform future technological applications designed to remove phosphorus from aqueous solutions.

Lanthanum cobalt oxides as models for La-promoted Co/{gamma}-Al{sub 2}O{sub 3} catalys

Energy Technology Data Exchange (ETDEWEB)

Hansteen, Ole Henrik

1998-12-31

Cobalt supported on {gamma}-Al{sub 2}O{sub 3} have for a long time been interesting catalysts for the synthesis of hydrocarbons by hydrogenation of carbonmonoxide, the so-called Fischer-Tropsch synthesis. The reduction and catalytic properties of these catalysts are largely improved by addition of promotors like rhenium and lanthanum. This thesis attempts to provide additional knowledge to the nature of the reduction processes from metal oxides via partially reduced phases into metal and to the large degree of interaction/reaction between the catalyst components. It focuses on detailed studies of model oxides in the La-Co-O and Co-Al-O systems under reducing conditions typically used for the synthesis of the catalysts. 132 refs., 41 figs., 16 tabs.