WorldWideScience

Sample records for kg abgereichertem uran

  1. Electrolytic production of uranous nitrate

    International Nuclear Information System (INIS)

    Orebaugh, E.G.; Propst, R.C.

    1980-04-01

    Efficient production of uranous nitrate is important in nuclear fuel reprocessing because U(IV) acts as a plutonium reductant in solvent extraction and can be coprecipitated with plutonium and/or throium as oxalates during fuel reprocessing. Experimental conditions are described for the efficient electrolytic production of uranous nitrate for use as a reductant in the SRP Purex process. The bench-scale, continuous-flow, electrolysis cell exhibits a current efficiency approaching 100% in combination with high conversion rates of U(VI) to U(IV) in simulated and actual SRP Purex solutions. High current efficiency is achieved with a voltage-controlled mercury-plated platinum electrode and the use of hydrazine as a nitrite scavenger. Conversion of U(VI) to U(IV) proceeds at 100% efficiency. Cathodic gas generation is minimal. The low rate of gas generation permits a long residence time within the cathode, a necessary condition for high conversions on a continuous basis. Design proposals are given for a plant-scale, continuous-flow unit to meet SRP production requirements. Results from the bench-scale tests indicate that an 8-kW unit can supply sufficient uranous nitrate reductant to meet the needs of the Purex process at SRP

  2. Photosynthesis of ammonium uranous fluoride

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Zaki, M.R.; Farah, M.Y.

    1975-01-01

    This study pertains to utilisation of solar energy for ethanol photosynthesis of ammonium uranous fluoride, that satisfies nuclear specifications needed for calcio- or magnesiothermy. Insolation in autumn using 4-10% ethanol in 5-20 g uranium/litre at initial pH 3.25 gave practically 99.8% yield in two hours, independant of 1.0 to 2.0 stoichiometric NH 4 F. With ultraviolet light, the yield varied between 30 and 60%, even after four hours irradiation. Stirring and heating to 60 0 C raised the tap density of the dried double fluorides from 1.48 at 30 0 C, to 1.85 g/cm 3 at 60 0 C. The texture increased also in fineness to 100% 50μ aggregates. The powders satisfy nuclear purity specifications. Thermograms indicated preferential decomposition of double fluoride at 375 0 C in controlled atmosphere to obtain nuclear pure anhydrous uranium tetrafluoride

  3. Investigations on cesium uranates and related compounds

    International Nuclear Information System (INIS)

    Egmond, A.B. van

    1976-01-01

    Crystal structures of cesium uranate are determined mainly by X-ray diffraction techniques. From phase studies it is concluded that of the Cs-U-O system, Cs 2 U 4 O 12 will play a prominent role in fuel elements of fast reactors due to fission product-fuel reactions causing swelling of the fuel and fuel-element failure. Crystal structures and lattice parameters are determined from Cs 2 U 4 O 12 , Cs 2 U 4 O 13 , Cs 2 U 5 O 16 , Cs 4 U 5 O 17 , Cs 2 U 7 O 22 , Cs 2 U 15 O 46 , Cs 2 UO 4 and Cs 2 U 2 O 7 . Finally some crystal structures of potassium and rubidium uranates are measured and a comparison of all available data on alkali uranates is made

  4. Cyclo nic separation of uranate dust

    International Nuclear Information System (INIS)

    Nadal, P.

    1976-01-01

    Size of particles of uranate dust which can be entrained by hot gases leaving a multiple-hearth furnace is determined. The convenience of the installation of a cyclone is discussed considering power of the fume-extractor and pressure-drop permissible in the system. (Author)

  5. COGEMA Experience in Uranous Nitrate Preparation

    International Nuclear Information System (INIS)

    Tison, E.; Bretault, Ph.

    2006-01-01

    Separation and purification of plutonium by PUREX process is based on a sequence of extraction and back extraction which requires reducing plutonium Pu IV (extractable form) into Pu III (inextractable form) Different reducers can be used to reduce Pu IV into Pu III. Early plants such as that for Magnox fuel at Sellafield used ferrous sulfamate while UP 1 at Marcoule used uranous sulfamate. These reducers are efficient and easy to prepare but generates ferric and/or sulphate ions and so complicates management of the wastes from the plutonium purification cycle. Recent plants such as UP3 and UP2 800 at La Hague, THORP at Sellafield, and RRP at Rokkasho Mura (currently under tests) use uranous nitrate (U IV) stabilized by hydrazinium nitrate (N 2 H 5 NO 3 ) and hydroxyl ammonium nitrate (HAN). In the French plants, uranous nitrate is used in U-Pu separation and alpha barrier and HAN is used in Pu purification. Compared to sulfamate, U IV does not generate extraneous chemical species and uranyl nitrate (U VI) generated by reducing Pu IV follows the main uranium stream. More over uranous nitrate is prepared from reprocessed purified uranyl nitrate taken at the outlet of the reprocessing plant. Hydrazine and HAN offer the advantage to be salt-free reagents. Uranous nitrate can be generated either by electrolysis or by catalytic hydrogenation process. Electrolytic process has been implemented in early plant UP 1 at Marcoule (when changing reducer from uranous sulfamate to uranous nitrate) and was used again in UP2 plant at La Hague. However, the electrolytic process presented several disadvantages such as a low conversion rate and problems associated with the use of mercury. Electrolysis cells with no mercury were developed for the Eurochemic plant in Belgium and then implemented in the first Japanese reprocessing plant in Tokai-Mura. But finally, in 1975, the electrolytic process was abandoned in favor of the catalytic hydrogenation process developed at La Hague. The

  6. Thermochemical evaluation and preparation of cesium uranates

    International Nuclear Information System (INIS)

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.

    1997-03-01

    Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  7. Efficient uranous nitrate production using membrane electrolysis

    International Nuclear Information System (INIS)

    Zhongwei Yuan; Taihong Yan; Weifang Zheng; Hongying Shuang; Liang Xian; Xiaoyan Bian; Chen Zuo; Chuanbo Li; Zhi Cao

    2013-01-01

    Electrochemical reduction of uranyl nitrate is a green, simple way to make uranous ion. In order to improve the ratio of uranous ion to the total uranium and maintain high current efficiency, an electrolyser with very thin cathodic and anodic compartment, which were separated by a cation exchange membrane, was setup, and its performance was tested. The effects of various parameters on the reduction were also evaluated. The results show that the apparatus is quite positive. It runs well with 120 mA/cm 2 current density (72 cm 2 cathode, constant current batch operation). U(IV) yield can achieve 93.1 % (500 mL feed, total uranium 199 g/L) after 180 min electrolysis. It was also shown that when U(IV) yield was below 80 %, very high current efficiency was maintained, and there was almost a linear relationship between uranous ion yield and electrolysis time; under the range of experimental conditions, the concentration of uranyl nitrate, hydrazine, and nitric acid had little effect on the reduction. (author)

  8. Direct reading spectrochemical analysis of sodium uranate

    International Nuclear Information System (INIS)

    Roca, M.; Capdevila, C.

    1966-01-01

    We describe the application of the quantometer to the analysis of sodium uranate. To determine boron, cadmium, phosphorus and molybdenum contents, the samples are mixed with graphite powder (1:30) and excited in a 10 amperes direct current arc with 4x4,,5 mm cup graphite rods, using silver as internal standard. A not se deep cup and a dilution factor of 90 are more suitable for calcium, copper, iron, silicon and vanadium determination; cobalt and chromium are the internal standards. (Author) 6 refs

  9. Thermochemical evaluation and preparation of cesium uranates

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Seichi; Ohashi, Hiroshi

    1997-03-01

    Two kinds of cesium uranates, Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7}, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U{sub 3}O{sub 8} and Cs{sub 2}CO{sub 3} for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  10. Thermal decomposition of ammonium uranate; X-ray study

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Rofail, N.H.; Khilla, M.A.

    1984-01-01

    Ammonium uranate was precipitated from a nuclear-pure uranyl nitrate solution using gaseous ammonia. Thermal decomposition of the obtained uranate, at different calcining temperatures, resulted in the formation of amorphous (A-)UO 3 , β-UO 3 , UOsub(2.9), U 3 O 8 (H) and U 3 O 8 (O). The influence of ammonia content, occluded nitrate ions and rate of heating, on the formation of these phases, was studied using X-ray powder diffraction analysis. The results indicated that ammonium uranate UO 2 (OH)sub(2-x)(ONH 4 )x . YH 2 O is a continuous non-stoichiometric system is a continuous non-stoichiometric system with no intermediate stoichiometric compounds and its composition varies according to mode of preparation. The results indicated also that the rate of heating and formation of hydrates are important factors for both UOsub(2.9) and U 3 O 8 (O) formation. (orig.)

  11. Software for Adapting Dspz Receivers to the Uran Interferometer Network

    Science.gov (United States)

    Isaeva, E. A.; Lytvynenko, O. A.; Shepelev, V. A.

    More than 10 years ago, URAN interferometer network (Megn A.V.,1997; Konovalenko A.A., 2014) had been equipped with newly designed receivers with a pass band extended up to 250 kHz and software rejection of interferences (Rashkovskii, 2012). The broadening of bandwidth of received signal increase the sensitivity of the receivers significantly and let us to investigate the angular structure about one hundred radio sources. A software package had been developed that allows: preparing a program of observations, carrying out observations automatically, making data cross-correlation, calculating visibility functions for all pairs of antennae, and fitting models of an angular structure of the sources. Data storage formats were elaborated for each stage of recording or processing. At present, new digital radio astronomy receiver DSPZ have been developed by IRA NASU (Zakharenko, 2016). The receiver allows recording an entire bandwidth of signals of a decameter range from 8 to 32 MHz. It is used at UTR-2 and URAN radio telescopes operated in a single dish mode. Application of the receivers for interferometer observation with the URAN network provides additional advantages in accuracy and sensitivity of studies. In this report we consider the data formats and synchronization methods used in URAN equipment and DSPZ receivers, and discuss algorithms of their transformation. Newly elaborated software is described, that allows selecting a set of frequency bands of signals recorded with DSPZ and converting them to the form used by the URAN software. This approach allows us to carry out the interferometer observations in an the extended frequency range provided by DSPZ and to use as much as possible the software package developed for the URAN network for data reduction.

  12. Structural characterization of ammonium uranate by infrared spectroscopy

    International Nuclear Information System (INIS)

    Rodriguez S, A.

    1994-01-01

    Infrared spectroscopy have been used to investigate the chemical composition of some ammonium uranates. In this study, I have attempted to establish the interrelationship between the structure of the products, the character of their infrared spectra and x-ray diffraction data capable of consistent interpretation in terms of defining the compounds. (Author)

  13. Uranium and drinking water; Uran und Trinkwasser

    Energy Technology Data Exchange (ETDEWEB)

    Konietzka, Rainer [Umweltbundesamt, Berlin (Germany). Fachgebiet II 3.6 - Toxikologie des Trink- und Badebeckenwassers; Dieter, Hermann H.

    2014-03-01

    Uranium is provoking public anxiety based on the radioactivity of several isotopes and the connection to nuclear technology. Drinking water contains at the most geogenic uranium in low concentrations that might be interesting in the frame of chemical of toxicology, but not due to radiological impact. The contribution gives an overview on the uranium content in drinking water and health effects for the human population based on animal tests. These experiments indicate a daily tolerable intake of 0.2 microgram per kg body mass. The actual limiting value for uranium in drinking water is 0.3 microgram per kg body mass water (drinking water regulation from 2001).

  14. Thermal and chemical analysis of ammonium uranates and intermediate oxides

    International Nuclear Information System (INIS)

    Farah, M.Y.; El-Fekey, S.A.

    1977-01-01

    NH + 4 /U ratio, in ammonium uranate, decreases markedly with lower pH of precipitation, dilution of ammonia used for washing as also rinsing by acetone, methanol, or boiling water and it varies between 0.23 and 0.54. Thermogravimetric plots indicated that variation in percentage loss of weight between 220 deg and 660 deg C was seriously influenced by washing mode. Storing UO 3 under ammonium nitrate solution revealed, that a fraction could have been introduced from aqueous media by cation exchange mechanism. The percentage decreases in weight between 220 deg and 660 deg C. increased from 1.9% for nuclear pure UO 3 , to 3,2% for the trioixde immersed in ammonium nitrate, indicating some uptake of ammonia, amounting to a value of 0.053 to NH + 4 /U. To elucidate the type of binding, the behavior during uranate calcination at various temperatures, durations and depth of calcined layers in tray, was investigated in function of NH + 4 /U ratio. Finally, the study suggested an analytical method for determination of uranium in pure ammonium uranate powders, applicable for both routine and academic works

  15. Role of ion transfer membrane in the production of uranous nitrate

    International Nuclear Information System (INIS)

    Nair, M.K.T.; Singh, R.K.; Bajpai, D.D.; Venugopalan, A.K.; Singh, R.R.; Gurba, P.B.; Thomas, Mathew

    1992-01-01

    In Purex process, plutonium and uranium are co-extracted into organic phase and these are partitioned by reducing Pu(IV) to Pu(III) using hydrazine stabilized uranous nitrate solution. Usually, uranous nitrate is added in much higher quantity than the stoichiometric requirement to effect complete reduction of plutonium. In conventional electrolytic cells only 60 to 70% of uranyl to uranous conversion is achieved. Use of this solution results in dilution of plutonium product. In addition to this, each externally fed uranous nitrate batch increases uranium processing load and affects the plant throughput. In order to keep the additional uranium processing load to a minimum, it is necessary to increase the uranous content to near cent percent level in the externally fed uranous nitrate solution. The studies carried out at PREFRE (Power Reactor Fuel Reprocessing) laboratory have shown that it is possible to produce concentrated uranous nitrate solution, nearly free from uranyl nitrate, by using a cation exchange membrane. This paper describes the development work carried out at PREFRE plant, Tarapur for production of cent percent uranous nitrate solution. Development of electrolytic cells for uranous production, from laboratory scale to pilot plant scale, has been explained. (author). 24 refs., 8 figs., 8 tabs

  16. Alkali-iodide/urania systems at high temperatures. 1. Cesium uranate chemistry

    International Nuclear Information System (INIS)

    McFarlane, J.; LeBlanc, J.C.

    1994-09-01

    Uranate compounds are likely to form in irradiated fuel from the reaction between UO 2 and fission products along UO 2 grain boundaries and in the fuel-cladding gap. Literature on the high-temperature chemistry of cesium and rubidium uranates was reviewed. Results from Knudsen cell experiments from 900 to 2600 K on cesium uranates are discussed. These studies indicate that the uranate phases formed depend on the oxygen potential of the system, which varies with the composition of the condensed phase. 62 refs., 12 figs., 6 tabs., 2 appendices

  17. Studies on the calcination of ammonium uranates with special reference to density

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Rofail, N.H.; Farah, M.Y.

    1980-01-01

    The objective of this study was to throw some light on ammonium uranates precipitated from uranyl nitrate solution using ammonia or urea. The effect of washing the uranates, thickness of their layers on the trays during subsequent calcination, temperature and duration, on the densities of powders formed during thermal decomposition was studied. (author)

  18. Infrared absorption study of ammonium uranates and uranium oxide powders formed during their thermal decomposition

    International Nuclear Information System (INIS)

    Rofail, N.H.; ELfekey, S.A.

    1992-01-01

    Ammonium uranates (AU) were precipitated from a nuclear-pure uranyl nitrate solution using different precipitating agents. IR spectra of the obtained uranates and oxides formed during their thermal decomposition have been studied. The results indicated that the precipitating agent, mode of stirring, washing and calcining temperature are important factors for a specific oxide formation.4 FIG., 3 TAB

  19. Structural analysis of the TRansUranic PACkage Transporter (TRUPACT)

    International Nuclear Information System (INIS)

    Lamoreaux, G.H.; Sutherland, S.H.; Duffey, T.A.

    1981-07-01

    The TRansUranic PACkage Transporter (TRUPACT) is a Type B container under development at the Transportation Technology Center, Sandia National Laboratory, for use in the transportation of contact-handled transuranic waste. This report describes the numerical analyses of the container's response to end-on, side-on, and center of gravity over corner impacts on an unyielding surface following a 9 m free fall. The results of the analyses are compared to available experimental data. In general, the analytical predictions and experimental comparisons confirm the validity of the TRUPACT design concept

  20. Recuperation of uranous salt samples found in a laboratory in the capital city (Niamey)

    International Nuclear Information System (INIS)

    Aissata, N.; Hamadou, K.; Almoustapha, T.

    2008-01-01

    A large quantity of uranous salt samples was found in an unused laboratory in Niamey (Capital City). The National Center of Radiation Protection (Centre National de Radioprotection (CNRP)), in collaboration with the Ministry of Mines and Energy (MM/E), has carried out the recuperation of several hundred kilograms of uranous salt and the decontamination of the area. At the end of the operation, 1813 uranous salt samples with average mass of 250 grams and two old calibration sources were found. Such quantities of uranous salt powder, hold near the river without control is a real hazard for the public because of probable act of vandalism. The regulatory body might continue in informing and sensitizing workers and public for recovering other orphaned sources and prevent sanitary hazards as the one solved at the ONAREM Laboratory. (author)

  1. Relations between red beds times and uranic mineralization at the area of north-west China, Shaanxi and Inner Mongolia

    International Nuclear Information System (INIS)

    Zhou Qiaosheng; Quan Zhigao

    1989-04-01

    Rad beds played an important role in the uranic mineralization. After analyzing the geological evolution in North-West China, Saanxi and Inner Mongolia the red beds is divided into six periods. The evolution rules at each period are studied. The authors found that the time of uranic mineralication and formation of red beds (basin) is simultaneously, the uranic deposits and red beds are accompanying minerals in all places existing deposits. Uranic mineralization is bound up with the continental red beds which was formed under dry and hot climate, but has no relations with the marine red beds. The place where the deposits exist, the red beds must exist, conversely it is not true. In the section, a big uranic deposit is generated only under or above the red beds. The relations between red beds and rich deposit are also explored. The mineralization theory and the model of uranic mineralization in red beds times are presented

  2. Chemical stability and physical properties of Caesium uranates

    International Nuclear Information System (INIS)

    Berton, J.P.; Baron, D.; Coquerelle, M.

    1998-01-01

    Caesium is one of the most abundant fission products in PWR nuclear fuel or in fast reactor fuel as well. A work program has been started at the TUI Karlsruhe, in collaboration with EDF Etudes et Recherches, to determine the thermal stability and conductivity, the mechanical properties and the thermal expansion coefficient of Cs 2 UO 4 . The Caesium mono-uranate was obtained by a chemical reaction between Cs 2 O 3 and U 3 O 8 powders mixed together, pressed and heated at 670 deg. C for 24 hours. The compound was found stable up to 830 deg. C. Mechanical compressive hardening tests allowed to evaluate the elastic modulus versus temperature in the range 200 to 800 deg. C. Furthermore the viscous behaviour of the compound above 400 deg. C was confirmed. The thermal expansion coefficient of Cs 2 UO 4 was found somewhat 40% higher than the thermal expansion coefficient of UO 2 . The thermal conductivity is about 1.5 to 1.8 W/m/K for temperatures ranging from 100 to 700 deg. C, a value very similar to the UO 2 fuel thermal conductivity at high burnup in the same temperature range. (author)

  3. Selective recovery of uranium from Ca-Mg uranates by chlorination

    International Nuclear Information System (INIS)

    Pomiro, Federico J.; Gaviría, Juan P.; Quinteros, Raúl D.

    2017-01-01

    A chlorination process is proposed for the uranium extraction and separation using Calcium−Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO 4 ) as reaction product. The formation of U 3 O 8 and MgU 3 O 10 was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h −1 of chlorine and 10 hs of reaction at 700 °C being U 3 O 8 the single uranium product obtained. - Highlights: •The chlorination is an effective method for the recovery uranium from Ca-Mg uranates. •The optimal conditions were: 10 hs of reaction time at 700 °C using 3 l/h of Cl 2 (g). •U 3 O 8 is recovery by washing out the chlorination by-products.

  4. Preparation of uranium dioxide by thermal decomposition and direct reduction of ammonium uranate

    International Nuclear Information System (INIS)

    Hernandez R, R.

    1995-01-01

    The thermal decomposition of ammonium uranate has been studied by infrared spectroscopy, and X-ray diffraction. It has been show that ammonia remains in the solid until substantially 350 Centigrade degrees, when gaseous nitrogen is released. It is concluded that compounds derived from the calcination of ammonium uranate at atmospheric pressure, produced amorphous U O 3 at about 350-400 Centigrade degrees and transform to U 3 O 8 via α - U O 3 and/or α - U O 3 . The object of this study was to obtain reliable fundamental information regarding the character of the pure carbon monoxide-ammonium uranate-uranium trioxide-uranium octaoxide reaction, in the range of temperatures that has been used in commercial reduction processes. Through the use of high-purity samples and by the proper control of incidental variable, this object was realized. (Author)

  5. Cyclo nic separation of uranate dust; Separacion de polvos de uranato por ciclonado

    Energy Technology Data Exchange (ETDEWEB)

    Nadal, P

    1976-07-01

    Size of particles of uranate dust which can be entrained by hot gases leaving a multiple-hearth furnace is determined. The convenience of the installation of a cyclone is discussed considering power of the fume-extractor and pressure-drop permissible in the system. (Author)

  6. Selective recovery of uranium from Ca-Mg uranates by chlorination

    Science.gov (United States)

    Pomiro, Federico J.; Gaviría, Juan P.; Quinteros, Raúl D.; Bohé, Ana E.

    2017-07-01

    A chlorination process is proposed for the uranium extraction and separation using Calciumsbnd Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO4) as reaction product. The formation of U3O8 and MgU3O10 was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h-1 of chlorine and 10 hs of reaction at 700 °C being U3O8 the single uranium product obtained.

  7. THE SPEAKING OF POLITICIAN OF SINGLE POLITICAL PARTY: MODEL OF HİLMİ URAN / BİR TEK PARTİ POLİTİKACISININ PROPAGANDA KONUŞMALARI: HİLMİ URAN ÖRNEĞİ

    Directory of Open Access Journals (Sweden)

    Dr. Fahri SAKAL

    2007-11-01

    Full Text Available There had been some policy changes of the Republican People’s Party(CHP in the period of transition from one-party system to multi party system in Turkey. The Speeches of Hilmi Uran who was considered second man in CHP had full of examples regarding policy changes. Uran had appeared to be a politician who was ready to acknowledge the principals of multi party system. Some changes carried out by H. Uran, such as alliance with the USA, introduction of religious course in public schools, awareness for Soviet and left wing threats, the virtues o democracy.

  8. Selective recovery of uranium from Ca-Mg uranates by chlorination

    Energy Technology Data Exchange (ETDEWEB)

    Pomiro, Federico J., E-mail: pomiro@cab.cnea.gov.ar [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); Gaviría, Juan P. [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); Consejo Nacional de Investigaciones Científicas y Técnicas (CONICET) (Argentina); Quinteros, Raúl D. [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); and others

    2017-07-15

    A chlorination process is proposed for the uranium extraction and separation using Calcium−Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO{sub 4}) as reaction product. The formation of U{sub 3}O{sub 8} and MgU{sub 3}O{sub 10} was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h{sup −1} of chlorine and 10 hs of reaction at 700 °C being U{sub 3}O{sub 8} the single uranium product obtained. - Highlights: •The chlorination is an effective method for the recovery uranium from Ca-Mg uranates. •The optimal conditions were: 10 hs of reaction time at 700 °C using 3 l/h of Cl{sub 2}(g). •U{sub 3}O{sub 8} is recovery by washing out the chlorination by-products.

  9. The application of extraction chromatography for analysis of alkali and alkaline earth uranates

    International Nuclear Information System (INIS)

    Tomazic, B.; Cukovic, M.

    1978-01-01

    A method for rapid analysis of alkali and alkaline earth uranates is proposed. The method is based on the use of an HDEHP extraction chromatographic column, which makes possible quantitative separations of alkaline earth ions from macroamounts of uranium(VI). Composition of alkaline earth uranates, based on regression analysis, are presented. The results, which show that under the given experimental conditions alkaline earth triuranates precipitate, are in good agreement with previous data from same laboratory. In addition the HDEHP extraction chromatographic column can be suggested as a tool for separation of representative fission products from irradiated uranium for the purpose of determination of the burn-up factor of nuclear reactor materials. (T.G.)

  10. Uranous nitrate production using PtO2 catalyst and H2/H2 gas mixtures

    International Nuclear Information System (INIS)

    Rao, K.S.; Shyamlal, R.; Narayanan, C.V.; Patil, A.R.; Ramanujam, A.; Kansra, V.P.; Balu, K.; Vaidya, V.N.

    2001-01-01

    The feasibility of producing near 100% uranous nitrate, the partitioning agent used in the spent fuel reprocessing by Purex process, by catalytically reducing uranyl nitrate with H 2 and H 2 gas mixtures was extensively studied. As near quantitative reduction of uranyl nitrate could be easily achieved in laboratory scale studies, pilot plant scale reduction of uranyl nitrate was also carried out and five litres of uranyl nitrate of 100 g/1 could be quantitatively reduced in one hour. (author)

  11. Plutonium purification cycle in centrifugal extractors: comparative study of flowsheets using uranous nitrate and hydroxylamine nitrate

    International Nuclear Information System (INIS)

    Baron, P.; Dinh, B.; Mauborgne, B.; Drain, F.; Gillet, B.

    1998-01-01

    The extension of the UP2 plant at La Hague includes a new plutonium purification cycle using multi-stage centrifugal extractors, to replace the present cycle which uses mixer/settler banks. The advantage of this type of extractor is basically the compactness of the equipment and the short residence time, which limits solvent degradation, particularly when reprocessing fuel containing a high proportion of plutonium 238. Two types of reducing agents have been considered for the plutonium stripping operation, uranous nitrate and hydroxylamine nitrate. Uranous nitrate displays a very fast reduction kinetics, ideal for the very short residence time of the phases in the centrifugal extractors. However, its extractability in the organic phase exacerbates the undesirable re-oxidation of plutonium, which is present in high concentration in this stage of the process. The short residence time of the centrifugal extractors is an advantage in as much as it could conceivably be adequate to obtain a sufficient reduction efficiency, while minimizing undesirable re-oxidation mechanisms. Hydroxylamine nitrate helps to minimize undesirable re-oxidation and is the normal choice for this type of operation. However, the plutonium (IV) reduction kinetics obtained is slower than with uranous nitrate, making it necessary to check whether its use is compatible with the very short residence times of centrifugal extractors.This article discusses the feasibility studies employing these two reducing agents. (author)

  12. The subcritical mass limit, 2.4 kgU, for the JCO's precipitation tank

    International Nuclear Information System (INIS)

    Komuro, Yuichi

    1999-01-01

    The critical safety on the precipitation tank in JCO Corporation forming a critical accident in September 30, 1999 had to be guaranteed by limiting amount of uranium contained into charging solution. The limited value of uranic mass in the precipitation tank was determined to be 2.4 kg, and from the dissolution tank positioned at upstream of this tank a solution not excess amount of solution to this value was designed to be transferred. In the 2nd Accident Survey Committee, there were found some discussions on a leading method of this value. In order to answer some requirements for this, here was described on outlines on U.S. Nuclear Safety Guide, TID-7016 Rev. 1, leading method of the limited value in 2.4 kg, and safety tolerance. As a result of reinvestigation, as it was confirmed that 2.4 kg in the limited amount contained an sufficient safety tolerance qualitatively and in comparison with already critical data. (G.K.)

  13. Osaamisen kehittämisen haasteet, esteet ja kannusteet työuran keskivaiheen muutostilanteissa

    OpenAIRE

    Törmälä-Rantala, Päivi

    2017-01-01

    Työn tavoitteena oli tutkia osaamisen kehittämisen haasteita, esteitä ja kannusteita työuran puolivälissä. Tutkimuksessa selvitettiin, miksi toinen opiskelee ja koulutuksen avulla muuttaa työtilannettaan aktiivisesti, kun taas toinen jättää osaamisensa kehittämisen ja jämähtää samaan työtehtävään vuosiksi. Kartoitus toimi taustatietona Työterveyslaitoksen Taidot työhön –hankkeeseen. Hanke toteutettiin interventiona, ja siinä opastettiin ja kannustettiin ihmisiä parantamaan työllistymiskykyään...

  14. URANS simulations of separated flow with stall cells over an NREL S826 airfoil

    DEFF Research Database (Denmark)

    Sarlak Chivaee, Hamid; Nishino, T.; Sørensen, Jens Nørkær

    2016-01-01

    airfoil using unsteady Reynolds-averaged Navier-Stokes (URANS) approach. Results of the simulations are demonstrated in terms of mean flow velocity, lift and drag, as well as pressure distribution, and validated against available experimental data. The simulations are carried out with a wide computational......A series of wind tunnel measurements and oil flow visualization was recently carried out at the Technical University of Denmark in order to investigate flow characteristics over a 14% thick NREL S826 airfoil at low Reynolds numbers. This paper aims at presenting numerical simulations of the same...

  15. Direct reading spectrochemical analysis of sodium uranate; Analisis espectroquimico de lectura directa de uranato sodico

    Energy Technology Data Exchange (ETDEWEB)

    Roca, M; Capdevila, C

    1966-07-01

    We describe the application of the quantometer to the analysis of sodium uranate. To determine boron, cadmium, phosphorus and molybdenum contents, the samples are mixed with graphite powder (1:30) and excited in a 10 amperes direct current arc with 4x4,5 mm cup graphite rods, using silver as internal standard. A not se deep cup and a dilution factor of 90 are more suitable for calcium, copper, iron, silicon and vanadium determination; cobalt and chromium are the internal standards. (Author) 6 refs.

  16. The effect of pH on the properties of ammonium uranate precipitated with gaseous ammonia

    International Nuclear Information System (INIS)

    Woolfrey, J.L.

    1976-11-01

    Ammonium uranate (AU) powders were precipitated from a uranyl nitrate solution using gaseous ammonia to determine the effect of pH of precipitation on their composition and morphology. Increasing pH of precipitation increased the ammonia and nitrate contents and the specific surface area but decreased the crystallite size of the AU powders. The specific surface area was also increased by increasing the ammonia content of the powder. The composition and morphology of the powders were similar to those reported in the literature for AU precipitated with NH 4 OH. (author)

  17. Uranous nitrate production for purex process applications using PtO2 catalyst and H2/H2-gas mixtures

    International Nuclear Information System (INIS)

    Sreenivasa Rao, K.; Shyamali, R.; Narayan, C.V.; Patil, A.R.; Jambunathan, U.; Ramanujam, A.; Kansara, V.P.

    2003-04-01

    In the Purex process of spent fuel reprocessing. the twin objectives- decontamination and partitioning are achieved by extracting uranium (VI) and plutonium (IV) together in the solvent 30% TBP-dodecane and then selectively reducing Pu (IV) to Pu (III) in which valency it is least extractable in the solvent. Uranous nitrate stabilized with hydrazine nitrate is the widely employed partitioning agent. The conventional method of producing U(IV) is by the electrolytic reduction of uranyl nitrate with hydrazine nitrate as uranous ion stabilizer. Tre percentage conversion of U(VI) to U(IV) obtained in this method is 50 -60 %. The use of this solution as partitioning agent leads not only to the dilution of the plutonium product but also to increase in uranium processing load by each externally fed uranous nitrate batch. Also the oxide coating of the anode, TSIA (Titanium Substrate Insoluble Anode) wears out after a certain period of operation. This necessitates recoating which is quite cumbersome considering the amount of the decontamination involved. An alternative to the conventional electrolytic method of reduction of uranyl nitrate to uranous nitrate was explored at FRD laboratory .The studies have revealed that near 100% uranous nitrate can be produced by reducing uranyl nitrate with H 2 gas or H 2 (8%)- Ar/N 2 gas mixture in presence of PtO 2 catalyst. This report describes the laboratory scale studies carried out to optimize the various parameters. Based on these studies reduction of uranyl nitrate on a pilot plant scale was carried out. The design and operation of the reductor column and also the various studies carried out in the pilot plant studies are discussed. Near 100% conversion of uranyl nitrate to uranous nitrate and also the redundancy of supply of electrical energy make this process a viable alternative to the existing electrolytic method. (author)

  18. On the use of (U)RANS and LES approaches for turbulent incompressible single phase flows in nuclear engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Benhamadouche, Sofiane, E-mail: sofiane.benhamadouche@edf.fr

    2017-02-15

    Highlights: • The paper deals with the use of (U)RANS and LES in nuclear engineering applications. • It gives some ideas and guidelines to run high quality computations. • Some perspectives are drawn concerning the development of (U)RANS and LES approaches in the future. - Abstract: The present paper gives some ideas and guidelines in order to run high quality (U)RANS or LES computations. The paper starts with (U)RANS approaches, advocating the use of Reynolds Stress Models for complex flows and recommending further work on modeling of turbulent heat fluxes, which remains today too basic in industry. The superiority of wall-resolved models vs. wall-modeled in RANS is recalled and the use of adaptive wall treatment is suggested. The concept of Unsteady RANS is finally questioned. Then, important issues around LES are raised. The mesh refinement criteria are recalled for wall-resolved LES and the use of wall models addressed. The production of DNS and wall-resolved LES calculations for flow understanding and RANS validation is encouraged.

  19. Unified formulation for URANS and LES in DxUNSp code

    Directory of Open Access Journals (Sweden)

    Catalin NAE

    2009-09-01

    Full Text Available The aim of this work is to find a unified and efficient implementation of a LES turbulence model in an existing URANS CFD code, initially based on unsteady RANS equations with a k-ε turbulence model. This code has the capability to be developed for nonreacting/reacting multifluid flows in research applications. The paper intends to present mainly three aspects of this implementation for unstructured mesh based solvers, for high Reynolds compressible flows: the influence of the numerical reconstruction scheme on the results for compressible LES, the influence of the compressible SGS modeling and the efficient implementation of a wall-law based approach for complex geometry. The results will be presented for a test case (3D flow over a square cylinder at Reynolds = 22.000 [0] and compared with experimental data and other simulations. Some details for the computational efficiency and implementation on parallel computer cluster at INCAS will also be presented [0].

  20. Haemolytic activity of uranium compounds haemolysis by thermochemical derivatives of ammonium uranate

    International Nuclear Information System (INIS)

    Stuart, W.I.; Tucker, A.D.; Adams, R.B.

    1975-01-01

    A study has been made of the haemolytic action on human erythrocytes by ammonium uranate (AU) and various thermochemical products of AU. These products were obtained by heating AU in hydrogen at 5 0 C min -1 to various temperatures. Haemolysis has been interpreted in terms of a diffusion model which for each product yields a single parameter Ksub(N), the haemolytic activity factor. The magnitude of Ksub(N) is a convenient measure of the ability of a powder to damage erythrocytes. The haemolytic activity of certain thermochemical derivatives indicates an exceptionally high potential for damage to erythrocytes. Infrared and thermoanalytical measurements have shown that the high activity of these products derives principally from a self-reduction reaction, induced by heating AU to 400-420 0 C in hydrogen. (author)

  1. The preparation of UO2 powder: effect of ammonium uranate properties

    International Nuclear Information System (INIS)

    Woolfrey, J.L.

    1978-01-01

    Ammonium uranate (AU) powders were precipitated from a uranyl nitrate solution with gaseous ammonia. The decomposition of the powders in hydrogen was studied to determine those properties of AU which affect the decomposition reactions and influence the properties of the final UO 2 powder. The thermal decomposition was affected by the initial composition (ammonia and nitrate content) and the morphology of the AU powders. The amount of self-reduction increased with increasing combined ammonia content and decreased with increasing nitrate content. The specific surface area of the decomposed powder increased with increasing total ammonia content and initial surface area of the precursor AU powder. Thermal treatment of the decomposed powder can be used to modify such effects and, in commercial powder production, is used to control the properties of the final UO 2 powder. (Auth.)

  2. The luminescence properties of the octahedral uranate group in oxides with perovskite structure, ch. 3

    International Nuclear Information System (INIS)

    Hair, J.Th.W. de

    1976-01-01

    This chapter describes how the luminescence properties of the octahedral uranate group are influenced by the chemical constitution of its environment. Especially the quenching temperature of the emission is very sensitive. It is stronger influenced by the nature of the neighbouring B cations in the [100] direction than by the A cations in the [111] direction. This variation of the quenching temperature as a function of the chemical constitution of the host lattice is discussed in terms of a configurational coordinate model. The luminescence properties of uranium-activated oxides A 2+ La 3+ B + B'O 6 are also discussed. Remarkably enough in SrLaNaWO 6 -U the luminescence originates from UO 2 2+ groups. (Auth.)

  3. Interaction of Atmospheric Turbulence with Blade Boundary Layer Dynamics on a 5MW Wind Turbine using Blade-Boundary-Layer-Resolved CFD with hybrid URANS-LES.

    Energy Technology Data Exchange (ETDEWEB)

    Vijayakumar, Ganesh [National Renewable Energy Lab. (NREL), Golden, CO (United States); Pennsylvania State Univ., University Park, PA (United States); Brasseur, James [Pennsylvania State Univ., University Park, PA (United States); Univ. of Colorado, Boulder, CO (United States); Lavely, Adam; Jayaraman, Balaji; Craven, Brent

    2016-01-04

    We describe the response of the NREL 5 MW wind turbine blade boundary layer to the passage of atmospheric turbulence using blade-boundary-layer-resolved computational fluid dynamics with hybrid URANS-LES modeling.

  4. The treatment of large quantities of high fluorin contents UO2 by ammonium double uranate (ADU) techniques

    International Nuclear Information System (INIS)

    Wang Bangwu; Chen Ying

    2010-01-01

    The paper has discussed the sinter action of UO 2 in low temperature. The study indicates the over hot part of UO 2 by the deoxidization hot of oxidation uranate mostly results in the sinter in the process of trans form ADU into UO 2 . The UO 2 settling times in kiln little influences the sinter performance of UO 2 in the same condition of high fluorin contents UO 2 returning kiln, and high fluorin contents UO 2 returning kiln does not sinter UO 2 again. Experiment on large quantities of high fluorin contents UO 2 by Ammonium Double Uranate (ADU) techniques direct returning kiln, the result shows the sinter performance of UO 2 doesn't drop in the process of high fluor in contents UO 2 direct returning kiln, and the performance of UO 2 can meet specification. (authors)

  5. Monitoring of impact of anthropogenic inputs on water quality of mangrove ecosystem of Uran, Navi Mumbai, west coast of India.

    Science.gov (United States)

    Pawar, Prabhakar R

    2013-10-15

    Surface water samples were collected from substations along Sheva creek and Dharamtar creek mangrove ecosystems of Uran (Raigad), Navi Mumbai, west coast of India. Water samples were collected fortnightly from April 2009 to March 2011 during spring low and high tides and were analyzed for pH, Temperature, Turbidity, Total solids (TS), Total dissolved solids (TDS), Total suspended solids (TSS), Dissolved oxygen (DO), Biochemical oxygen demand (BOD), Carbon dioxide (CO2), Chemical oxygen demand (COD), Salinity, Orthophosphate (O-PO4), Nitrite-nitrogen (NO2-N), Nitrate-nitrogen (NO3-N), and Silicates. Variables like pH, turbidity, TDS, salinity, DO, and BOD show seasonal variations. Higher content of O-PO4, NO3-N, and silicates is recorded due to discharge of domestic wastes and sewage, effluents from industries, oil tanking depots and also from maritime activities of Jawaharlal Nehru Port Trust (JNPT), hectic activities of Container Freight Stations (CFS), and other port wastes. This study reveals that water quality from mangrove ecosystems of Uran is deteriorating due to industrial pollution and that mangrove from Uran is facing the threat due to anthropogenic stress. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Analysis of added resistance and seakeeping responses in head sea conditions for low-speed full ships using URANS approach

    Directory of Open Access Journals (Sweden)

    Yoo-Chul Kim

    2017-11-01

    Full Text Available The KVLCC2 and its modified hull form were investigated in regular head waves using Unsteady Reynolds Averaged Navier–Stokes (URANS methods. The modified KVLCC2 (named KWP-bow KVLCC2 is designed for reducing wave reflection from the bow. Firstly, the original KVLCC2 is studied for verification of the present code and methodology and the computed time history of total resistance and 2DOF motions (heave and pitch for the selected two wave length conditions are directly compared with the results obtained from KRISO towing tank experiment under the identical condition. The predicted added resistance, heave and pitch motion RAOs show relatively good agreement with the experimental results. Secondly, the comparison of performance in waves between KVLCC2 and KWP-bow KVLCC2 is carried out. We confirmed that newly designed hull form shows better performances in all the range of wave length conditions through both the computation and the experiment. The present URANS method can capture the difference of performance in waves of the two hull forms without any special treatment for short wave length conditions. It can be identified that KWP-bow KVLCC2 gives about 8% of energy saving in sea state 5 condition. Keywords: Added resistance in waves, Ship motion, URANS, KVLCC2

  7. Analisa Pembuatan Tabung Gas Lpg 3 Kg

    Directory of Open Access Journals (Sweden)

    Mustafa -

    2012-11-01

    Full Text Available Program konversi minyak tanah ke LPG merupakan program pemerintah yang bertujuan untuk mengurangisubsidi BBM, dengan mengalihkan pemakaian minyak tanah ke LPG. Tujuan analisa untuk mengetahui proses pembuatantabung gas, proses deep drawing dan metode pengelasan yang baik. Karena masih banyak orang yang takut memakai bahanbakar LPG tersebut karena takut meledak akibat kualitasnya yang kurang bagus. Deep Drawing atau biasa disebut drawingadalah salah satu jenis proses pembentukan logam, dimana bentuk pada umumnya berupa silinder dan selalu mempunyaikedalaman tertentu. Pada proses pembuatan tabung gas elpiji untuk mendisain suatu proses pembentukan logam , sepertipenarikan (drawing. Salah satu pekerjaan yang harus kita lakukan adalah menentukan atau memilih kapasitas mesin(energi, gaya, torsi serta perkakas dan peralatan yang akan digunakan untuk proses tersebut. Pada proses deep drawingdengan kecepatan tekan yang telah ditentukan (sesuai tabel daya tekan maksimal tidak boleh melebihi: 167,330 kg. Padaproses pengelasan circum, tegangan normal mencapai 61.16 kg/cm2, karena masih diatas uji ketahanan hidrostastik, makamasih dalam batas aman.

  8. Respiratory outcomes following 100 mg/kg v. 200 mg/kg of poractant ...

    African Journals Online (AJOL)

    In keeping with current evidence, the initial dose of poractant alpha was increased from 100 mg/kg to 200 mg/kg. e outcomes of newborns requiring treatment with surfactant before and aer this change were reviewed. Methods. Electronic clinical records were reviewed of infants admitted to ACH who received surfactant ...

  9. Effect of pH change on the primary uran-mica mineralization

    Energy Technology Data Exchange (ETDEWEB)

    Shmariovich, E M; Zhil' tsova, I G; Pakul' nis, G V; Shugina, G A [Ministerstvo Geologii SSR, Moscow

    1982-01-01

    Conditions of the formation of ore bodies of hexavalent uranium minerals represented by uranyl vanadates and phosphates which are primary and sedimented from low temperature solutions (carnotite deposits in calcretes and carnotite - autunite deposits in black shale formations) are considered. Thermodynamic curves of the solubility dependence of various uranyl minerals on pH medium in the absence of SO/sub 4//sup 2 -/ and CO/sub 3//sup 2 -/ ions and for sulphate-carbonate solutions have been calculated using dissociation constants of corresponding acids and ..delta..G/sup 0/f(298.15) values. It has been ascertained that uranyl mineral compounds according to the dependence of their solubility on ph medium form a distinct series from molybdates through arsenates, phosphates, vanadates and silicates to minerals of uranophane and kasolite group. It is shown that during the formation of infiltration deposits with uranyl mineralization a decisive role is played by the contrast change of pH value of medium caused by the presence of acid geochemical barrier (uranyl molybdates, arsenates, phosphates and vanadates are precipitating) or neutralizing alkaline barriers (uran-mica and uranyl silicates are precipitating) on the path of movement of oxygen metal-bearing solutions.

  10. Guest Foreword by Lord Phillips KG PC

    Directory of Open Access Journals (Sweden)

    Nicholas A. Phillips

    2012-04-01

    Full Text Available The Rt Hon The Lord Phillips of Worth Matravers KG PC, President of the Supreme Court of the United Kingdom of Great Britain and Northern Ireland Ambition and excellence. Those two words epitomize Qatar. Under the leadership of his Highness the Emir, this small State has set out to make an impact on the world that belies its size. Ambitious was the plan to have an international broadcasting station. Ambitious was the plan to build from scratch a Museum of Islamic Art. Ambitious was the bid – the successful bid to host the World Cup in 2022. Ambitious is the bid to stage the Olympic Games in 2020. Qatar not merely has ambitions, it realizes its ambitions. And when it does so it is not enough to say that the result is ‘world class’, for Qatar sets out to be a world leader in whatever it puts its hand to. Excellence is the norm. Al Jazeera has established itself as the broadcasting station of choice for many throughout the world. The Doha Museum of Islamic Art is recognized as being second to none. In addition, the scale and standard of development in Doha itself is setting new standards of excellence in the fields of architecture and civil engineering. Thus when Qatar focuses its energies on education and the law, high achievements are expected. I shall have the honour of helping to achieve those expectations when I succeed Lord Woolf as President of Qatar’s new and impressive Civil and Commercial Court. The College of Law at Qatar University is already achieving excellence in the field of legal education. So, naturally, all expect great things of this new International Review of Law and I am delighted to have been invited to welcome it by this foreword. The range of the first edition is both international and topical. Those countries that have experienced the turbulence of the Arab Spring are settling new constitutions, and other countries are bent on constitutional reform designed to avoid such turbulence. So an erudite article on

  11. Preparation of uranium dioxide by thermal decomposition and direct reduction of ammonium uranate; Preparacion del dioxido de uranio por descomposicion termica y reduccion directa del uranato de amonio

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez R, R

    1996-12-31

    The thermal decomposition of ammonium uranate has been studied by infrared spectroscopy, and X-ray diffraction. It has been show that ammonia remains in the solid until substantially 350 Centigrade degrees, when gaseous nitrogen is released. It is concluded that compounds derived from the calcination of ammonium uranate at atmospheric pressure, produced amorphous U O{sub 3} at about 350-400 Centigrade degrees and transform to U{sub 3} O{sub 8} via {alpha} - U O{sub 3} and/or {alpha} - U O{sub 3}. The object of this study was to obtain reliable fundamental information regarding the character of the pure carbon monoxide-ammonium uranate-uranium trioxide-uranium octaoxide reaction, in the range of temperatures that has been used in commercial reduction processes. Through the use of high-purity samples and by the proper control of incidental variable, this object was realized. (Author).

  12. The assessment of the radiation influence upon the uran mining personnel and data on miners irradiation consequence

    International Nuclear Information System (INIS)

    Glushinsky, M.V.; Zuevitch, F.I.; Ponfilov, A.P.; Bitkolov, N.Z.

    1993-01-01

    The results of investigation into the radiation exposure of mine workers, involved with underground uran mining and the retrospective study of miners lung cancer frequency covering a period of more than 40 years (1950∼1992) are represented. It is shown that integrated breathing system exposure value for all radiation factors was equal to 0.2-0.4 of allowable exposure according to home regulations. The miners mortality data shows that lung cancer death-rate was increasing linearly as the accumulated exposure for radon degradation products was growing. The mortality risk from occupational lung cancer was 1.9 x 10 -4 (pers·rem) -1 for the whole group of miners. The lung cancer make up 70% proportion from all cancer disease taken as a cause of death. In 1965 when the air pollution by radon degradation products began to decrease, the mine-workers lung cancer frequency was significantly smaller than within the group taken as a controls

  13. Synthesis, characterization, and molecular structure of tetraethylammonium pentakis(isothiocyanato)bis(2,2'-bipyridine)uranate(IV)

    International Nuclear Information System (INIS)

    Wiley, R.O.; Von Dreele, R.B.; Brown, T.M.

    1980-01-01

    The synthesis of tetraethylammonium pentakis(isothiocyanato)bis(2,2'-bipyridine)uranate(IV) has been accomplished, and it was characterized by classical physical methods. The crystal and molecular structure was determined from single-crystal x-ray data collected by the theta-2theta technique on an automated diffractometer. The compound consists of pentakis(isothiocyanato)bis (2,2'-bipyridine)uranate(IV) anions and disordered tetraethylammonium cations. Uranium is bound to nine nitrogen atoms in a highly distorted monocapped square antiprism in which one bipyridine occupies a position bridging the cap and the near square while the other bipyridine spans the opposite edge of the far square. Distortion from the ideal geometry is caused by the small ligand bite of the bipyridine ligand. An alternative description of the coordination geometry is derived from the seven-coordinate pentagonal bipyramid in which each bipyridine ligand is assumed to occupy an axial position with the five thiocyanato ligands forming the pentagonal girdle. The U-N bond distances vary from 2.35 to 2.47 A for the thiocyanato ligands and from 2.61 to 2.65 A for the bipyridine ligands. The structure was solved by standard heavy-atom techniques and refined by large-block matrix least squares to a final R value of 0.083 for 3878 independent observed reflections. The compound crystallized in the monoclinic space group P2 1 /c, Z = 4, with lattice parameters a = 14.427 (10) A, b = 18.612 (17) A, c = 15.710 (10) A, and β = 105.17 (7) 0 , rho/sub obsd/ = 1.57 g cm -3

  14. Benchmark simulation of turbulent flow through a staggered tube bundle to support CFD as a reactor design tool. Part 2. URANS CFD simulation

    International Nuclear Information System (INIS)

    Ridluan, Artit; Tokuhiro, Akira

    2008-01-01

    In Part II, we described the unsteady flow simulation and proposed a modification of a traditional turbulence flow model. Computational fluid dynamics (CFD) simulations of an isothermal, fully periodic flow across a tube bundle using unsteady Reynolds averaged Navier-Stokes (URANS) equations, with turbulence models such as the Reynolds stress model (RSM) were investigated at a Reynolds number of 1.8x10 4 , based on the tube diameter and inlet velocity. As noted in Part I, CFD simulation and experimental results were compared at five positions along (x,y) coordinates. The steady RANS simulation showed that four diverse turbulence models were efficient for predicting the Reynolds stresses, and generally, SRANS results were marginal to poor, using a consistent evaluation terminology. In the URANS simulation, we modeled the turbulent flow field in a manner similar to the approach used for large eddy simulation (LES). The time-dependent URANS results showed that the simulation reproduces the dynamic stability as characterized by transverse oscillatory flow structures in the near-wake region. In particular, the inclusion of terms accounting for the time scales associated with the production range and dissipation rate of turbulence generates unsteady statistics of the mean and fluctuation flow. In spite of this, the model implemented produces better agreement with a benchmark data set and is thus recommended. (author)

  15. Ipilimumab 10 mg/kg versus ipilimumab 3 mg/kg in patients with unresectable or metastatic melanoma

    DEFF Research Database (Denmark)

    Ascierto, Paolo A; Del Vecchio, Michele; Robert, Caroline

    2017-01-01

    of ipilimumab 10 mg/kg versus 3 mg/kg. METHODS: This randomised, double-blind, multicentre, phase 3 trial was done in 87 centres in 21 countries worldwide. Patients with untreated or previously treated unresectable stage III or IV melanoma, without previous treatment with BRAF inhibitors or immune checkpoint...

  16. 0KG: creating and developing an innovative clothing service

    Science.gov (United States)

    Bernardes, J. P.; Nogueira, M.

    2017-10-01

    This paper explores the creation, analysis and understanding of the feasibility and potential of an innovative service called 0KG, which focuses on the question: “are people willing to use second-hand clothing and/or leased when traveling?”. 0KG is a rental service for the day-to-day, business, and also cultural clothing, depending on the country where tourists are traveling. The main benefit of this service is to be a facilitator in the traveling moment, allowing displacements to be made with greater tranquility, without concern for the luggage and still offering a varied range of clothes to use that normally tourists would not have in their closet. Inspired by the ‘slow fashion movement’, 0KG intends to be an inovation promoting the re-use of clothes. The creation and development of this service happened through the use of various methodologies, such as design thinking and business models. The analysis to these methodologies allows an explanation of 0KG through a process of design thinking and the creation of a business model called Kaleidoscope. Regarding its validation, it was achieved in the format of a questionnaire with 430 responses and a focus group with people of interest. Finally, the paper culminates with the positive response to the problem.

  17. Estudio preliminar de la mineralización uranífera en la cordillera oriental, San Ramón, Oxapampa

    OpenAIRE

    Valencia, Jacinto

    2014-01-01

    Rocas intrusivas del magmatismo permo-triásico de la cordillera oriental, constituidas por granitos de San Ramón y Oxapampa, presentan buena favorabilidad como rocas fértiles en uranio, un granito de facie roja denominado monzo-granito; esta condición es el resultado de la ejecución del proyecto de cooperación del OIEA PER 2/16, a cargo de IPEN, “Mejora del conocimiento del potencial uranífero del Perú”. Los trabajos de campo han consistido en la revisión geológico-radiométrica y toma de mues...

  18. The impact of ammonium and nitrate impurities on the formation of uranium oxides, in thecomposition range UO3-U3O8-z during thermal decomposition of ammonium uranates

    International Nuclear Information System (INIS)

    El-Mamoon Yahai, M.; El-Fekey, S.A.; Abd El-Razek, A.M.

    1996-01-01

    Ammonium uranates (AU) were precipitated from a nuclear-pure uranyl nitrate solution using ammonia liquor. Unwashed and washed uranate samples were heated at temperatures varying between 400 and 800 C and analysed thermally and by X-ray diffraction analysis. The results indicated that amorphous uranium trioxide (A-UO 3 ) is mainly formed in absence of carried ammonium and nitrate ions, whereas deamination of the retained ammonia leads to β-UO 3 formation. The retained ammonium ions in the AU structure increased with the pH of precipitation and these ions lead to formation of two polymorphs of uranium octoxides. (orig.)

  19. Dark matter limits froma 15 kg windowless bubble chamber

    Energy Technology Data Exchange (ETDEWEB)

    Szydagis, Matthew Mark [Univ. of Chicago, IL (United States)

    2011-03-01

    The COUPP collaboration has successfully used bubble chambers, a technology previously applied only to high-energy physics experiments, as direct dark matter detectors. It has produced the world's most stringent spin-dependent WIMP limits, and increasingly competitive spin-independent limits. These limits were achieved by capitalizing on an intrinsic rejection of the gamma background that all other direct detection experiments must address through high-density shielding and empirically-determined data cuts. The history of COUPP, including its earliest prototypes and latest results, is briefly discussed in this thesis. The feasibility of a new, windowless bubble chamber concept simpler and more inexpensive in design is discussed here as well. The dark matter limits achieved with a 15 kg windowless chamber, larger than any previous COUPP chamber (2 kg, 4 kg), are presented. Evidence of the greater radiopurity of synthetic quartz compared to natural is presented using the data from this 15 kg device, the first chamber to be made from synthetic quartz. The effective reconstruction of the three-dimensional positions of bubbles in a highly distorted optical field, with ninety-degree bottom lighting similar to cloud chamber lighting, is demonstrated. Another innovation described in this thesis is the use of the sound produced by bubbles recorded by an array of piezoelectric sensors as the primary means of bubble detection. In other COUPP chambers, cameras have been used as the primary trigger. Previous work on bubble acoustic signature differentiation using piezos is built upon in order to further demonstrate the ability to discriminate between alpha- and neutron-induced events.

  20. Dark matter limits from a 15 kg windowless bubble chamber

    International Nuclear Information System (INIS)

    Szydagis, Matthew Mark

    2010-01-01

    The COUPP collaboration has successfully used bubble chambers, a technology previously applied only to high-energy physics experiments, as direct dark matter detectors. It has produced the world's most stringent spin-dependent WIMP limits, and increasingly competitive spin-independent limits. These limits were achieved by capitalizing on an intrinsic rejection of the gamma background that all other direct detection experiments must address through high-density shielding and empirically-determined data cuts. The history of COUPP, including its earliest prototypes and latest results, is briefly discussed in this thesis. The feasibility of a new, windowless bubble chamber concept simpler and more inexpensive in design is discussed here as well. The dark matter limits achieved with a 15 kg windowless chamber, larger than any previous COUPP chamber (2 kg, 4 kg), are presented. Evidence of the greater radiopurity of synthetic quartz compared to natural is presented using the data from this 15 kg device, the first chamber to be made from synthetic quartz. The effective reconstruction of the three-dimensional positions of bubbles in a highly distorted optical field, with ninety-degree bottom lighting similar to cloud chamber lighting, is demonstrated. Another innovation described in this thesis is the use of the sound produced by bubbles recorded by an array of piezoelectric sensors as the primary means of bubble detection. In other COUPP chambers, cameras have been used as the primary trigger. Previous work on bubble acoustic signature differentiation using piezos is built upon in order to further demonstrate the ability to discriminate between alpha- and neutron-induced events.

  1. Construction of a 13 kG magnetic coil system

    International Nuclear Information System (INIS)

    Rossi, J.O.; Aso, Y.; Castro, P.J.; Barroso, J.J.; Ludwig, G.O.; Montes, A.; Nono, M.C.A.; Correa, R.A.

    1991-08-01

    The construction of magnetic coil system for a 35 GHz gyrotron is reported in great detail. This system is designed to generate a magnetic induction of 13,2 kG over an extension of 13 cm. By using an operating current of about 100 A, it was verified that both the axial magnetic field profile and the spatial non-uniformity are in close agreement with those theoretically predicted. (author)

  2. Digestible phosphorus levels for barrows from 50 to 80 kg

    Directory of Open Access Journals (Sweden)

    Viviane Maria Oliveira dos Santos Nieto

    2016-05-01

    Full Text Available ABSTRACT This study was carried out to evaluate the levels of digestible phosphorus in diets for barrows with a high potential for lean meat deposition from 50 to 80 kg. Eighty barrows, with an initial weight of 47.93±3.43 kg, were distributed in completely randomized blocks, with each group given five levels of digestible phosphorus (1.86, 2.23, 2.61, 2.99, and 3.36 g kg−1. There were eight replicates, and two animals per experimental unit. Phosphorus levels did not significantly influence feed intake, weight gain, or feed conversion ratio. Daily digestible phosphorus intake increased linearly as levels of phosphorus in the diet were increased. Phosphorus levels did not significantly influence muscle depth, loin eye area, backfat thickness, or the percentage and quantity of lean meat in the carcass. A linear increase was observed for feeding cost as the levels of digestible phosphorus in the diet were increased, and the level of 1.86 g kg−1 cost 29.4% less when compared with the level of 2.61 g kg−1. The dry matter, natural matter, the coefficient of the residue, and volatile solids of the waste were not significantly influenced by phosphorus levels. Conversely, it was possible to observe an increasing linear effect for total solids, total phosphorus, and total nitrogen in the waste of animals receiving diets with increased levels of digestible phosphorus. The level of 1.86 g kg−1, which corresponded to a daily intake of 4.77 g−1 of digestible phosphorus, meets the requirements of barrows weighing 50 to 80 kg.

  3. FFTF operational results: startup to 100 MWd/kg

    International Nuclear Information System (INIS)

    Baird, Q.L.; Harris, R.A.

    1985-01-01

    The Fast Flux Test Facility (FFTF) is a 400-MW(t) sodium-cooled fast reactor operating at the Hanford Engineering Development Laboratory in Richland, Washington, to conduct fuels and materials testing in support of the US liquid-metal fast breeder reactor program. Startup and initial power testing included a comprehensive series of nuclear and nonnuclear tests to verify the thermal and neutronic characteristics of the plant and to demonstrate its inherent safety features. Extensive reactor core characterization measurements were completed to provide the neutron and gamma spectra, fission rates, and other physics data needed to design and evaluate tests irradiated in the FFTF. A specially designed series of natural-circulation tests was performed to demonstrate the inherent safety features of the plant. Early in 1982 the FFTF began its first 100-d irradiation cycle. Since that time the plant has operated beyond expectations; it achieved a cycle capacity factor of 99.5% in the most recent irradiation cycle. One hundred fifty fuel assemblies (80 of which are experiments) and over 32,000 individual fuel pins have been irradiated, some in excess of 100 MWd/kg. Specialized equipment and systems unique to sodium-cooled reactor plants have performed well. There have been no sodium leaks in the 6 y of sodium system operation. Liquid-metal system maintenance techniques have been proven reliable. Plant maintenance and operating personnel radiation exposures have been very low. 15 figs

  4. A water-cooled 13-kG magnet system

    International Nuclear Information System (INIS)

    Rossi, J.O.; Goncalves, J.A.N.; Barroso, J.J.; Patire Junior, H.; Spassovsky, I.P.; Castro, P.J.

    1993-01-01

    The construction, performance, and reliability of a high field magnet system are reported. The magnet is designed to generate a flat top 13 kG magnetic induction required for the operation of a 35 GHz, 100 k W gyrotron under development at INPE. The system comprises three solenoids, located in the gun, cavity, and collector regions, consisting of split pair magnets with the field direction vertical. The magnets are wound from insulated copper tube whose rectangular cross section has 5.0 mm-diameter hole leading the cooling water. On account of the high power (∼ 100 k W) supplied to the cavity coils, it turned out necessary to employ a cooling system which includes hydraulic pump a heat exchanger. The collector and gun magnets operate at lower DC current (∼ 150 A), and, in this case, flowing water provided by wall pipes is far enough to cool down the coils. In addition, a 250 k V A high power AC/DC Nutek converser is used to supply power to the cavity magnet. For the collector and gun magnets, 30 V/600 A DC power supplies are used. (author)

  5. A thermogravimetric study of the decomposition of UO3 to U3O8 in relation to the conditions of pretreatment of ammonium uranate

    International Nuclear Information System (INIS)

    Rofail, N.H.; Girgis, B.S.

    1993-01-01

    The fabrication of nuclear fuel generally involves the preparation of intermediate uranium oxides (UO 3 and U 3 O 8 ) which can be processed either to ceramic or to metallic nuclear fuel. Ammonium uranate (AU) was precipitated from uranyl nitrate with ammonia gas and dried without washing, or washed with water, methanol, and/or methanol-acetone, and dried. Four DTG stages of decomposition appeared. Dissociation of UO 3 to U 3 O 8 at 600 deg - 700 deg C was associated with an E diss of 355-492 kJ x mol -1 , dependent on the mode of washing the AU. For the production of U 3 O 8 , washing of AU with water and drying at 50 deg C , and/or precalcination at and beyond 350 deg C, is recommended. (author) 22 refs.; 1 fig.; 4 tabs

  6. THE BEAMING STRUCTURES OF JUPITER’S DECAMETRIC COMMON S-BURSTS OBSERVED FROM THE LWA1, NDA, AND URAN2 RADIO TELESCOPES

    Energy Technology Data Exchange (ETDEWEB)

    Imai, Masafumi [Department of Geophysics, Kyoto University, Kyoto 606-8502 (Japan); Lecacheux, Alain [Laboratoire d’Etudes Spatiales et d’Instrumentation en Astrophysique, CNRS/Observatoire de Paris, Meudon F-92195 (France); Clarke, Tracy E. [Naval Research Laboratory, Washington, DC 20375 (United States); Higgins, Charles A. [Department of Physics and Astronomy, Middle Tennessee State University, Murfreesboro, TN 37132 (United States); Panchenko, Mykhaylo [Space Research Institute, Austrian Academy of Sciences, Graz A-8042 (Austria); Dowell, Jayce [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Imai, Kazumasa [Department of Electrical Engineering and Information Science, Kochi National College of Technology, Kochi 783-8508 (Japan); Brazhenko, Anatolii I.; Frantsuzenko, Anatolii V. [Poltava Gravimetrical Observatory, S. Subotin Institute of Geophysics, National Academy of Sciences of Ukraine, Poltava 36029 (Ukraine); Konovalenko, Alexandr A., E-mail: imai@kugi.kyoto-u.ac.jp [Institute of Radio Astronomy, National Academy of Sciences of Ukraine, Kharkiv 61002 (Ukraine)

    2016-08-01

    On 2015 February 21, simultaneous observations of Jupiter's decametric radio emission between 10 and 33 MHz were carried out using three powerful low-frequency radio telescopes: the Long Wavelength Array Station One in the USA, the Nançay Decameter Array in France, and the URAN2 telescope in Ukraine. We measured the lag times of short-bursts (S-bursts) for 105 minutes of data over effective baselines of up to 8460 km by using cross-correlation analysis of the spectrograms from each instrument. Of particular interest is the measurement of the beaming thickness of S-bursts, testing if either flashlight- or beacon-like beaming is emanating from Jupiter. We find that the lag times for all pairs drift slightly as time elapses, in agreement with expectations from the flashlight-like beaming model. This leads to a new constraint of the minimum beaming thickness of 2.″66. Also, we find that most of the analyzed data abound with S-bursts, whose occurrence probability peaks at 17–18 MHz.

  7. Quantitative analysis of sodium di-uranate for Al, Ca, Fe, Mg, Mn, Na by flame-atomic absorption spectrometric method

    International Nuclear Information System (INIS)

    Jat, J.R.; Balaji Rao, Y.; Subba Rao, Y.

    2015-01-01

    Nuclear Fuel Complex (NFC) receives Sodium Di-Uranate (SDU) from Uranium Corporation of India Limited (UCIL) for producing sinterable UO 2 pellets for manufacturing fuel sub assemblies. Several impurities present in ore find their way into SDU during its conversion. Stringent specification have been laid down by the reactor designs for achieving the optimum performance of the fuel and several impurity element like Al, Ca, Fe, Mg, Mn, Na among others affects severely performance of UO 2 fuel. Most of the impurity including the above mentioned elements are generally analysed by ICP-OES method. However, determination of Al, Ca, Fe, Mg, Mn and Na by ICP-OES requires lot of dilution as they are present at high levels in SDU. Apart from introducing dilution error, dilution process is very tedious and time consuming work and not a preferred choice in an industrial lab like control lab where large analytical load exists and time bound analysis is a requirement. To avoid these difficulties a simple and reliable Flame Atomic absorption spectrometric technique has been developed for regular analysis. Present method involves dissolution of SDU sample in Conc. HNO 3 and after the complete dissolution the sample solution has been evaporated to near dryness on a hot plate. Subsequently sample solution has been brought into 4N HNO 3 medium

  8. Dose of rocuronium for rapid tracheal intubation following remifentanil 2 μg kg-1 and propofol 2 mg kg-1.

    Science.gov (United States)

    Oh, Ah-Young; Cho, Suk-Ju; Seo, Kwang-Suk; Ryu, Jung-Hee; Han, Sung-Hee; Hwang, Jung-Won

    2013-09-01

    Full relaxation is not mandatory for successful tracheal intubation. We tried to find the dose of rocuronium that gave acceptable intubation conditions in a rapid sequence intubation with remifentanil and propofol. A dose-finding study of rocuronium using a modified Dixon's up-and-down method. A single tertiary care teaching hospital. Patients undergoing elective surgery under general anaesthesia. After premedication with midazolam and glycopyrrolate, anaesthesia was induced using remifentanil 2 μg kg and propofol 2 mg kg, and a predetermined dose of rocuronium was administered. The dose of rocuronium was determined by a modified Dixon's up-and-down method starting from 0.8 mg kg with an interval of 0.1 or 0.05 mg kg. Intubation was performed 60 s after the start of the rocuronium injection. Intubation conditions were graded as excellent, good or poor. Excellent or good were regarded as clinically acceptable. A dose of rocuronium needed for acceptable intubation condition in 50% of patients (ED50) during rapid tracheal intubation after induction of anaesthesia with remifentanil and propofol. Twenty-eight patients were enrolled to obtain six crossovers. The ED50 of rocuronium was 0.20 mg kg (95% confidence interval, CI 0.17 to 0.23 mg kg) by a modified Dixon's up-and-down method. After induction of anaesthesia with remifentanil 2 μg kg and propofol 2 mg kg, the ED50 of rocuronium for acceptable intubation condition was 0.20 mg kg (95% CI, 0.17 to 0.23 mg kg) for rapid sequence intubation. Thus, we recommend that the intubation dose should be 0.8 mg kg. Clinical trial registration KCT0000094.

  9. Assessment of the sedative effects of buprenorphine administered with 20 microg/kg detomidine in horses.

    Science.gov (United States)

    Love, E J; Taylor, P M; Murrell, J; Whay, H R; Waterman-Pearson, A E

    2011-04-16

    The aim of this randomised, observer-blinded, crossover study was to compare the effects of four treatments, administered intravenously to six horses: saline and saline; 10 µg/kg detomidine and 7.5 µg/kg buprenorphine; 20 µg/kg detomidine and 7.5 µg/kg buprenorphine; and 20 µg/kg detomidine and 10 µg/kg buprenorphine. Sedation was subjectively assessed and recorded on a visual analogue scale. Peak sedation and duration of sedation were investigated using a univariate general linear model with post-hoc Tukey tests (Pdetomidine from 10 to 20 µg/kg increased the degree of sedation when administered with the same dose of buprenorphine (7.5 µg/kg). When administered with 20 µg/kg detomidine, increasing the dose of buprenorphine from 7.5 to 10 µg/kg did not influence the degree of sedation achieved.

  10. Twiny pro: 5.1 kg of propane dressed in apple green; Twiny pro: 5.1 kg de propane en habillage vert pomme

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1998-05-01

    Designed for professional and outdoors uses, Twini Pro - the new Primagaz 5.1 kg propane cylinder - is a complement to the Twiny butane 6 kg cylinder was launched during the first week of March in some 2,500 outlets, before 5,000 and 7,000 points later

  11. Reversal of rocuronium-induced (1.2 mg kg-1) profound neuromuscular block by accidental high dose of sugammadex (40 mg kg-1).

    NARCIS (Netherlands)

    Molina, A.L.; Boer, H.D. de; Klimek, M.; Heeringa, M.; Klein, J.

    2007-01-01

    Sugammadex is the first selective relaxant binding agent and reverses rocuronium-induced neuromuscular block. A case is reported in which a patient accidentally received a high dose of sugammadex (40 mg kg-1) to reverse a rocuronium-induced (1.2 mg kg-1) profound neuromuscular block. A fast and

  12. Efektifitas Fungsida Berbahan Aktif Pyraclostrobin 50 G/KG + Metiram G/KG untuk Mengendalikan Penyakit Embun Tepung (Podosphaera leucotrica Pada Tanaman Apel

    Directory of Open Access Journals (Sweden)

    Eli Korlina

    2016-03-01

    Full Text Available Pengujian efektifitas fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg untuk mengendalian  penyakit embun tepung (Podosphaera leucotricha pada tanaman apel telah dilaksanakan di kebun apel milik petani Desa Wringinanom, Kecamatan Poncokusumo, Kabupaten Malang yang beriklim tinggi kering dengan ketinggian tempat ±  850 diatas permukaan laut (dpl, mulai bulan Pebruari sampai dengan April 2011, menggunakan kultivar apel  Manalagi yang telah berumur 8-10 tahun.  Perlakuan terdiri atas Fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg dengan 4 (empat tingkat konsentrasi yaitu 0,5; 1,0; 1,5; dan 2,0 g/l air, dan kontrol (tanpa perlakuan, disusun dalam rancangan acak kelompok  (RAK dan diulang 4 kali. Hasil pengujian menunjukkan bahwa Fungisida berbahan aktif pyraclostrobin 50 g/kg+metiram 550g/kg konsentrasi 0,5-2 g/l air telah efektif mengendalikan penyakit embun tepung P. leucotricha pada tanaman apel dengan penekanan  serangan sebesar 44,42-54,73%.  Rata-rata produksi buah apel berkisar antara 8,49 – 10,38 kg/pohon. Tanaman apel yang diaplikasi dengan fungisida tersebut tidak mengalami fitotoksisitas.Kata Kunci: Apel, penyakit embun tepung (Podosphaera leucotricha.

  13. Dose requirements of alfentanil to eliminate autonomic responses during rapid-sequence induction with thiopental 4 mg/kg and rocuronium 0.6 mg/kg.

    Science.gov (United States)

    Abou-Arab, Mohammad H; Rostrup, Morten; Heier, Tom

    2016-12-01

    Opioids are integral part of anesthesia induction, but information on optimal dosing is limited. We aimed to determine doses of alfentanil needed to eliminate increases in 5 autonomic response variables (plasma concentrations of epinephrine, norepinephrine and vasopressin, arterial blood pressure [ABP], and heart rate) during rapid-sequence induction of anesthesia with thiopental 4 mg/kg and rocuronium 0.6 mg/kg. Prospective, randomized, observer-blinded, interventional clinical study. Large academic institution. Eighty-four healthy patients, aged 18 to 55 years, received 1 of 7 assessor-blinded doses of alfentanil (0, 10, 20, 30, 40, 50, and 60 μg/kg) together with thiopental 4 mg/kg and rocuronium 0.6 mg/kg, administered in rapid succession (15 seconds). Laryngoscopy was initiated 40 seconds after rocuronium, and tracheal intubation was concluded within 15 seconds thereafter. An indwelling radial artery catheter was used for hemodynamic monitoring and blood sampling. Relationships between alfentanil dose and response variables were tested with linear regression, and the influence of covariates (sex, body weight, and age) was determined. Alfentanil dose needed to prevent increases in ABP >10% above baseline with 95% probability was estimated with logistic regression. Significant relationships were determined between alfentanil dose and response variables. Clinically interesting influence of covariates was not found. Alfentanil 55 μg/kg was needed to prevent increases in ABP postintubation >10% above baseline with 95% probability. One individual needed a bolus of vasopressor postintubation. Optimal control of autonomic responses during rapid-sequence induction was achieved with clinically relevant doses of alfentanil in healthy patients anesthetized with thiopental 4 mg/kg and rocuronium 0.6 mg/kg. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. The determination of molar volumes of uranous nitrate and nitric acid in systems of U(NO3)4-HNO3-H2O and U(NO3)4-HNO3-30% TBP kerosene

    International Nuclear Information System (INIS)

    Tao Chengying

    1986-01-01

    The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature

  15. 78 FR 17080 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-03-20

    ... Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation... certain Rolls-Royce Deutschland Ltd & Co KG (RRD) BR700-710 series turbofan engines. This AD requires... applies to Rolls-Royce Deutschland Ltd & Co KG (RRD) BR700-710A1-10 and BR700-710A2-20 turbofan engines...

  16. 77 FR 71085 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2012-11-29

    ... Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation... turbofan engines. This AD requires initial and repetitive general inspections and ultrasonic inspections...

  17. Kecamatan Tampan oleh Dinas Perindustrian dan Perdagangan Kota Pekanbaru (Studi Kasus: Pangkalan Lpg 3 Kg)

    OpenAIRE

    Faisal, Andini; Yuliani, Febri

    2015-01-01

    LPG 3 kg has become a very important requirement. It can be seen from the demand for LPG 3 kg is increasing every year, both in use for households or for the development of micro enterprises. The purpose of this research was to determine how the LPG 3 kg distribution control in the Kelurahan Sidomulyo Barat Kecamatan Tampan by the Department of Industry and Trade of Pekanbaru City (case study: Sub Distributor LPG 3 kg) and to determine the factors that affect the control in the distribution o...

  18. Perbandingan antara Tramadol 2 mg/kgBB dan Fentanil 2 mg/kgBB Intravena Sebagai Analgetik Intraoperatif pada Operasi Laparotomi Ginekologis; Pengaruhnya terhadap Skor PRST

    Directory of Open Access Journals (Sweden)

    Arief Kurniawan

    2017-12-01

    Full Text Available Perkembangan dan kemajuan teknologi serta ilmu pengetahuan telah mendorong pelaksanaan pelayanan kesehatan yang lebih efektif dan lebih ekonomis dibanding dengan cara yang lazim dikerjakan. Telah dilakukan penelitian terhadap 32 pasien operasi laparotomi ginekologis yang dibagi menjadi dua kelompok. Kelompok Tramadol (n=16 diberikan tramadol 2 mg/kgBB (pengenceran akuabides sampai 10 mL lewat jalur infus selama satu menit, sedangkan pada kelompok Fentanil (n=16 diberikan fentanil 2 µg/kgBB dengan cara yang sama. Lima menit kemudian diberikan propofol 2 mg/kgBB, atrakurium 0,5 mg/kgBB, enfluran 2 volume %, N2O:O2=2 L/menit:2 L/menit. Setelah tiga menit dilakukan laringoskopi intubasi. Pasien diventilasi kendali dengan mode ventilator IPPV. Operasi dilaksanakan bila kedalaman anestesi tercapai berdasar atas skor PRST (P=systolic arterial pressure, R=heart rate, S=sweat, dan T=tears 2 sampai dengan 4. Analgetik pertolongan 50 µg fentanil diberikan bila skor PRST lebih dari 4. Analgetik postoperatif 30 mg ketorolak dan antimuntah 10 mg metoklopramid diberikan saat jahit kulit. Pencatatan tekanan darah, laju nadi, saturasi O2, dan skor PRST dilakukan sebagai berikut: T0 = penderita tiba di kamar operasi, T1= preintubasi, T2= satu menit setelah intubasi, T3= satu menit setelah insisi, T4 dan seterusnya diukur tiap 15 menit sampai selesai operasi. Pasien diekstubasi setelah pernapasan adekuat. Skala sedasi dan muntah dinilai setiap 15 menit setelah ekstubasi selama dua jam. Dari hasil penelitian didapatkan skor PRST mulai T1 sampai T12 secara statistis tidak berbeda bermakna antara kelompok tramadol dan fentanil (p>0,05. Kedua kelompok mengalami peningkatan skor PRST satu menit setelah intubasi. Skor PRST dipertahankan antara 0 sampai 2. Pada kelompok tramadol dan fentanil masing-masing satu orang mendapatkan analgetik pertolongan fentanil 50 µg karena skor PRST 5. Tidak ditemukan perbedaan skala sedasi dan muntah antara dua kelompok perlakuan

  19. Lower tidal volume strategy (?3?ml/kg) combined with extracorporeal CO2 removal versus ?conventional? protective ventilation (6?ml/kg) in severe ARDS

    OpenAIRE

    Bein, Thomas; Weber-Carstens, Steffen; Goldmann, Anton; M?ller, Thomas; Staudinger, Thomas; Brederlau, J?rg; Muellenbach, Ralf; Dembinski, Rolf; Graf, Bernhard M.; Wewalka, Marlene; Philipp, Alois; Wernecke, Klaus-Dieter; Lubnow, Matthias; Slutsky, Arthur S.

    2013-01-01

    Background Acute respiratory distress syndrome is characterized by damage to the lung caused by various insults, including ventilation itself, and tidal hyperinflation can lead to ventilator induced lung injury (VILI). We investigated the effects of a low tidal volume (V T) strategy (V T???3?ml/kg/predicted body weight [PBW]) using pumpless extracorporeal lung assist in established ARDS. Methods Seventy-nine patients were enrolled after a ?stabilization period? (24?h with optimized therapy an...

  20. Random comparison study of the clinical response to 153Sm-EDTMP 1.0 mCi/kg and 1.5 mCi/kg

    International Nuclear Information System (INIS)

    Pan, Z.; Zhu, S.

    2001-01-01

    Sixty-seven patient with painful bone metastases were randomized to two groups. Group 1 (n=34) received 1.0 mCi/kg of 153 Sm-EDTMP and group II (n=33) received 1.5 mCi/kg. All of them met inclusion criteria and there was no significantly difference between the basic conditions of two groups. After receiving 153 Sm-EDTMP intravenously, all patients were kept in close follow-up weekly with blood counting, physician visiting and collecting patient's self-filling-in diary including pain score, Karnofsky performance scale and analgesic consumption. The follow-up duration was six weeks. The final overall condition assessed by physician were graded into no change (including worse), slight relief, significant relief and complete relief. Only significant relief and complete relief were considered as effectiveness for pain relief. Haematological toxicity grade was evaluated based on the nadir of WBC ad PLT counts. The results indicated that the higher dosage group had a higher effectiveness rate (75.76%) compared to the lower dosage group (67.65%), but without statistic significance (x 2 =0.5365, 0.25 153 Sm-EDTMP could be used for those patients with better haematological function and 1.0 mCi/kg used for those patients with poorer haematological function. (author)

  1. 50-kg large-size cold crucible levitation melting apparatus; Teibu shuto kino wo motsu 50kg kyu korudo kurushiburu fuyo yokai shochi no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, S. [Fuji Electric Co. Ltd., Tokyo (Japan); Tadano, E. [Fuji Electric Corporate Research and Development Ltd., Kanagawa (Japan)

    1997-06-25

    With an increase in the degree of industrial techniques and the development of high-technology products in recent years, it has been demanded that the quality of high-purity metal materials be improved. The levitation melting method is a new melting method in which a metal material is melted by induction heating while the material is levitated in a water-cooled copper crucible. This paper made clear the principle of the levitation melting method and describes some problems in the development of a 50 kg-class large-capacity levitation melting apparatus and solutions to the problems. The development of a 50 kg-class levitation melting apparatus having a bottom discharging function was carried out on the basis of the results of discussion of the above-mentioned problems, and the noncontact melting of 50 kg cast iron and the noncontact bottom discharging of molten iron succeeded. This enabled the noncontact process of from the melting of a high-purity metal material and a metal of a high melting point to the casting of the molten metal. Since a continuous casting apparatus is provided under the crucible, the casting of an ingot and a rod material becomes possible. When a metal material is levitation-melted in superhigh vacuum, production of a superhigh-purity metal and a new metal material can be attained since the material is not contaminated by the atmosphere. 9 refs., 11 figs., 4 tabs.

  2. 77 FR 12450 - Airworthiness Directives; BRP-Powertrain GmbH & Co KG Rotax Reciprocating Engines

    Science.gov (United States)

    2012-03-01

    .... (1) Inspect the oil pump and engine valve train for oil leaks in accordance with paragraph 3.1) step... paragraph 3.1.3) steps 19. through 21. of BRP- Powertrain GmbH & Co KG, Rotax Aircraft Engines Mandatory... Airworthiness Directives; BRP-Powertrain GmbH & Co KG Rotax Reciprocating Engines AGENCY: Federal Aviation...

  3. 78 FR 17079 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-03-20

    ... Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation... certain Rolls-Royce Deutschland Ltd & Co KG (RRD) models Tay 620-15 and Tay 650-15 turbofan engines. This... Tay 620-15 and Tay 650-15 turbofan engines with a low-pressure compressor (LPC) rotor disc assembly...

  4. 78 FR 17075 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-03-20

    ... Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation... certain Rolls-Royce Deutschland Ltd & Co KG (RRD) Tay 611-8 turbofan engines. This AD requires inspection... (RRD) Tay 611-8 turbofan engines, serial numbers 16245, 16256, 16417, 16418, 16584, 16585, 16639, 16640...

  5. 78 FR 35574 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-06-13

    ... Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation... airworthiness directive (AD) for all Rolls-Royce Deutschland Ltd & Co KG (RRD) model Tay 650-15 turbofan engines... Compliance We estimate that this proposed AD affects 52 Tay turbofan engines installed on airplanes of U.S...

  6. The pattern of protein retention in pigs from 2 to 120 kg live weight

    DEFF Research Database (Denmark)

    Chwalibog, André; Jakobsen, K; Thorbek, G

    1996-01-01

    of metabolizable energy and oxidation of nutrients and a total of 152 measurements in the live weight (LW) range from 2 to 120 kg complied with the criterions. 3. The selected material were used in a quadratic function of RP on metabolic weight (kg0.75) to describe the curve for maximum RP. 4. The function...... obtained was: RP, g/d = 11.55 x kg0.75 - 0.185 x kg1.50 with a maximum of 180 g/d at 98 kg LW. 5. The RP-values were compared with data from the literature with other races and the function seems well established to describe maximum protein retention in non-hormone treated or specific selected pigs....

  7. Raw material uranium; Rohstoff Uran

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-03-15

    Uranium is an important raw material in human life. Mostly using nuclear fission uranium is used in nuclear medicine, industry and research. The most important application is the generation of electricity in nuclear power plants. Due to the global availability the worldwide uranium supply is guaranties for a long time. The contribution covers the issues medicine, neutron research, energy generation, occurrence, mining, processing, recycling and disposal.

  8. Perbandingan Granisetron 0,01 mg/KgBb dengan Ondansetron 0,08 Mg/Kg.Bb Untuk Mencegah Mual Muntah Pascaoperasi Dini Mastektomi Radikal Modifikasi

    Directory of Open Access Journals (Sweden)

    Budi Fitriyana

    2013-04-01

    Full Text Available Postoperative nausea and vomiting not only cause discomfort to the patient, but also lead to electrolyte imbalance, regurgitation and aspiration, bleeding and loss of surgical sutures. Patients who experience postoperative nausea and vomiting will require further attention and treatment which of course increases the cost of medical services. Women who underwent mastectomy with accompanying decision underarm lymph nodes have a high risk of postoperative nausea and vomiting. Many anti-vomiting are given including antihistamines, butyrophenon, and dopamine receptor antagonists have been reported to have undesirable side effects including excessive sedation, hypotension, dry mouth, dysphoria, hallucinations and extrapyramidal effects. 5 HT3 receptor antagonists provide a major advancement for treatment of postoperative nausea and vomiting due to fewer side effects when compared with anti-vomiting medications before. This study will compare the two drugs 5 HT3 receptor antagonist granisetron with ondansetron in preventing postoperative nausea and vomiting modified radical mastectomy early. Conducted research on 58 patients ASA I and II modified radical mastectomy is performed under general anesthesia. Sampling was carried out using double-blind randomized controlled trial. Samples were divided into two groups by block randomization. Group G is given granisetron 0.01 gr / kg.bb and group O is given ondansetron 0.08 mg / kg.bb. Drug treatment is administered intravenously 30 minutes before the surgery ended on a complete evaluation of blood pressure, heart rate, oxygen saturation and length of surgery. Postoperative nausea and vomiting shortly after surgery assessed every hour until 6 hours after surgery (early postoperative nausea and vomiting to 4 scale (0-3. Data were analyzed by t-test, Chi-square test, Mann-Whitney test and Fisher's Exact test on Windows SPSS ver.16 The results suggest there is a tendency complaints of postoperative nausea and

  9. Final report of AFRIMETS.M.M-S6: supplementary comparison of 100 mg, 100 g 500 g, 1 kg and 5 kg stainless steel mass standards

    Science.gov (United States)

    Mautjana, R. T.; Molefe, P. T.; Mayindu, N. F.; Armah, M. N.; Ramasawmy, V.; Albasini, G. L.; Matali, S.; Richmond, H.; Rusimbi, V.; Kiwanuka, J.; Mutale, D. M.; Mutsimba, F.

    2018-01-01

    This report summarizes the results of AFRIMETS.M.M-S6 mass standards comparison conducted between eleven participating laboratories/countries. Two sets of five weights with nominal values 100 mg, 100 g, 500 g, 1 kg and 5 kg were used as the traveling standards. These nominal values were decided from the needs of participating laboratories submitted to the pilot laboratory through a questionnaire and agreed upon by all participants. The traveling standards were hand carried between laboratories starting from February 2014 and were received from the last participants in October 2014. The programme was coordinated by National Metrology Institute of South Africa (NMISA), who provided the travelling standards and reference values for the comparison. The corrections to the BIPM as-maintained mass unit [5] have insignificant influence on the results of this comparison. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  10. An Electrochemical Capacitor with Applicable Energy Density of 7.4 Wh/kg at Average Power Density of 3000 W/kg.

    Science.gov (United States)

    Zhai, Teng; Lu, Xihong; Wang, Hanyu; Wang, Gongming; Mathis, Tyler; Liu, Tianyu; Li, Cheng; Tong, Yexiang; Li, Yat

    2015-05-13

    Electrochemical capacitors represent a new class of charge storage devices that can simultaneously achieve high energy density and high power density. Previous reports have been primarily focused on the development of high performance capacitor electrodes. Although these electrodes have achieved excellent specific capacitance based on per unit mass of active materials, the gravimetric energy densities calculated based on the weight of entire capacitor device were fairly small. This is mainly due to the large mass ratio between current collector and active material. We aimed to address this issue by a 2-fold approach of minimizing the mass of current collector and increasing the electrode performance. Here we report an electrochemical capacitor using 3D graphene hollow structure as current collector, vanadium sulfide and manganese oxide as anode and cathode materials, respectively. 3D graphene hollow structure provides a lightweight and highly conductive scaffold for deposition of pseudocapacitive materials. The device achieves an excellent active material ratio of 24%. Significantly, it delivers a remarkable energy density of 7.4 Wh/kg (based on the weight of entire device) at the average power density of 3000 W/kg. This is the highest gravimetric energy density reported for asymmetric electrochemical capacitors at such a high power density.

  11. Sugammadex 4.0 mg kg-1 reversal of deep rocuronium-induced neuromuscular blockade

    DEFF Research Database (Denmark)

    Yu, Buwei; Wang, Xiangrui; Hansen, Søren Helbo

    2014-01-01

    Objective: Maintenance of deep Neuro Muscular Blockade (NMB) until the end of surgery may be beneficial in some surgical procedures. The selective relaxant binding agent sugammadex rapidly reverses deep levels of rocuronium-induced NMB. The purpose of this study was to evaluate the efficacy...... and safety of sugammadex 4.0 mg kg-1 for reversal of deep rocuronium-induced NMB in Chinese and Caucasian patients. Methods: This was an open-label, multicenter, prospective Phase III efficacy study in adult American Society of Anesthesiologists Class 1-3 patients scheduled for surgery under general...... anesthesia and requiring deep NMB. All patients received intravenous propofol and opioids for induction and maintenance of anesthesia, and a single intubation dose of rocuronium 0.6 mg/kg, with maintenance doses of 0.1-0.2 mg/kg as required. Sugammadex 4.0 mg/kg was administered after the last dose...

  12. Model testing of a 10-kg high explosive blast attenuation maze

    International Nuclear Information System (INIS)

    Bacigalupi, C.M.; Burton, W.A.

    1981-01-01

    The basement area of the proposed High Explosive Applications Facility (HEAF) at the Lawrence Livermore National Laboratory includes 10-kg HE assembly and process cells, and a 10-kg corridor for the transport of up to 10 kg of HE from the receiving dock to the cells and to the experimental firing tanks. Previous model experiments developed a process cell-maze configuration that attenuated the effects of an accidental 10-kg detonation to acceptable levels (maximum of 10 to 11 psi reflected). This document reports 1/8-scale model tests conducted to confirm the maze design and to determine the blast pressures in adjacent areas in the final HEAF building configuration. In addition, pressure/time information was obtained at selected points in the model expansion chamber to provide the architect-engineer with information for structural design

  13. 78 FR 77382 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-12-23

    ... Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of...-Royce Deutschland Ltd & Co KG (RRD) BR700-715A1-30, BR700-715B1- 30, and BR700-715C1-30 turbofan engines... turbofan engines installed on aircraft of U.S. registry. We also estimate that it would take about 24 hours...

  14. Níveis de lisina digestível para leitões dos 6 aos 15 kg Digestible lysine level for piglets from 6 to 15 kg

    Directory of Open Access Journals (Sweden)

    Christiane Garcia Vilela Nunes

    2008-01-01

    Full Text Available Este estudo foi realizado para avaliar o efeito de diferentes níveis de lisina digestível na ração sobre o desempenho de leitões dos 6 aos 15 kg. Foram utilizados 120 leitões (80 machos castrados e 40 fêmeas, distribuídos em um delineamento experimental de blocos ao acaso, com cinco tratamentos (1,06; 1,16; 1,26; 1,36 e 1,46% de lisina digestível na ração, oito repetições e três animais por unidade experimental, mantidos em ambiente termoneutro. Os níveis de lisina digestível na ração não influenciaram o consumo diário de ração. Entretanto, o consumo de lisina digestível, o ganho de peso e a deposição de proteína corporal aumentaram de forma linear de acordo com os níveis de lisina digestível na ração. Os níveis de lisina digestível na ração influenciaram a conversão alimentar, que variou de forma quadrática, reduzindo até o nível estimado de 1,41% de lisina digestível. O nível estimado de no mínimo de 1,46% proporcionou melhores resultados de ganho de peso e deposição de proteína na carcaça de leitões dos 6 aos 15 kg mantidos em ambiente termoneutro.This study was conducted to evaluate the effect of different levels of digestible lysine in diets on the performance of piglets from 6 to 15 kg. One hundred and twenty piglets (80 castrated males and 40 females were used. The piglets were allotted to a completely randomized block design, with five treatments (1.06, 1.16, 1.26, 1.36, and 1.46% of digestible lysine, eight replicates and three animals per experimental unit, kept in thermoneutral environment. The dietary level of digestible lysine did not affect daily feed intake. However, the digestible lysine intake, weight gain and body protein deposition increased linearly according to the dietary lysine levels. The dietary digestible lysine levels affected feed:gain ratio that reduced in a quadratic way until the estimated dietary digestible lysine level of 1.41%. The estimated level at least of 1

  15. Uso de sal durante o transporte de juvenis (1kg de pirarucu (Arapaima gigas Use of salt during the transportation of pirarucu juveniles (1kg (Arapaima gigas

    Directory of Open Access Journals (Sweden)

    Franmir Rodrigues Brandão

    2008-12-01

    Full Text Available O pirarucu é um peixe nativo da bacia Amazônica cuja criaçãovem sendo estudada em algumas partes do Brasil. O objetivo desse trabalho foi testar o sal de cozinha como mitigador de estresse durante o transporte de juvenis de pirarucu (1 kg. Para isso, os peixes foram transportados em dois diferentes sistemas: caixas sem adição de oxigênio (transporte aberto e sacos plásticos com injeção de oxigênio e lacrado (transporte fechado. Nos dois sistemas os peixes foram transportados em três diferentes tratamentos: controle e duas concentrações de sal na água (3 e 6 g.L-1. Após o transporte os peixes foram colocados em viveiros para avaliação da recuperação. Foram analisados parâmetros do metabolismo energético (cortisol, glicose e lactato e de hematologia (hematócrito. O sal de cozinha não foi eficiente em mitigar as respostas de estresse no transporte em nenhum dos dois sistemas de transporte estudados.Pirarucu is a native fish of the Amazon basin, widely used in culture systems in some parts of Brazil. The objective of this work was to test table salt as a stress mitigator during transportation of pirarucu juveniles (1kg. Fish were transported by two different systems: boxes without addition of oxygen (open system and closed oxygen filled plastic bags (closed system. To both systems fish were transported at three different treatments: control and two table salt concentration (3 and 6 gL-1. After transportation, fish were stocked in ponds to monitor recovery. Metabolic (cortisol, glucose and lactate and hematological (hematocrit parameters were analyzed. The table salt was not efficient in mitigating stress response during the both tested transport system.

  16. Meat quality and cut yield of pigs slaughtered over 100kg live weight

    Directory of Open Access Journals (Sweden)

    T.M. Bertol

    2015-08-01

    Full Text Available Meat quality and cut yield of pigs slaughtered between 100 and 150kg live weight were evaluated. Pigs (417 Agroceres PIC barrows and gilts were fed a daily allowance of 2.8kg per head from 80kg until 100.71±0.85, 118.58±0.99, 134.07±1.18 or 143.90±1.24kg live weight. Seventy-one pigs were used for the evaluation of primal and subprimal cuts. There was no interaction between sex and slaughter weight for any of the evaluated parameters. Ham, shoulder, and loin weights linearly increased (P<0.01; R2: 84.3-93.2% with increasing slaughter weight, which, however, had little effect on primal cuts meat yield. Increasing slaughter weight promoted a linear (P<0.05 and a quadratic (P<0.01 increase of red/green coordinate (a* value of the loin and ham, respectively. Shear force showed a quadratic response (P<0.05, with minimum value estimated at 122kg slaughter weight. It was concluded that, under the applied management, increasing slaughter weight increased the volume of meat, but had little effect on meat yield. The meat of pigs slaughtered at heavier weights showed more intense red color and the same intramuscular fat content as lighter pigs, while tenderness was slightly affected.

  17. Effects on proliferation and cell cycle of irradiated KG-1 cells stimulated by CM-CSF

    International Nuclear Information System (INIS)

    Guo Dehuang; Dong Bo; Wen Gengyun; Luo Qingliang; Mao Bingzhi

    2000-01-01

    In order to explore the variety of cell proliferation and cell cycle after exposure to ionizing radiation, the responses of irradiated KG-1 cells of the human myeloid leukemia stimulated by GM-CSF, the most common used cytokine in clinic, were investigated. The results showed that GM-CSF enhance KG-1 cells proliferation, reduce G0/G1 block, increase S phase and G2/M phase. The stimulation effects of the GM-CSF are more effective in irradiated group than in control group

  18. Opto-chemical response of Makrofol-KG to swift heavy ion irradiation

    Indian Academy of Sciences (India)

    In the present study, the effects of swift heavy ion beam irradiation on the structural, chemical and optical properties of Makrofol solid-state nuclear track detector (SSNTD) were investigated. Makrofol-KG films of 40 m thickness were irradiated with oxygen beam (8+) with fluences ranging between 1010 ion/cm2 and 1012 ...

  19. 78 FR 71532 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-11-29

    ... Deutschland Ltd & Co KG Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. [[Page 71533... (AD) 2007-03- 02 for all Rolls-Royce Deutschland (RRD) Tay 620-15, Tay 650-15, and Tay 651-54 turbofan..., January 29, 2007) (``AD 2007-03-02'') for certain RRD Tay 611-8 and Tay 620-15 turbofan engines with LP...

  20. 77 FR 16917 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2012-03-23

    ... heat treated after application of silver plating. We are issuing this AD to prevent failure of the HP... treatment after application of silver plating. This condition, if not corrected, could result in a stage 2... directive (AD): 2012-06-17 Rolls-Royce Deutschland Ltd & Co KG (Formerly Rolls-Royce plc, Derby, England...

  1. Chronic hemodialysis in children weighing less than 10 kg.

    LENUS (Irish Health Repository)

    Quinlan, Catherine

    2013-05-01

    Hemodialysis (HD) in infants is usually used when peritoneal dialysis (PD) has failed. We describe our experience with HD, outlining the morbidity, complications, and outcomes for infants weighing less than 10 kg managed with HD for more than 6 months over a 10-year period.

  2. RANCANG BANGUN MESIN PEMBUAT BAHAN ADONAN ROTI TIPE HORIZONTAL BERKAPASITAS 10 KG

    Directory of Open Access Journals (Sweden)

    Sukanto Sukanto

    2016-07-01

    Full Text Available Modern technology recently was impact technology manufacturing of breads. Many mixer machine available on market, but to get special capacity mixer  as 10 kg is difficult. The goals of the research to design and manufactur mixer machine with 10 kg capacity. Experimental metode was applied of this study. The opinions data will be collected by some producer and grocer breads  responden. Furthermore the conclusion of this machine people need will be design and manufactur. Running test must be done to know performance machine produced. Finally this research was produced mixer machine with 10 kg capacity with  mixer unit by  screw sumbu horizontal system and 1 phase electric was applied. Dimension machine is ±85 x 65 x100 cm. Running test was done with good result, breads batter material ductile and kalis suitable to breads.  Beside that’s  the capacity of mixer was increase until 3 time form 1 – 3 kg

  3. Complete braided adsorbent for marine testing to demonstrate 3g-U/kg-adsorbent

    Energy Technology Data Exchange (ETDEWEB)

    Janke, Chris [ORNL; Yatsandra, Oyola [ORNL; Mayes, Richard [ORNL; none,; Gill, Gary [PNNL; Li-Jung, Kuo [PNNL; Wood, Jordana [PNNL; Sadananda, Das [ORNL

    2014-04-30

    ORNL has manufactured four braided adsorbents that successfully demonstrated uranium adsorption capacities ranging from 3.0-3.6 g-U/kg-adsorbent in marine testing at PNNL. Four new braided and leno woven fabric adsorbents have also been prepared by ORNL and are currently undergoing marine testing at PNNL.

  4. Twenty-Seven Years Experience With Transvenous Pacemaker Implantation in Children Weighing <10 kg.

    Science.gov (United States)

    Konta, Laura; Chubb, Mark Henry; Bostock, Julian; Rogers, Jan; Rosenthal, Eric

    2016-02-01

    Epicardial pacemaker implantation is the favored approach in children weighing pacemaker implantation in neonates and infants from 1987. To date there have been no long-term follow-up reports of what is for many a controversial strategy. Between 1987 and 2003, 37 neonates and infants-median age 6.7 months (1 day to 3 years) and median weight 4.6 kg (2.7-10 kg)-had a permanent transvenous pacing system implanted. Pacing leads were placed into the right ventricular apex/outflow tract through a subclavian vein puncture with a redundant loop in the atrium. Three patients were lost to follow-up, 4 patients died from complications of cardiac surgery, and 2 patients had their system removed. At long-term follow-up in 28 patients at a median of 17.2 (range, 11.2-27.4) years, 10 patients have a single chamber ventricular pacemaker, 14 a dual chamber pacemaker, 3 a biventricular pacemaker, and 1 has a single chamber implantable cardioverter defibrillator. Subclavian vein patency was assessed in 26 patients. The overall subclavian vein occlusion rate was 10 of 13 (77%) 5 kg during long-term follow-up. After a median of 14.3 (range, 13.4-17.6) years of pacing, 7 patients continue with their original lead. Transvenous pacing in infants <10 kg results in encouraging short- and long-term clinical outcomes. Subclavian vein occlusion remains an important complication, occurring predominantly in those weighing <5 kg. © 2016 American Heart Association, Inc.

  5. GTS Duratek, Phase I Hanford low-level waste melter tests: 100-kg melter offgas report

    International Nuclear Information System (INIS)

    Eaton, W.C.

    1995-11-01

    A multiphase program was initiated in 1994 to test commercially available melter technologies for the vitrification of the low-level waste (LLW) stream from defense wastes stored in underground tanks at the Hanford Site in southeastern Washington State. Phase 1 of the melter demonstration tests using simulated LLW was completed during fiscal year 1995. This document is the 100-kg melter offgas report on testing performed by GTS Duratek, Inc., in Columbia, Maryland. GTS Duratek (one of the seven vendors selected) was chosen to demonstrate Joule heated melter technology under WHC subcontract number MMI-SVV-384215. The document contains the complete offgas report on the 100-kg melter as prepared by Parsons Engineering Science, Inc. A summary of this report is also contained in the GTS Duratek, Phase I Hanford Low-Level Waste Melter Tests: Final Report (WHC-SD-WM-VI-027)

  6. Isoleucine requirement of pigs weighing 8 to 18 kg fed blood cell–free diets1

    DEFF Research Database (Denmark)

    Nørgaard, Jan Værum; Shresta, Aruna; Krogh, Uffe

    2013-01-01

    The aim of the present study was to determine the minimum requirement of Ile in young pigs, enabling feeding of balanced low-CP diets. Most previous studies have used experimental diets that included blood cells, which are particularly high in Leu and known to antagonize the use of Ile. One week....... In conclusion, the average estimation of requirement in this dose-response study using blood cell–free diets was 0.52 SID Ile:Lys during a 21-d experimental period from 8 kg BW....... after weaning at d 28, 100 crossbred female pigs weighing 7.9 ± 0.7 kg were allocated to 1 of 5 dietary treatments. Diets were formulated to contain 1.15 g standardized ileal digestible (SID) Lys/MJ NE and were free of blood cells. The SID Ile was 0.42, 0.47, 0.53, 0.58, and 0.62 relative to Lys...

  7. Experimental investigation of 150-KG-scale corium melt jet quenching in water

    Energy Technology Data Exchange (ETDEWEB)

    Magallon, D.; Hohmann, H.

    1995-09-01

    This paper compares and discusses the results of two large scale FARO quenching tests known as L-11 and L-14, which involved, respectively, 151 kg of W% 76.7 UO{sub 2} + 19.2 ZrO{sub 2} + 4.1 Zr and 125 kg of W% 80 UO{sub 2} + 20 ZrO{sub 2} melts poured into 600-kg, 2-m-depth water at saturation at 5.0 MPa. The results are further compared with those of two previous tests performed using a pure oxidic melt, respectively 18 and 44 kg of W% 80 UO{sub 2} + 20 ZrO{sub 2} melt quenched in 1-m-depth water at saturation at 5.0 MPa. In all the tests, significant breakup and quenching took place during the melt fall through the water. No steam explosion occurred. In the tests performed with a pure oxide UO{sub 2}-ZrO{sub 2} melt, part of the corium (from 1/6 to 1/3) did not breakup and reached the bottom plate still molten whatever the water depth was. Test L-11 data suggest that full oxidation and complete breakup of the melt occurred during the melt fall through the water. A proportion of 64% of the total energy content of the melt was released to the water during this phase ({approximately}1.5 s), against 44% for L-14. The maximum temperature increase of the bottom plate was 330 K (L-14). The mean particle size of the debris ranged between 2.5 and 4.8mm.

  8. Pharmacokinetics of sugammadex 16 mg/kg in healthy Chinese volunteers.

    Science.gov (United States)

    de Kam, Pieter-Jan; Hou, Jie; Wang, Zaiqi; Lin, Wen Hong; van den Heuvel, Michiel

    2015-06-01

    Elimination of sugammadex occurs predominantly via the kidneys, with the majority of the drug excreted unchanged in the urine. To date, most studies with sugammadex have been performed in non-Asian populations. The objectives of this open-label study were to determine the pharmacokinetics (PK) and safety of single-dose sugammadex (16 mg/kg) in healthy Chinese adult volunteers. 12 Chinese subjects (6 male; 6 female) received intravenous sugammadex (16 mg/kg) as a 10-second bolus infusion. Blood samples were collected pre-sugammadex and at regular intervals up to 24 hours post-sugammadex for PK assessment. Safety was assessed via AEs, vital signs, electrocardiogram, and laboratory parameters. Following sugammadex 16 mg/kg infusion, peak sugammadex concentration was 197 μg/mL, clearance was 99.7 mL/min, and apparent volume of distribution at equilibrium was 10.5 L. Plasma sugammadex concentrations showed a polyexponential decline over time, with an overall geometric mean (CV%) terminal half-life of 145 minutes (17.9%) (139 minutes (17.7%) for males; 152 minutes (18.6%) for females). No influence of gender on the PK of sugammadex was observed. Three subjects experienced an adverse events (AE) (dysgeusia of mild intensity), which was considered possibly or probably related to sugammadex. There were no clinically significant changes in vital signs, electrocardiography or laboratory parameters. PK of sugammadex (16 mg/kg) was characterized in healthy Chinese subjects. Overall between-subject variability on clearance and apparent volume of distribution was ~ 10%. Sugammadex was generally well tolerated.

  9. Cloning, purification and characterization of a thermostable β-galactosidase from Bacillus licheniformis strain KG9.

    Science.gov (United States)

    Matpan Bekler, F; Stougaard, P; Güven, K; Gül Güven, R; Acer, Ö

    2015-06-28

    A thermo— and alkalitolerant Bacillus licheniformis KG9 isolated from Taşlıdere hot water spring in Batman/Turkey was found to produce a thermostable β—galactosidase. Phylogenetic analysis showed that the 16S rRNA gene from B. licheniformis strain KG9 was 99.9% identical to that of the genome sequenced B. licheniformis strain DSM 13. Analysis of the B. licheniformis DSM 13 genomic sequence revealed four putative β—galactosidase genes. PCR primers based on the genome sequence of strain DSM 13 were used to isolate the corresponding β—galactosidase genes from B. licheniformis strain KG9. The calculated molecular weights of the β—galactosidases I, II, III, and IV using sequencing data were 30, 79, 74, and 79 kDa, respectively. The genes were inserted into an expression vector and recombinant β—galactosidase was produced in Escherichia coli. Of the four β—galactosidase genes identified in strain KG9, three of them were expressed as active, intracellular enzymes in E. coli. One of the recombinant enzymes, β—galactosidase III, was purified and characterized. Optimal temperature and pH was determined to be at 60 ºC and pH 6.0, respectively. Km was determined to be 1.3 mM and 13.3 mM with oNPG (ortho—nitrophenyl—β—D—galactopyranoside) and lactose as substrates, respectively, and Vmax was measured to 1.96 μmol/min and 1.55 μmol/min with oNPG and lactose, respectively.

  10. 40 KG Sample of Fish-Clay from Stevns Klint, Denmark

    Science.gov (United States)

    Gwozdz, R.; Hansen, H. J.; Rasmussen, K. L.

    1992-07-01

    In March 1986 a 50-m-long exposure of the cliff at Stevns Klint fell down and exposed about 40 square meters of Fish Clay. Due to this extraordinary event we were able to pick by hand about 50 kg black KT boundary layer material. After drying, the material was homogenized using a wooden pestle and an agate mortar. The powdered material was sieved through 200 mesh nylon gauze. The fraction larger than 200 mesh was collected and powdered again in an agate mortar. After four repetitions the amount of material with grain size less than 200 mesh was about 40 kg. The fraction larger than 200 mesh was reduced to about 7 kg. The 40-kg powder was mixed in a rotating polyethylene drum for three weeks. The material was analyzed by instrumental neutron activation analysis, atomic absorption and X-ray fluorescence analysis for about 40 elements. INAA was made on 20 aliquots with weight about 300 mg, 20 aliquots with weight about 80 mg, and 30 with weights between 10 and 20 mg. The preliminary results show that our KT boundary sample (1) is very homogeneous, (2) is very close in composition to other K-T boundary clays analyzed by us or described in the literature, and (3) has an Ir concentration of 32 +- 2 ng/g. We hope that our Fish Clay sample (termed by us "Mesozoic Midnight") after analysis in other laboratories and by other analytical methods may qualify as reference material in analytical work on boundary clay material.

  11. Chemical reactor for a PUREX reprocessing plant of 200Kg U/day capacity

    International Nuclear Information System (INIS)

    Oliveria Lopes, M.J. de.

    1974-03-01

    Dissolution of spent reactor fuels in Purex process is studied. Design of a chemical reactor for PWR elements, 3% enriched uranium dioxide with zircaloy cladding, for a 200Kg/day uranium plant is the main objective. Chop-leach process is employed and 7.5M nitric acid is used. Non-criticality was obtained by safe geometry and checked by spectrum homogeneous calculus and diffusion codes. Fuel cycle is considered and decladding and dissolution are treated more accurately

  12. The Study of the Influence of Urea and Hexa Methylene Tetramine (HMTA) Additive on the Total Gelation Process of Uranium on the Chemical Characteristic of the Poly (Uranate-Vinyl Alcohol) Gel

    International Nuclear Information System (INIS)

    Damunir

    2007-01-01

    The study of the influence of urea and Hexa methylene tetramine (HMTA) additive on the total gelation process of uranium on the chemical characteristic of the poly (uranate-vinyl alcohol) gel was done. First of all the 1M uranyl nitrate solution was heated at 70 °C, then variation the 1,2,3,4 and 5M urea additive was studied. Urea was added to the hot solution, and stirred for 10 minutes, producing the colloid particles of UO 3 . The mixing and heating up for 20 minutes, the colloid of UO 3 solution reacted by mixed of THF-PVA 1:1 solution. The solution was cooled at 32°C for 2 hours, and then variation the 1,2,3,4 and 5M HMTA additive was studied. HMTA was added into solution at 32°C and was stirred to form the homogenous sol solution. For the poly (urinate-vinyl) gel formation, the sol solution was dropped to the medium solution of 5M NH 5 OH at ambient condition. Gel formatted was microsphere then soaked, washed by NH 4 OH and hot water to release the chemical matters which were unreacted, was dried at 60°C and then dried at 150°C for 4 hours. The chemical characteristic of gel was made, covering the analyzed of colour, shape and diameter microsphere using optical microscope. Next, the analysis of molecular composition of the gel, using Fourier transform infra red spectroscopic (FTIR), was made. The analytical were the qualitative analysis of the absorption band of infra red spectrum on O-U-O-U-O bond, U-O bond and NH 3 , C-OH, C-H and OH functional group at 300-4000 wave numbers. The result of the research showed that the addition of urea and HMTA additive influences on chemical characteristic of the poly (uranate-vinyl alcohol) gel. The optimum condition was at 2-3 M urea and 2- M HMTA concentration. The analyze of absorption band of infra red spectrum showed that the molecular composition of poly (vinyl alcohol) gel was the uranium trioxide, ammonia, water and polyvinyl alcohol molecular contain with the molecular formulas of [2UO 3 .2 NH 3 .H 2 O

  13. Ionizing radiation effects on the KG1A primitive hematopoietic cell line

    International Nuclear Information System (INIS)

    Clave, Emmanuel; Carosella, Edgardo D.; Gluckman, Eliane; Dubray, Bernard; Socie, Gerard

    1996-01-01

    Purpose: Better understanding of radiation-induced effects on the hematopoietic system is important in both the context of therapeutic intervention and accidental exposure. However, direct study of these effects on the hematopoietic stem cell pool is hampered by the small number of accessible cells. We, thus, studied radiation-induced effects on the KG1a stem cell line. Methods and Materials: We confirmed and extended the immunophenotype of KG1a with monoclonal antibodies, established a radiation survival curve, and quantified mRNAs by Northern blotting 30 min after 1, 2, and 3 Gy of ionizing radiation (IR) and followed for up to 48 h after a 3 Gy dose. Cell cycle status and apoptosis were assessed by fluorescent-activated cell sorter (FACS) analysis, cell morphology, and DNA fragmentation. Results: KG1a was found to be CD34+, CD7+, Thy1 low, CD38 low, lineage negative (neg), C-KITneg and HLA-DRneg, a phenotype consistent with a primitive hematopoietic origin. This immunophenotype was not altered by x-ray irradiation. The D 0 value was 1.75 Gy. We showed a time-dependent variation of c-jun mRNA expression with an early and transient dose-dependent induction followed by a second increase at 24 and 48 h: a biphasic dose-dependent variation of bcl-2 expression 30 min after irradiation with a reduction of mRNA level at 1 Gy, and a normalization at higher doses and stable levels of mRNA for c-fos, c-myc, G-CSF, GM-CSF, IL-6, TNF-α, TGF-β, and MIP-1α genes. Cell cycle analysis showed the absence of G1/S phase arrest, a point consistent with the absence of detection of P53 mRNA by Northern blot analysis. The dose-dependent G2/M phase arrest was not followed by significant apoptotic cell death. Conclusion: Taken together, this data indicates that radiation-induced cell death of KG1a, a cell line that has a relatively high D 0 value, does not seem to be the result of the apoptotic pathway but occurs subsequent to a G2/M phase arrest

  14. New Admissions to the K.G. Paustovsky Moscow Literary Museum-Center

    Directory of Open Access Journals (Sweden)

    Angelica I. Dormidontova

    2018-03-01

    Full Text Available This is an overview of а new collection received by the K.G. Paustovsky Moscow Literary Museum-Center in 2017, the year of the 125th anniversary of his birth. The collection consists of 366 items. Among them are manuscripts, biographical documents, letters, books with autographs, photographs, posters, booklets, and drawings. These items are of considerable interest for the study of the writer’s methods, his biography as well as for understanding the circle of his contacts. The overview incorporates a number of authentic documents.

  15. Studies of flow configurations up to the critical phenomenon at 80 kg/cm2

    International Nuclear Information System (INIS)

    Raisson, C.

    1968-12-01

    Tests performed at 80 kg/cm 2 allow to study two-phase flows and their evolution up to the critical heating. Three measurement methods have been used simultaneously: thermocouples, conductivity probe, short length pressure drops after the output. The 282 cm length stainless steel channel has an internal diameter of 0.6 cm and a wall thickness of 0.2 cm. Flow configuration results are comparable to those of the literature with some precision regarding some transition zones. Two critical heating regimes have been highlighted. The results demonstrate the interest of the method and the importance of hydrodynamic parameters on the critical heating phenomenon [fr

  16. A 27-kg mucinous cystadenoma of the ovary presenting with deep vein thrombosis.

    Science.gov (United States)

    Tola, Esra Nur; Erdemoğlu, Evrim; Yalçın, Yakup; Alkaya Solmaz, Filiz; Erdemoğlu, Ebru

    2016-03-01

    Giant ovarian adenomas are rarely observed today because of early diagnosis and treatment. Mucinous cystadenomas is a kind of tumor that mostly causes the ovary to enlarge. Theu can present with various and non-specific clinical manifestations such as deep vein thrombosis. The primary symptoms of giant ovarian tumors are abdominal enlargement and distension. Therefore, making the correct preoperative diagnosis is sometimes difficult. The appropriate treatment must include oncologic procedures and a multidisciplinary approach to minimalize complications and save the patient's life. Herein, we report a woman aged 53 years with a 27-kg ovarian mucinous cystadenoma that presented as a left popliteal vein thrombosis.

  17. GIOVE, a shallow laboratory Ge-spectrometer with 100 μBq/kg sensitivity

    Energy Technology Data Exchange (ETDEWEB)

    Heusser, G.; Weber, M.; Denz, T.; Hakenmueller, J.; Hofacker, R.; Lackner, R.; Lindner, M.; Maneschg, W.; Reisfelder, M.; Simgen, H.; Schreiner, J.; Stolzenburg, D.; Strecker, H.; Westermann, J. [Max-Planck-Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany)

    2013-08-08

    A new germanium gamma spectrometer called GIOVE (Germanium spectrometer with Inner and Outer Veto) has been set up at the underground/shallow laboratory (15 m w.e.) of MPI-K. Its double plastic scintillator veto system and neutron moderation interlayer lower the background by more than one order of magnitude compared to the other existing spectrometer at this facility. The integral (40-2700 keV) background rate of about 290 counts (day kg){sup −1} is just a factor 4 to 8 above that of the GeMPI spectrometers operated at LNGS (3800 m w.e.) and thus proves that even under shallow overburden sub mBq/kg sensitivities are achievable. Extended material screening and neutron attenuation studies preceded the final design of the spectrometer. The technical realization of the spectrometer is described in detail with special emphasis on the inner veto system. For its optimisation a simulation model was developed for light collection on small low activity PMT’s under various geometrical conditions. Radon suppression is accomplished by employing a gas tight sample container and a nitrogen flushed glove-box system with an airlock. The active volume of the crystal was modelled by absorption scanning measurements and Monte Carlo simulations. The complete shield is implemented in a Geant4 based simulation framework.

  18. CDEX-1 1 kg point-contact germanium detector for low mass dark matter searches

    International Nuclear Information System (INIS)

    Kang Kejun; Yue Qian; Wu Yucheng

    2013-01-01

    The CDEX collaboration has been established for direct detection of light dark matter particles, using ultra-low energy threshold point-contact p-type germanium detectors, in China JinPing underground Laboratory (CJPL). The first 1 kg point-contact germanium detector with a sub-keV energy threshold has been tested in a passive shielding system located in CJPL. The outputs from both the point-contact P + electrode and the outside N + electrode make it possible to scan the lower energy range of less than 1 keV and at the same time to detect the higher energy range up to 3 MeV. The outputs from both P + and N + electrode may also provide a more powerful method for signal discrimination for dark matter experiment. Some key parameters, including energy resolution, dead time, decay times of internal X-rays, and system stability, have been tested and measured. The results show that the 1 kg point-contact germanium detector, together with its shielding system and electronics, can run smoothly with good performances. This detector system will be deployed for dark matter search experiments. (authors)

  19. Preliminary results of sedimentation study in SMART, Kg. Berembang holding pond

    International Nuclear Information System (INIS)

    Jeremy Andy Dominic; Wan Zakaria Wan Md Tahir; Lakam Mejus; Juhari Mohd Yusuf; Kamaruzaman Mohamad; Mod Omar Hassan

    2010-01-01

    Full text: Spatial variations of the sediment bulk density profile in the Storm water Management And Road Tunnel (SMART) holding pond were measured at every 20 metre intervals along six cross section lines with a total of 72 sampling points using a Cs-137 nuclear backscatter probe. The bulk density profile at each sampling points were vertically measured at every 2 inches increment in an upward direction. The thickness of the deposited sediment varies spatially with a gradual increase towards the centre of the holding pond. The highest sediment deposition areas are located near the baffle walls, the centre and the south east corner of the holding pond. The maximum thickness of the deposited sediment adjacent to the baffle walls is 22 inch and at both the centre and south east area are 18 inch. The sediment bulk density profile varies from 1,010 kg.m -3 to 1,400 kg.m -3 . Spatial density variations are in correlation with the active and inactive zone in the pond area. The potential of sediment deposition and consolidation process is higher in the inactive zone compare to the active zone, therefore the bulk density value the inactive zone is much higher. (author)

  20. Characterization of BG28 and KG3 filter glass for Drive Diagnostic Attenuators

    Energy Technology Data Exchange (ETDEWEB)

    Page, R H; Weiland, T; Folta, J

    2007-11-30

    BG28 and KG3 filter glasses were tested for use as attenuators in the NIF drive diagnostic (DrD) systems. Tests were performed in the Optical Sciences Laser facility with a 351 nm, 2-step, 3-nsec pulse at fluences ranging up to {approx} 1 J/cm{sup 2}. Single-shot measurements showed no solarization when the samples were allowed to relax for a week after exposure. KG3 filters exhibited no luminescence and no transient pulse distortion. BG28 filters luminesced appreciably and imposed a 'droop' (similar to 'square-pulse distortion') on the signals. The droop parameter is estimated at 0.50 {+-} 0.11 cm{sup 2}/J. Droop is explained in terms of known copper-doped-glass spectroscopy and kinetics (buildup of triplet-state populations, with excited-state absorption). Simulation of the distortion ({approx}1.6%) expected on a 1.8 MJ Haan pulse led to a minor redesign of the Drive Diagnostic with reduced fluence on the BG28 filters to reduce the droop distortion to 0.5%.

  1. Available phosphorus for 15- to 30-kg pigs kept in hot environment

    Directory of Open Access Journals (Sweden)

    Leandro Alebrante

    2011-12-01

    Full Text Available This experiment was conducted to determine the requirement of available phosphorus (aP for pigs kept in hot environment. Seventy-two pigs (36 castrated males and 36 females with initial weight of 15.10±0.31 kg were allotted in a completely randomized block design with six treatments (0.107, 0.214, 0.321, 0.428, 0.535, and 0.642% of aP, six replicates and two pigs (1 castrated male and 1 female per experimental unit. Pigs were kept in a hot environment with temperature of 34.1±0.8 ºC. The levels of aP influenced the daily weight gain, which increased quadratically up to the estimated level of 0.477%, and feed conversion, which improved quadratically up to the estimated level of 0.457%. The levels of aP also influenced the content of phosphorus in the bone, which increased quadratically up to the estimated level of 0.529%. The available phosphorus requirement of 15- to 30-kg pigs kept in a hot environment, for the best results of daily weight gain, feed conversion and bone parameters are 0.477, 0.457, and 0.529%, corresponding to the estimated daily available phosphorus intakes of 4.75; 4.55 and 5.27 g, respectively.

  2. Available phosphorus levels for 95 to 120 kg barrows genetically selected for lean gain

    Directory of Open Access Journals (Sweden)

    Cláudio Luís Corrêa Arouca

    2012-06-01

    Full Text Available With the objective of evaluating available phosphorus (aP levels in diets for barrows selected for lean meat deposition, eighty commercial hybrid pigs with initial weight of 94.05±1.05 kg were used in this experiment. Pigs were allotted in a completely randomized block design, with five treatments (0.092, 0.156, 0.220, 0,284, and 0.348% of aP, eight replicates and two pigs per experimental unit. The average daily weight gain of pigs increased and the feed conversion improved quadratically with increasing aP in the diets up to the estimated levels of 0.21 and 0.20%, respectively. There was no effect of the dietary aP on average daily feed intake. However, aP intake, bone strength and concentration of phosphorus in the bones increased linearly with increasing aP in the diets. The levels of aP did not affect carcass traits; however, the alkaline phosphatase activity was improved and the values of serum inorganic phosphorus increased quadratically up to the estimated levels of 0.26 and 0.27% of aP, respectively. The available phosphorus levels of 0.21, 0.27, and 0.35%, corresponding to daily aP intakes of 6.34, 8.13, and 10.44 g result, respectively, in greatest performance, blood and bone parameters of 95 to 120 kg barrows selected for lean gain.

  3. Optimization of heat transfer during the directional solidification process of 1600 kg silicon feedstock

    Science.gov (United States)

    Hu, Chieh; Chen, Jyh Chen; Nguyen, Thi Hoai Thu; Hou, Zhi Zhong; Chen, Chun Hung; Huang, Yen Hao; Yang, Michael

    2018-02-01

    In this study, the power ratio between the top and side heaters and the moving velocity of the side insulation are designed to control the shape of the crystal-melt interface during the growth process of a 1600 kg multi-crystalline silicon ingot. The power ratio and insulation gap are adjusted to ensure solidification of the melt. To ensure that the crystal-melt interface is slightly convex in relation to the melt during the entire solidification process, the power ratio should be augmented gradually in the initial stages while being held to a constant value in the middle stages. Initially the gap between the side and the bottom insulation is kept small to reduce thermal stress inside the seed crystals. However, the growth rate will be slow in the early stages of the solidification process. Therefore, the movement of the side insulation is fast in the initial stages but slower in the middle stages. In the later stages, the side insulation gap is fixed. With these modifications, the convexity of the crystal-melt interface in relation to the melt can be maintained during the growth process with an approximately 41% reduction in the thermal stress inside the growing ingot and an 80% reduction in dislocation density along the center line of the ingot compared with the original case.

  4. Fast-response cryogenic calorimeter containing a 52-KG radiation absorber

    International Nuclear Information System (INIS)

    Bendt, P.J.; Yarnell, J.L.

    1977-01-01

    An isothermal liquid helium boiloff calorimeter containing a 52-kg copper radiation absorber, and having a time constant 235 U foils irradiated in a nuclear reactor. The short response time was achieved by the large reduction in heat capacity of solids at 4 0 K, and by nearly isothermal operation. Though the initial power level was approx.3 W, the maximum thermal energy storage was approx.1 joule. The Al clad foils were transported in approx.1 s, and cooled to liquid helium temperature in approx.3 s. Boil-off helium gas was warmed to room temperature in a controlled manner, and measured with a hot-film anemometer flowmeter, which was calibrated by comparison with a dry-test volume flowmeter, and by electric heating of the radiation absorber. The correction for gamma leakage from the absorber was less than or equal to 3%, and the correction at short cooling times for sample cooldown, 2.24-m activity of the Al cladding, and system response time, amounted to 3.4% at 10 s. The overall accuracy (1 sigma) of the radiation measurements is less than or equal to 2%, except at the shortest cooling time (10 s), where it rises to 4%

  5. Experimental Study of Ultralight (<300 kg/m3 Foamed Concrete

    Directory of Open Access Journals (Sweden)

    Xianjun Tan

    2014-01-01

    Full Text Available A type of ultralight (<300 kg/m3 foamed concrete (FC, which can be used as a new energy-conservation and environmental-protection building material and is particularly suitable for the thermal-insulation engineering of building external walls, was produced. The influences of different mixing amounts of fly ash, fly ash activator, WC (WC ratio, and foaming agent (FA on the compressive strength of FC were reported. The experimental study indicated that (1 the addition of fly ash reduced the strength of the FC and that the appropriate mixing amount of fly ash in this ultralight FC system should not exceed 45%; (2 with the increasing of fly ash activator, the strength of the FC sample is notably enhanced and the appropriate mixing amount of fly ash activator is 2.5%; (3 the optimized proportion of WC ratio is 0.45, and the FC that was produced according to this proportion has relatively high compressive strength; (4 by increasing the mixing amount of FA, the compressive strength of the FC notably decreases, and the optimal mixing amount of FA in this experiment is 3.5%.

  6. Modification Of Coffe Fruits Breaking Machine Two Cylinder Type With Capacity 700 Kg Jam

    Directory of Open Access Journals (Sweden)

    M.C. Tri Atmodjo

    2017-08-01

    Full Text Available Modification of a tool is an early activity of the business development of a product that is needed by the community. In this case wants a tool or breaking machine to improve the production of fast precise and efficient. Because there are still many farmers who use single cylindrical coffee-breaking machine even most still use traditional or manual way. The purpose of this research is to modify the simple two-cylinder wet coffee breaking tool so that it can be easily applied in the community especially to small and medium-sized coffee of farmers in rural areas and to improve the production result in order to achieve the appropriate result both in the work and quality. . From the calculation of the machine obtained high dimension 1200 mm width 450 mm and length 600 mm. With the material characteristics are Sheet plate Shaft Iron frame Cylindrical breaker Bearing Pulley Belt and gasoline engine 6.5 HP. The results of this machine operation is a coffee fruit that has been broken with a capacity of 800 kg hour.

  7. Oxygen breathing accelerates decompression from saturation at 40 msw in 70-kg swine.

    Science.gov (United States)

    Petersen, Kyle; Soutiere, Shawn E; Tucker, Kathryn E; Dainer, Hugh M; Mahon, Richard T

    2010-07-01

    Submarine disaster survivors can be transferred from a disabled submarine at a pressure of 40 meters of seawater (msw) to a new rescue vehicle; however, they face an inherently risky surface interval before recompression and an enormous decompression obligation due to a high likelihood of saturation. The goal was to design a safe decompression protocol using oxygen breathing and a trial-and-error methodology. We hypothesized that depth, timing, and duration of oxygen breathing during decompression from saturation play a role to mitigate decompression outcomes. Yorkshire swine (67-75 kg), compressed to 40 msw for 22 h, underwent one of three accelerated decompression profiles: (1) 13.3 h staged air decompression to 18 msw, followed by 1 h oxygen breathing, then dropout; (2) direct decompression to 18 msw followed by 1 h oxygen breathing then dropout; and (3) 1 h oxygen prebreathe at 40 msw followed by 1 h mixed gas breathing at 26 msw, 1 h oxygen breathing at 18 msw, and 1 h ascent breathing oxygen. Animals underwent 2-h observation for signs of DCS. Profile 1 (14.3 h total) resulted in no deaths, no Type II DCS, and 20% Type I DCS. Profile 2 (2.1 h total) resulted in 13% death, 50% Type II DCS, and 75% Type I DCS. Profile 3 (4.5 h total) resulted in 14% death, 21% Type II DCS, and 57% Type I DCS. No oxygen associated seizures occurred. Profile 1 performed best, shortening decompression with no death or severe DCS, yet it may still exceed emergency operational utility in an actual submarine rescue.

  8. The effects of 450 kg surface explosions at the E layer of the ionosphere

    International Nuclear Information System (INIS)

    Fitzgerald, T.J.; Carlos, R.C.

    1992-01-01

    A network of hf ionospheric sounders consisting of two transmitter and two receiver stations was deployed to detect the effects of acoustic waves generated by surface ground motion following an underground nuclear test (UGT) at the Nevada Test Site. The frequency of the transmissions were chosen so that the hf radio waves were totally reflected in the E layer of the ionosphere at an altitude of approximately 100 km. The transmissions were highly stable cw tones at two frequencies separated by 100 kHz so that two altitudes separated by approximately .5 km could be sensed. The network sampled four geographic locations in the ionosphere ranging from almost directly overhead of the UGT out to a horizontal range of 60 km. The ionospheric sounders detected disturbances on all the paths beginning at approximately 325 s after the UGT which persisted for up to 100 s. These disturbances will be described in detail in a later paper. Shortly after the UGT an extended series of ionospheric disturbances were detected which we ascribe to the arrival of acoustic shock waves at the E layer caused by the surface detonation of ordinance with effective yields of 450 kg of high explosive during an unrelated exercise conducted by the U. S. Air Force at a nearby bombing range. The conjunction of these disturbances produced a direct comparison of the effects of UGT's and surface explosions in the ionosphere. In this paper we describe the effects produced by the surface explosions and interpret the disturbance in terms of diffraction induced by electron density changes accompanying the passage of the acoustic waves from the explosions through the reflection altitudes

  9. Preliminary Results on a Contact between 4 kg of Molten UO2 and Liquid Sodium

    International Nuclear Information System (INIS)

    Amblard, M.

    1976-01-01

    The CORECT II Experiment consists in simulating the penetration of sodium into an assembly when the fuel is molten. In other words, it is a shock-tube type of experiment with dimensions representative of a full-scale assembly. the experiment consists in dropping a 100 litre column of sodium onto partially molten UO 2 . The following measurements are carried out in transient regime: - sodium velocity in the column; - pressure in the interaction chamber; - pressures at the bottom and at the top of a 5 m tube; - pressure in the argon blanket. The experimental parameters are: - the mass of UO 2 involved (about 4 or 7 kg of 80% molten UO 2 ); - the initial temperature of the sodium (up to 700 deg. C); - the pressure of the residual gas in the interaction chamber during the fall of the sodium; - the dimensions of the interaction chamber and the sodium supply tube; - the form of contact between the UO 2 and the sodium (the sodium may fall on partially liquid and settled UO 2 or on UO 2 pre-dispersed by forced trapping of sodium). To date, 6 tests have been performed. These tests have always resulted in fine fragmentation without any violent interaction. Since no knowledge is available on the change of grain size distribution with time, on the temperature of grain formation, and on the grain movement in the sodium, it is very difficult to interpret these UO 2 -Na tests. We intend to carry out more severe interaction tests on this experimental set-up, by eliminating as much as possible the non-condensable gas which cushions the mechanical impact of the sodium on the UO 2 (tests have shown that by strongly de-pressurizing the liquid UO 2 the fuel could be dispersed by boiling, and this effect should also improve the possibilities of a liquid/liquid contact). - by injecting a little sodium into the UO 2 to facilitate its dispersion in the coolant

  10. Fixation and mobilisation of uranium and its radioactive decay products in C-richwater sediments; Festlegung und Mobilisierung von Uran und seinen radioaktiven Zerfallsprodukten in kohlenstoffreichen Gewaessersedimenten

    Energy Technology Data Exchange (ETDEWEB)

    Nassour, Mohammad

    2014-05-27

    organic carbon as main metabolic energy source for low order lotic ecosystems on the fixation of uranium was investigated by analyzing, the effects of leaves (coarse particulate organic matter: CPOM) and their degradation products (mainly fine particulate organic matter: FPOM and biofilms etc.). It was found that the highly mobile fraction of uranium in the water pathway, preferably present under the given conditions in the form different uranyl-carbonato-complexes, is efficiently fixed on fresh organic plant material (plant litter, leaves) in the first steps of organic matter decomposition within a few days. But it also can be immobilized relatively stable. It was also found that CPOM is a temporary sink for uranium, which may be sedimented depending on the turbulence flow and discharge. This may contribute to the directional removal of uranium from the water into the sediment. Finally this work analyzed the conditions in the pelagic and benthic zone of the Neuensalz pre dam of the Poehl reservoir, which is located downstream of the mining site. It presents a periodically stagnant water body with seasonally continuous sedimentation, a possible stable sink of uranium and products of radioactive decay in early diagenesis. Water samples of the pelagic zone and undisturbed sediment cores were taken and analyzed during winter stagnation. The results are discussed in front of seasonal changes in water chemistry and load data. {sup 238}U and {sup 226}Ra showed a culmination of activity concentrations in the sediment horizons from 25 to 35 cm depth, in particular at a centrally located sampling point (K3). At this point highest activity concentrations of {sup 238}U were found with a median value of 770 Bq*kg{sup -1} at a depth of 30 cm. At the same location {sup 226}Ra shows activity concentrations of 250 Bq*kg{sup -1}(median). Based on the {sup 137}Cs dating method a sedimentation rate of 1.5 cm*yr{sup -1} was calculated for the pre-dam Neuensalz sediment. On average

  11. Pregnancy outcomes in a cohort of women with a preconception body mass index >50 kg/m²

    DEFF Research Database (Denmark)

    Bonnesen, Barbara; Secher, Niels J; Møller, Lars K

    2013-01-01

    analyzed as relative risks by a two-proportion z-test. Women with preconception BMI >50 kg/m(2) smoked, developed gestational diabetes and pre-eclampsia, and needed induction of labor more frequently than mothers with BMI ≤50 kg/m(2) . Examination of the case records showed that many attempted vaginal...

  12. The Construal of Midwives by Pregnant Women with a Body Mass Index Greater Than or Equal to 30 kg/m2 (BMI ≥ 30 kg/m2 ): A Repertory Grid Study.

    Science.gov (United States)

    Hodgkinson, Emma L; Smith, Debbie M; Hare, Dougal Julian; Wittkowski, Anja

    2017-03-01

    To explore the construal of midwives by pregnant women with a body mass index greater than 30 kg/m 2 (BMI ≥ 30 kg/m 2 ). Ten pregnant women with a BMI ≥ 30 kg/m 2 were recruited from antenatal clinics at a maternity hospital in the North West of England. Each participant completed a repertory grid. The participants chose people to match roles including themselves, pregnant women, midwives of different BMIs and hypothetical elements. They also generated psychological constructs to describe them. Pregnant women with a BMI ≥ 30 kg/m 2 construed themselves as vulnerable and self-conscious. Some women endorsed obesity-related stereotypes for themselves and felt responsible for their weight. The midwife with a BMI 18 stereotypes. Copyright © 2016 John Wiley & Sons, Ltd. Pregnant women with a BMI ≥ 30 kg/m 2 construe themselves as vulnerable and self-conscious and perceive themselves responsible for their weight. Pregnant women with a BMI ≥ 30 kg/m 2 construe midwives with a low BMI as having an undesirable, cold, interpersonal style. Midwives with a raised BMI are construed as similar to the women, because they share the uncomfortable psychological consequences of a raised BMI. The nature of pregnant women's construal may affect their engagement and satisfaction with maternity services and midwifery care. Copyright © 2016 John Wiley & Sons, Ltd.

  13. Perbandingan Penambahan PePerbandingan Penambahan Petidin 0,25 mg/kgBB dengan Klonidin 1 µg/kgBB pada Bupivakain 0,25% untuk Blok Infraorbital pada Labioplasti Anak terhadap Lama Analgesia Pascaoperasi

    Directory of Open Access Journals (Sweden)

    Dewi Ramadani

    2014-08-01

    Full Text Available Post operative pain for labioplasty can be prevented by bilateral infraorbital block. This study aimed to compare the effectiveness addition of pethidine 0.25 mg/kgBW and clonidine 1 µg/kgBW to bupivacaine 0.25% for postoperative analgesia using infraorbital block in paediatric labioplasty with a pain scale score face, leg, activity, cry, consolability (FLACC. The study was a single-blind randomized controlled trial from March to September 2013 involving 30 pediatric patients, physical status American Society of Anesthesiologist (ASA II, ages 3 months–1 year for labioplasty surgery with bilateral infraorbital block at Dr. Hasan Sadikin Hospital Bandung. Subjects were grouped into two groups: 15 subjects using adjuvant pethidine 0.25 mg/kgBW (BP and 15 subjects using adjuvant clonidine 1 ug/kgBW (BK. After induction of anesthesia, infraorbital block done 1 mL on each side of the face. Data were analyzed by t test, showed a highly significant difference (p<0.01 in BP group compared with BK, the average length of postoperative analgesia 1.828 minutes (30 hours vs 1072 minutes (18 hours. The conclusions is the addition of pethidine 0.25 mg/kgBW in bupivacaine 0.25% to infraorbital block in paediatric labioplasty provide postoperative analgesia longer than of clonidine 1 µg/kgBW.

  14. New Phase in the System Uranium-Molybdenum-Silicon; Nouvelle phase dans le systeme uranium-molybdene-silicium; Novaya faza v sisteme uran-molibden'-kremnij; Una fase nueva en el sistema uranio-molibdeno-silicio

    Energy Technology Data Exchange (ETDEWEB)

    Sikirica, M.; Ban, Z. [Rudjer Bokovic Institute, Zagreb, Yugoslavia (Croatia)

    1963-11-15

    During the investigation of the ternary system uranium-molybdenum-silicon, a new phase with the composition U{sub 4}Mo{sub 5}-Si{sub 3} was formed. Structure determination exclusively based on the powder data showed that the particular phase belongs to the hexagonal system. Space group P6/mmc or one of the sub-groups is indicated. Unit cell dimensions were found to be a = 5.37{sub 0}A, c = 8 . 58{sub 2}A. A comparison of calculated and observed intensities shows close resemblance to the structure of the Laves phases of the C14-type. (author) [French] Au cours de recherches sur le systeme ternaire uranium-molybdene-silicium, on a constate la formation d'une nouvelle phase, de composition U{sub 4}Mo{sub 5}Si{sub 3}. Une determination de la structure, exclusivement fondee sur des donnees relatives a la poudre, a revele que cette phase particuliere appartenait au systeme hexagonal. Les auteurs indiquent un groupe spatial P6/mmc ou un des sous-groupes. Les dimensions d'une maille individuelle sont donnees par a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparaison entre l'intensite calculee et Tintensite observee montre une ressemblance etroite avec la structure des phases de Laves du type C-14. (author) [Spanish] En-el curso del estudio del sistema temario uranio-molibdeno-silicio, los autores observaron la formacion de una fase cuya composicion responde a la formula U{sub 4}Mo{sub 5}Si{sub 3}. La determinacion de la estructura, basada exclusivamente en los datos referentes al material en polvo, demuestra que esa fase pertenece al sistema hexagonal. Se senalo la existencia de un grupo especial P6/mmc y se comprobo que las dimensiones de la celda elemental son a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparacion de las intensidades calculadas con las observadas indica que existe una analogia estrecha con la estructura de la fase de Laves del tipo C 14. (author) [Russian] Pri izuchenii trojnoj sistemy uran - molibden - kremnij obrazovalas' novaya faza sostava U{sub 4}Mo{sub 5

  15. (rorKG)

    African Journals Online (AJOL)

    Procedure. Twenty-three variables thought to be the most important in determining profit were chosen for analysis. A mul- tiple regression program was then used to find those. Gross margin per cow in herd. Total dairy animal units. Total amount of milk produced. Product income. Purchased feeds. Home grown concentrates.

  16. gredients (g/kg)

    African Journals Online (AJOL)

    Eugenia

    2015-05-16

    May 16, 2015 ... synthesis and the uptake of exogenous fatty acids supplied by the diet (Kloareg et al., 2007). ... A total of 120 crossbred pigs (Pietrain × Duroc boars and Polish ... were minced, vacuum packed and stored at −20 ºC, pending ...

  17. Assessment of the sedative effects of buprenorphine administered with 10 μg/kg detomidine in horses.

    Science.gov (United States)

    Love, E J; Taylor, P M; Murrell, J; Whay, H R; Waterman-Pearson, A E

    2011-04-09

    The aim of this randomised, observer-blinded, crossover study was to compare the effects of six treatments, administered intravenously to six horses: saline and saline (S/S); detomidine and saline (D/S); detomidine and 5 µg/kg buprenorphine (D/B5); detomidine and 7.5 µg/kg buprenorphine (D/B7.5); detomidine and 10 µg/kg buprenorphine (D/B10); and detomidine and 25 µg/kg butorphanol (D/BUT). The detomidine dose was 10 µg/kg for all treatments in which it was included. Sedation was subjectively assessed and recorded on a visual analogue scale. Peak sedation, duration of sedation and the area under the curve (AUC) for sedation scores were investigated using a univariate general linear model with post-hoc Tukey tests (P<0.05). Peak sedation and duration of sedation were statistically significantly different between treatments (P<0.001). No sedation was apparent after administration of S/S. The AUC was significantly different between treatments (P=0.010), with S/S being significantly different from D/S, D/BUT, D/B5 and D/B7.5, but not D/B10 (P=0.051).

  18. Commercial Optimization of a 100 kg/day PEM based Hydrogen Generator For Energy and Industrial Applications

    International Nuclear Information System (INIS)

    Moulthrop, L.; Anderson, E.; Chow, O.; Friedland, R.; Maloney, T.; Schiller, M.

    2006-01-01

    Commercial hydrogen generators using PEM water electrolysis are well proven, serving industrial applications worldwide in over 50 countries. Now, market and environmental requirements are converging to demand larger on-site hydrogen generators. North American liquid H 2 shortages, increasing trucking costs, developing economies with no liquid infrastructure, utilities, and forklift fuel cell fueling applications are all working to increase market demand for commercial on-site H 2 generation. These commercial applications may be satisfied by a 100 kg H 2 /day module; this platform can be the pathway towards a 500 kg H 2 /day generator desired for small fore-court hydrogen vehicle fueling stations. This paper discusses the steps necessary and activities already underway to develop a 100 to 500 kg H 2 /day PEM hydrogen generator platform to meet commercial market cost targets and approach US DoE transportation fueling cost targets. (authors)

  19. Challenges in device closure of a large patent ductus arteriosus in infants weighing less than 6 kg.

    Science.gov (United States)

    Vijayalakshmi, I B; Chitra, Narasimhan; Praveen, Jayan; Prasanna, Simha Rao

    2013-02-01

    Transcatheter closure of patent ductus arteriosus (PDA) has replaced surgery in most institutions. Despite improvements in techniques and the devices available, closure of large PDA in very small infants remains a challenge. To assess the challenges, feasibility, and efficacy of device closure of large PDA, in infants weighing ≤6 kg. Analysis of device closure of a PDA was done in 61 infants ≤6 kg. Their ages, ranged from 9 days-12 months (mean 8.9 months), weight ranged from 2.2 to 6 kg (mean 5.3 kg), and PDA measured 3.2-8.7 mm (mean 4.8 mm). The fluoroscopy time was 3-18 minutes. The largest device used was 12 × 10 mm. Successful device placement was achieved in 60/61 infants (98.4%). Mild aortic obstruction occurred in 2 cases (3.3%), as the device got displaced towards the aorta after release. The device embolized in 2 cases (3.3%). In one it was retrieved by a novel method like fastening the screw in the aorta and was closed with a 4 × 6 ADO II. In the other infant, with a single kidney, died of uremia after device retrieval. Mild left pulmonary artery (LPA) obstruction occurred in one case (1.6%). Four cases (6.6%) had minor vascular complications. The postprocedure weight gain after 3 months was between 2.5 kg ± 250 mg. Device closure of large PDA in infants weighing ≤6 kg with left ventricular failure is challenging but possible, safe and effective. Retrieval of embolized device could be tricky. © 2012, Wiley Periodicals, Inc.

  20. Pilot scale electron bombardment furnace for continuous casting; application to the trial preparation of 20 kg of uranium monocarbide rods

    International Nuclear Information System (INIS)

    Trouve, J.; Genard, R.; Treillou, A.; Accary, A.

    1964-01-01

    The authors describe a pilot scale electron beam furnace designed for continuous melting and casting of uranium-carbon alloys. This equipment allows the melting and casting processes to be completely automatically controlled, the cooling being carried out under vacuum and the discharge being effected without breaking the vacuum. In a pre-production run of 20 kg of slugs, the composition of practically all the pieces was controlled within ± 0,1 per cent C. The output of the furnace was 2,2 kg/hour. (authors) [fr

  1. Investigations on cesium uranates. Pt. 7

    International Nuclear Information System (INIS)

    Cordfunke, E.H.P.

    1979-01-01

    The thermochemical properties of Cs 2 U 4 O 12 have been evaluated using new experimental data, including the low-temperature heat capacities, the enthalpy of formation at room temperature, and the high-temperature enthaply increments by drop calorimetry. From the results a section of the Cs-U-O phase diagram at 1000 K has been constructed showing the stability of the compound as a function of cesium and oxygen pressure. (orig.) [de

  2. Uran production at the Drosen mine

    International Nuclear Information System (INIS)

    Sittner, Helmar; Duschek, Bernd

    2009-01-01

    In September 1950, SAG Wismuth started the geological and mining work at the area Ronneburg. In the year 1982, the last mine at Drosen took up the underground mining. Still no empirical values were present for the controlling of the underground production. The contribution under consideration reports on first efforts to the determination of geological-qualitative indices of uranium exploitation. At 1st September, 1982, the pits 403 and 415 of the mine Drosen took up the underground mining of uranium

  3. Lipozyme IM-catalyzed interesterification for the production of margarine fats in a 1 kg scale stirred tank reactor

    DEFF Research Database (Denmark)

    Zhang, Hong; Xu, Xuebing; Mu, Huiling

    2000-01-01

    Lipozyme IM-catalyzed interesterification of the oil blend between palm stearin and coconut oil (75/25 w/w) was studied for the production of margarine fats in a 1 kg scale batch stirred tank reactor. Parameters such as lipase load, water content, temperature, and reaction time were investigated...

  4. Multiple Intelligences and ESL Teaching and Learning: An Investigation in KG II Classrooms in One Private School in Beirut, Lebanon

    Science.gov (United States)

    Ghamrawi, Norma

    2014-01-01

    This study examined teachers' use of the Multiple Intelligences Theory on vocabulary acquisition by preschoolers during English as a second language (ESL) classes in a K-12 school in Lebanon. Eighty kindergartners (KG II, aged 5 years) and eight teachers constituted the sample. The study used mixed methods, including observations of videotaped…

  5. Milestone Report - Complete New Adsorbent Materials for Marine Testing to Demonstrate 4.5 g-U/kg Adsorbent

    Energy Technology Data Exchange (ETDEWEB)

    Janke, Christopher James [ORNL; Das, Sadananda [ORNL; Oyola, Yatsandra [ORNL; Mayes, Richard T. [ORNL; Saito, Tomonori [ORNL; Brown, Suree [ORNL; Gill, Gary [PNNL; Kuo, Li-Jung [PNNL; Wood, Jordana [PNNL

    2014-08-01

    This report describes work on the successful completion of Milestone M2FT-14OR03100115 (8/20/2014) entitled, “Complete new adsorbent materials for marine testing to demonstrate 4.5 g-U/kg adsorbent”. This effort is part of the Seawater Uranium Recovery Program, sponsored by the U.S. Department of Energy, Office of Nuclear Energy, and involved the development of new adsorbent materials at the Oak Ridge National Laboratory (ORNL) and marine testing at the Pacific Northwest National Laboratory (PNNL). ORNL has recently developed two new families of fiber adsorbents that have demonstrated uranium adsorption capacities greater than 4.5 g-U/kg adsorbent after marine testing at PNNL. One adsorbent was synthesized by radiation-induced graft polymerization of itaconic acid and acrylonitrile onto high surface area polyethylene fibers followed by amidoximation and base conditioning. This fiber showed a capacity of 4.6 g-U/kg adsorbent in marine testing at PNNL. The second adsorbent was prepared by atom-transfer radical polymerization of t-butyl acrylate and acrylonitrile onto halide-functionalized round fibers followed by amidoximation and base hydrolysis. This fiber demonstrated uranium adsorption capacity of 5.4 g-U/kg adsorbent in marine testing at PNNL.

  6. Women with a BMI ≥ 30kg/m² and their experience of maternity care: A meta ethnographic synthesis.

    Science.gov (United States)

    Jones, Catriona; Jomeen, Julie

    2017-10-01

    this paper is a report of a systematic review and meta-ethnography of the experiences of women with body mass index (BMI) ≥ 30kg/m² and their experience of maternity care. systematic review methods identified 12 qualitative studies about women's experiences of maternity care when their BMI ≥ 30kg/m². Findings from the identified studies were synthesised into themes, using metaethnography. SYNTHESIS AND FINDINGS: the meta-ethnography produced four key concepts; Initial encounters, Negotiating risk, Missing out and The positive intervention, which represent the experiences of maternity care for women with BMI ≥ 30kg/m² KEY CONCLUSION: many women with BMI ≥ 30kg/m² appear to be dissatisfied with the approaches taken to discuss weight status during maternity encounters. When weight is not addressed during these encounters women appear to be equally dissatisfied. The absence of open and honest discussions about weight, the feeling of being denied of a normal experience, and an over emphasis on the risks imposed upon pregnancy and childbirth by obesity, leave women feeling dissatisfied and disenfranchised. Sensitive care and practical advice about diet and exercise can help women move towards feeling more in control of their weight management. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  7. Obstetric and neonatal characteristics of pregnancy and delivery for infant birthweight ≥5.0 kg.

    Science.gov (United States)

    Crosby, David A; Ahmed, Sahar; Razley, Aminah; Morrison, John J

    2017-12-01

    Infant birthweight ≥5.0 kg represents a significant risk factor for mother and neonate. The objective of this study was to examine the obstetric and neonatal outcome measures in a large cohort of such deliveries. The data used for this study were prospectively entered into an obstetric computerized database during the period 1989-2013. All pregnancies where the delivery resulted in an infant weighing ≥5.0 kg were identified. The results were retrospectively analyzed separately for parity, and a separate analysis was performed comparing the outcome measures observed in the earlier years of the study with those of the later years. There were 73,796 deliveries in the time period of which there were n = 201 (0.3%) infants with birth weight ≥5.0 kg. The mean maternal body mass index (BMI) was in the obese category range (30.9 kg/m 2 ) and the median gestation at delivery was 40.8 weeks. The cesarean delivery rate for nulliparous women was 56.3% and for parous women 30.8%. The overall rate of third degree perineal tears was 3.8%, the rate of shoulder dystocia was 4.6% and the rate of Erb's Palsy was 1.5%. There was a significant increase in cesarean delivery in the latter of the study (26.7% versus 43.0%, p = 0.02), due to an increase in the planned pre-labor cesarean deliveries (30.0 versus 12.9%, p = 0.005). There was no difference in adverse outcomes in both groups. These findings describe the features of pregnancy associated with infant birthweight ≥5.0 kg, and outline reliable maternal and neonatal morbidity data for these pregnancies. In this cohort, there was no apparent benefit from increased planned pre-labor cesarean delivery rates.

  8. The Predictive Factors for Diabetic Remission in Chinese Patients with BMI > 30 kg/m2 and BMI < 30 kg/m2 Are Different.

    Science.gov (United States)

    Liang, Hui; Cao, Qing; Liu, Huan; Guan, Wei; Wong, Claudia; Tong, Daniel

    2018-01-15

    Roux-en-Y gastric bypass has been proven to be beneficial for patients with obesity and type 2 diabetes mellitus (T2DM). In less-obese patient (BMI 30-35 kg/m 2 ), surgical treatment is indicated when medication fails to control the T2DM. Asian develops diabetes at a lower BMI. For lower-BMI patients, the rate of diabetes amelioration varies significantly with patients of higher BMI after surgical treatment. The factors that contribute to the post-operative diabetes response rate in lower-BMI patients have not been elucidated. Between 2010 and 2014, a total of 144 patients who underwent gastric bypass for the treatment of T2DM were included for study. Patients were divided into two groups for subgroup analysis, namely BMI > 30 kg/m 2 and BMI BMI group (BMI > 30 kg/m 2 ) was 80% (n = 90) whereas for the lower BMI (BMI BMI group, low HbA1c and high fasting C-peptide are predictive factors whereas for lower-BMI group, along with elevated C-peptide level, disease duration is the positive predictive factor for DM remission. Patients with BMI > 30 kg/m 2 and those with BMI BMI patients while duration of diabetes is for high-low-BMI patients. C-peptide is a predictor of remission in both groups. Further large-scale studies are required to define the predictors of diabetes remission after gastric bypass in low- and high-BMI patients.

  9. A Novel Geriatric Screening Tool in Older Patients with Cancer: The Korean Cancer Study Group Geriatric Score (KG-7.

    Directory of Open Access Journals (Sweden)

    Jin Won Kim

    Full Text Available Geriatric assessment (GA is resource-consuming, necessitating screening tools to select appropriate patients who need full GA. The objective of this study is to design a novel geriatric screening tool with easy-to-answer questions and high performance objectively selected from a large dataset to represent each domain of GA. A development cohort was constructed from 1284 patients who received GA from May 2004 to April 2007. Items representing each domain of functional status, cognitive function, nutritional status, and psychological status in GA were selected according to sensitivity (SE and specificity (SP. Of the selected items, the final questions were chosen by a panel of oncologists and geriatricians to encompass most domains evenly and also by feasibility and use with cancer patients. The selected screening questions were validated in a separate cohort of 98 cancer patients. The novel screening tool, the Korean Cancer Study Group Geriatric Score (KG-7, consisted of 7 items representing each domain of GA. KG-7 had a maximal area under the curve (AUC of 0.93 (95% confidence interval (CI 0.92-0.95 in the prediction of abnormal GA, which was higher than that of G-8 (0.87, 95% CI 0.85-0.89 within the development cohort. The cut-off value was decided at ≤ 5 points, with a SE of 95.0%, SP of 59.2%, positive predictive value (PPV of 85.3%, and negative predictive value (NPV of 82.6%. In the validation cohort, the AUC was 0.82 (95% CI 0.73-0.90, and the SE, SP, PPV, and NPV were 89.5%, 48.6%, 77.3%, and 75.0%, respectively. Furthermore, patients with higher KG-7 scores showed significantly longer overall survival (OS in the development and validation cohorts. In conclusions, the KG-7 showed high SE and NPV to predict abnormal GA. The KG-7 also predicted OS. Given the results of our studies, the KG-7 could be used effectively in countries with high patient burden and low resources to select patients in need of full GA and intervention.

  10. 131I distribution in mice after continuous exposure to ionizing radiation of 0.39 C/kg

    International Nuclear Information System (INIS)

    Mraz, L.; Stollarova, N.

    1982-01-01

    The distribution of 131 I in mice has been investigated under the condition of continuous exposure to daily doses of 0.013 C/kg up to a total dose of 0.39 C/kg. Radioiodine distribution in exposed animals was compared with that in laboratory and field controls at intervals ranging from 0.5 to 24 hours. The group of experimental animals was simultaneously exposed to ionizing radiation and the climatic conditions of the open-air gamma field. Consequently, the metabolic activity of organs decreased during the distribution measurements as is also shown by the low radioiodine level in the thyroid gland. Differences in the distribution in exposed animals as compared with field controls are characteristic of changes caused by ionizing radiation. (author)

  11. [Experimental study on aging effect of Angelica sinensis polysaccharides combined with cytarabine on human leukemia KG1alpha cell lines].

    Science.gov (United States)

    Xu, Chun-Yan; Geng, Shan; Liu, Jun; Zhu, Jia-Hong; Zhang, Xian-Ping; Jiang, Rong; Wang, Ya-Ping

    2014-04-01

    The latest findings of our laboratory showed that Angelica sinensis polysaccharide (ASP) showed a definite effect in regulating the aging of hematopoietic stem cells. Leukemia is a type of malignant hematopoietic tumor in hematopoietic stem cells. There have been no relevant reports about ASP's effect in regulating the aging of leukemia cells. In this study, human acute myeloid leukemia (AML) KG1alpha cell lines in logarithmic growth phase were taken as the study object, and were divided into the ASP group, the cytarabine (Ara-C) group, the ASP + Ara-C group and the control group. The groups were respectively treated with different concentration of ASP, Ara-C and ASP + Ara-C for different periods, with the aim to study the effect of ASP combined with Ara-C in regulating the aging of human acute myeloid leukemia KG1alpha cell lines and its relevant mechanism. The results showed that ASP, Ara-C and ASP + Ara-C could obviously inhibit KG1alpha cell proliferation in vitro, block the cells in G0/G1 phase. The cells showed the aging morphological feature. The percentage of positive stained aging cells was dramatically increased, and could significantly up-regulate the expression of aging-related proteins P16 and RB, which were more obvious in the ASP + Ara-C group. In conclusion, the aging mechanism of KG1alpha cell induced by ASP and Ara-C may be related to the regulation of the expression of aging-related proteins, suggesting that the combined administration of ASP and anticancer drugs plays a better role in the treatment of leukemia .

  12. A Monazite of Bangka Processing Laboratory Work is Undertaken to Recover Rare Earth Oxides for 1 kg/day Capacity

    International Nuclear Information System (INIS)

    Hafni-Lissa-Nuri; Faizal-Riza; Susilaningtyas; Sugeng-Waluyo; Erni-Rifandriyah-Arief

    2004-01-01

    This laboratory work is collaboration P2BGGN-BATAN and PT. Timah Tbk. to obtain monazite data process for use equipment calculation and economic pilot scales. A RE 2 O 3 can be treated to become an individual elements (Ce, Pr, Nd, Pm, Sm, Eu, etc.) and can be used as a raw materials in the industries of electronics, magnetics, ceramics, steels and glass optic etc. RE 2 O 3 which are gained from processing of 100 kg monazite with -325 mesh in size distribution and 1 kg/day capacity will be the sample for PT Timah marketing activity. The process is done with use equipments laboratory scale that were designed last year. The equipment processes are decomposition, dissolution, precipitation tank and calcinator. Total RE 2 O 3 production are 45 kg and total recovery RE 2 O 3 71,696 % ; Th 2,129 % ; U and P 2 O 5 0 %, Purify products RE 2 O 3 93,59 % and Th 1143 ppm. Based on the assessment of Chemex Inc Canada, the product of RE 2 O 3 contains are about >55,32 % RE 2 O 3 and 16 ppm Th. U and Th content within specification product of RE 2 O 3 depends to buyer/request. (author)

  13. NASA's Evolutionary Xenon Thruster (NEXT) Project Qualification Propellant Throughput Milestone: Performance, Erosion, and Thruster Service Life Prediction After 450 kg

    Science.gov (United States)

    Herman, Daniel A.

    2010-01-01

    The NASA s Evolutionary Xenon Thruster (NEXT) program is tasked with significantly improving and extending the capabilities of current state-of-the-art NSTAR thruster. The service life capability of the NEXT ion thruster is being assessed by thruster wear test and life-modeling of critical thruster components, such as the ion optics and cathodes. The NEXT Long-Duration Test (LDT) was initiated to validate and qualify the NEXT thruster propellant throughput capability. The NEXT thruster completed the primary goal of the LDT; namely to demonstrate the project qualification throughput of 450 kg by the end of calendar year 2009. The NEXT LDT has demonstrated 28,500 hr of operation and processed 466 kg of xenon throughput--more than double the throughput demonstrated by the NSTAR flight-spare. Thruster performance changes have been consistent with a priori predictions. Thruster erosion has been minimal and consistent with the thruster service life assessment, which predicts the first failure mode at greater than 750 kg throughput. The life-limiting failure mode for NEXT is predicted to be loss of structural integrity of the accelerator grid due to erosion by charge-exchange ions.

  14. Lower tidal volume strategy (≈3 ml/kg) combined with extracorporeal CO2 removal versus 'conventional' protective ventilation (6 ml/kg) in severe ARDS: the prospective randomized Xtravent-study.

    Science.gov (United States)

    Bein, Thomas; Weber-Carstens, Steffen; Goldmann, Anton; Müller, Thomas; Staudinger, Thomas; Brederlau, Jörg; Muellenbach, Ralf; Dembinski, Rolf; Graf, Bernhard M; Wewalka, Marlene; Philipp, Alois; Wernecke, Klaus-Dieter; Lubnow, Matthias; Slutsky, Arthur S

    2013-05-01

    Acute respiratory distress syndrome is characterized by damage to the lung caused by various insults, including ventilation itself, and tidal hyperinflation can lead to ventilator induced lung injury (VILI). We investigated the effects of a low tidal volume (V(T)) strategy (V(T) ≈ 3 ml/kg/predicted body weight [PBW]) using pumpless extracorporeal lung assist in established ARDS. Seventy-nine patients were enrolled after a 'stabilization period' (24 h with optimized therapy and high PEEP). They were randomly assigned to receive a low V(T) ventilation (≈3 ml/kg) combined with extracorporeal CO2 elimination, or to a ARDSNet strategy (≈6 ml/kg) without the extracorporeal device. The primary outcome was the 28-days and 60-days ventilator-free days (VFD). Secondary outcome parameters were respiratory mechanics, gas exchange, analgesic/sedation use, complications and hospital mortality. Ventilation with very low V(T)'s was easy to implement with extracorporeal CO2-removal. VFD's within 60 days were not different between the study group (33.2 ± 20) and the control group (29.2 ± 21, p = 0.469), but in more hypoxemic patients (PaO2/FIO2 ≤150) a post hoc analysis demonstrated significant improved VFD-60 in study patients (40.9 ± 12.8) compared to control (28.2 ± 16.4, p = 0.033). The mortality rate was low (16.5%) and did not differ between groups. The use of very low V(T) combined with extracorporeal CO2 removal has the potential to further reduce VILI compared with a 'normal' lung protective management. Whether this strategy will improve survival in ARDS patients remains to be determined (Clinical trials NCT 00538928).

  15. Interference-free determination of sub ng kg-1 levels of long-lived 93Zr in the presence of high concentrations (μg kg-1) of 93Mo and 93Nb using ICP-MS/MS.

    Science.gov (United States)

    Petrov, Panayot; Russell, Ben; Douglas, David N; Goenaga-Infante, Heidi

    2018-01-01

    Long-lived high abundance radionuclides are of increasing interest with regard to decommissioning of nuclear sites and longer term nuclear waste storage and disposal. In many cases, no routine technique is available for their measurement in nuclear waste and low-level (ng kg -1 ) environmental samples. Recent advances in ICP-MS technology offer attractive features for the selective and sensitive determination of a wide range of long-lived radionuclides. In this work, inductively coupled plasma-tandem mass spectrometry (ICP-MS/MS)-based methodology, suitable for accurate routine determinations of 93 Zr at very low (ng kg -1 ) levels in the presence of high levels (μg kg -1 ) of the isobaric interferents 93 Nb and 93 Mo (often present in nuclear waste samples), is reported for the first time. Additionally, a novel and systematic strategy for method development based on the use of non-radioactive isotopes is proposed. It relies on gas-phase chemical reactions for different molecular ion formation to achieve isobaric interference removal. Using cell gas mixtures of NH 3 /He/H 2 or H 2 /O 2 , and suitable mass shifts, the signal from the 93 Nb and 93 Mo isobaric interferences on 93 Zr were suppressed by up to 5 orders of magnitude. The achieved limit of detection for 93 Zr was 1.3 × 10 -5  Bq g -1 (equivalent to 0.14 ng kg -1 ). The sample analysis time is 2 min, which represents a significant improvement in terms of sample throughput, compared to liquid scintillation counting methods. The method described here can be used for routine measurements of 93 Zr at environmentally relevant levels. It can also be combined with radiometric techniques for use towards the standardisation of 93 Zr measurements. Graphical abstract Interference-free determination of 93 Zr in the presence of high concentrations of isobaric 93 Mo and 93 Nb by ICP-MS/MS.

  16. Fabrication of a 1200 kg Ingot of V-4Cr-4Ti for the DIII-D Radiative Divertor Program

    International Nuclear Information System (INIS)

    Johnson, W.R.; Smith, J.P.

    1998-01-01

    Vanadium chromium titanium alloys are attractive materials for fusion reactors because of their high temperature capability and their potential for low neutron active and rapid activation decay. A V-4Cr-4Ti alloy has been selected in the U.S. as the current leading candidate vanadium alloy for future use in fusion reactor structural applications. General Atomics (GA), in conjunction with the Department of Energy's (DOE) DIII-D Program, is carrying out a plan for the utilization of this vanadium alloy in the DIII-D tokamak. The plan will culminate in the fabrication, installation, and operation of a V-4Ti alloy structure in the DIII-D Radiative Divertor (RD) upgrade. The deployment of vanadium alloy will provide a meaningful step in the development and technology acceptance of this advanced material for future fusion power devices. Under a GA contract and material specification, an industrial scale 1200 kg heat (ingot) of a V-4Cr-4Ti alloy has been produced and converted into product forms by Wah Chang of Albany, Oregon (WCA). To assure the proper control of minor and trace impurities which affect the mechanical and activation behavior of this vanadium alloy, selected lots of raw vanadium base metal were processed by aluminothermic reduction of high purity vanadium oxide, and were then electron beam melted into two high purity vanadium ingots. The ingots were then consolidated with high purity Cr and Ti, and double vacuum-arc melted to obtain a 1200 kg V-4Cr-4Ti alloy ingot. Several billets were extruded from the ingot, and were then fabricated into plate, sheet, and rod at WCA. Tubing was subsequently processed from plate material. The chemistry and fabrication procedures for the product forms were specified on the basis of experience and knowledge gained from DOE Fusion Materials Program studies on previous laboratory scale heats and a large scale ingot (500 kg)

  17. Magnetic Modeling of Inflated Low-mass Stars Using Interior Fields No Larger than ˜10 kG

    Science.gov (United States)

    MacDonald, James; Mullan, D. J.

    2017-11-01

    We have previously reported on models of low-mass stars in which the presence of inflated radii is ascribed to magnetic fields that impede the onset of convection. Some of our magneto-convection models have been criticized because, when they were first reported by Mullan & MacDonald, the deep interior fields were found to be very large (50-100 MG). Such large fields are now known to be untenable. For example, Browning et al. used stability arguments to suggest that interior fields in low-mass stars cannot be larger than ˜1 MG. Moreover, 3D models of turbulent stellar dynamos suggest that fields generated in low-mass interiors may be not much stronger than 10-20 kG. In the present paper, we present magneto-convective models of inflated low-mass stars in which the interior fields are not permitted to be stronger than 10 kG. These models are used to fit empirical data for 15 low-mass stars for which precise masses and radii have been measured. We show that our 10 kG magneto-convective models can replicate the empirical radii and effective temperatures for 14 of the stars. In the case of the remaining star (in the Praesepe cluster), two different solutions have been reported in the literature. We find that one of these solutions can be fitted well with our model using the nominal age of Praesepe (800 Myr). However, the second solution cannot be fitted unless the star’s age is assumed to be much younger (˜150 Myr).

  18. A GENDER-BASED KINEMATIC AND KINETIC ANALYSIS OF THE SNATCH LIFT IN ELITE WEIGHTLIFTERS IN 69-KG CATEGORY

    Directory of Open Access Journals (Sweden)

    Erbil Harbili

    2012-03-01

    Full Text Available The objective of this study was to compare the kinematic and kinetic differences in snatch performances of elite 69-kg men and women weightlifters, the only category common to both genders. The heaviest lifts performed by 9 men and 9 women weightlifters competing in 69-kg weight class in Group A in the 2010 World Weightlifting Championship were analyzed. The snatch lifts were recorded using 2 cameras (PAL. Points on the barbell and body were manually digitized by using Ariel Performance Analysis System. The results showed that maximal extension angle of the ankle and knee during the first pull, the knee angle at the end of the transition phase, and maximal extension angle of the knee in the second pull were significantly greater in men (p < 0.05. The angular velocity of the hip was significantly greater in men during the first pull (p < 0.05. During the second pull, women showed significantly greater maximal angular velocity at the hip and ankle joints (p < 0.05. Moreover, the maximal vertical linear velocity of the barbell was significantly greater in women (p < 0.05. The absolute mechanical work and power output in the first pull and power output in the second pull were significantly greater in men (p < 0.05. However, the relative mechanical work was significantly greater in women during the second pull (p < 0.05. The results revealed that in 69-kg weight class, women were less efficient than men in the first pull, which is strength oriented, whereas they were as efficient as men in the second pull, which is more power oriented

  19. First 10 kg of naked germanium detectors installed in liquid nitrogen in GENIUS Test-Facility in GRAN-SASSO

    Energy Technology Data Exchange (ETDEWEB)

    Klapdor-Kleingrothaus, H.V. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)

    2004-07-01

    The GENIUS Test Facility has come into operation in Gran Sasso on May 5, 2003 with its first ten kg of naked Ge detectors in liquid nitrogen. This is the first time that this novel technique for extreme background reduction in search for rare decays is applied under the background conditions of an underground laboratory. GENIUS-TF has the potential to check the DAMA evidence for cold dark matter by modulation, and possibly, to improve the accuracy of the recently observed first signal for neutrinoless double beta decay. (orig.)

  20. First 10 kg of naked germanium detectors installed in liquid nitrogen in GENIUS Test-Facility in GRAN-SASSO

    International Nuclear Information System (INIS)

    Klapdor-Kleingrothaus, H.V.

    2004-01-01

    The GENIUS Test Facility has come into operation in Gran Sasso on May 5, 2003 with its first ten kg of naked Ge detectors in liquid nitrogen. This is the first time that this novel technique for extreme background reduction in search for rare decays is applied under the background conditions of an underground laboratory. GENIUS-TF has the potential to check the DAMA evidence for cold dark matter by modulation, and possibly, to improve the accuracy of the recently observed first signal for neutrinoless double beta decay. (orig.)

  1. Changes of some serum proteins in rats continuously irradiated with daily dose rate of 0. 0258 C/kg

    Energy Technology Data Exchange (ETDEWEB)

    Chlebovska, K; Chlebovsky, O; Praslicka, M [Univerzita P.J. Safarika, Kosice (Czechoslovakia). Katedra Vseobecnej Biologie

    1976-01-01

    Changes of serum albumin, haptoglobin, hemopexin and IgG in rats during chronic /sup 60/Co gamma irradiation with a daily dose rate of 0.0258 C/kg within 44 days were investigated by the method of two-dimensional quantitative immunoelectrophoresis. In comparison with normal levels, the values of albumin and IgG in rats during irradiation decreased until the death of animals to 50%, the values of haptoglobin increased till the 39th day of irradiation to 250% and hemopexin values increased to 150%.

  2. The regulation effect of STAT 5 signaling pathway on the cell cycle progression of irradiated KG-1 cells

    International Nuclear Information System (INIS)

    Guo Dehuang; Dong Bo; Luo Qingliang; Wen Gengyun; Mao Bingzhi

    2000-01-01

    The author investigated the role of the JAK/STAT signaling pathway regulating cell cycle progression in the irradiated KG-1 cells. By permanent transfecting the cells with DN-STAT 5 cDNA to block the JAK/STAT signaling pathway and then transient transfecting with cyclin D 1 or cyclin B 1 cDNA, the effects of cyclin D 1 protein and cyclin B 1 protein on the cell cycle progression were examined. Results showed that after irradiation with 8Gy 60 Co rays, the irradiated KG-1 cells transfected with only DN-STAT 5 cDNA can not recover form the G 1 arrest, even though GM-CSF was added. Meanwhile, the cells transfected with both the DN-STAT 5 cDNA and cyclin D 1 cDNA or cyclin B 1 cDNA can recover from the G 1 arrest or the G 2 arrest to a great extent. Thus, it was proved indirectly that the JAK/STAT signaling pathway activated by GM-CSF regulated the cell cycle progression through cyclin D 1 and cyclin B 1 protein

  3. Factors Influencing ACT After Intravenous Bolus Administration of 100 IU/kg of Unfractionated Heparin During Cardiac Catheterization in Children.

    Science.gov (United States)

    Muster, Ileana; Haas, Thorsten; Quandt, Daniel; Kretschmar, Oliver; Knirsch, Walter

    2017-10-01

    Anticoagulation using intravenous bolus administration of unfractionated heparin (UFH) aims to prevent thromboembolic complications in children undergoing cardiac catheterization (CC). Optimal UFH dosage is needed to reduce bleeding complications. We analyzed the effect of bolus UFH on activated clotting time (ACT) in children undergoing CC focusing on age-dependent, anesthesia-related, or disease-related influencing factors. This retrospective single-center study of 183 pediatric patients receiving UFH during CC analyzed ACT measured at the end of CC. After bolus administration of 100 IU UFH/kg body weight, ACT values between 105 and 488 seconds were reached. Seventy-two percent were within target level of 160 to 240 seconds. Age-dependent differences were not obtained ( P = .407). The ACT values were lower due to hemodilution (total fluid and crystalloid administration during CC, both P ACT values but occurred more frequently in children between 1 month and 1 year of age (91%). In conclusion, with a bolus of 100 IU UFH/kg, an ACT target level of 160 to 240 seconds can be achieved during CC in children in 72%, which is influenced by hemodilution and anticoagulant and antiplatelet premedication but not by age.

  4. An accurate calibration method for high pressure vibrating tube densimeters in the density interval (700 to 1600) kg . m-3

    International Nuclear Information System (INIS)

    Sanmamed, Yolanda A.; Dopazo-Paz, Ana; Gonzalez-Salgado, Diego; Troncoso, Jacobo; Romani, Luis

    2009-01-01

    A calibration procedure of vibrating tube densimeters for density measurement of liquids in the intervals (700 to 1600) kg . m -3 , (283.15 to 323.15) K, and (0.1 to 60) MPa is presented. It is based on the modelization of the vibrating tube as a thick-tube clamped at one end (cantilever) whose stress and thermal behaviour follows the ideas proposed in the Forced Path Mechanical Calibration model (FPMC). Model parameters are determined using two calibration fluids with densities certified at atmospheric pressure (dodecane and tetracholoroethylene) and a third one with densities known as a function of pressure (water). It is applied to the Anton Paar 512P densimeter, obtaining density measurements with an expanded uncertainty less than 0.2 kg . m -3 in the working intervals. This accuracy comes from the combination of several factors: densimeter behaves linearly in the working density interval, densities of both calibration fluids cover that interval and they have a very low uncertainty, and the mechanical behaviour of the tube is well characterized by the considered model. The main application of this method is the precise measurement of high density fluids for which most of the calibration procedures are inaccurate.

  5. New Fiber Materials with Sorption Capacity at 5.0 g-U/kg Adsorbent under Marine Testing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Tomonori [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Brown, S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Das, Sadananda [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Mayes, Richard T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Janke, Christopher James [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dai, Sheng [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kuo, Li-Jung [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strivens, Jonathan E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Schlafer, Nicholas [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wood, J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gill, G. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Flicker Byers, M. [Univ. of Texas, Austin, TX (United States); Schneider, Eric [Univ. of Texas, Austin, TX (United States)

    2016-03-30

    capacities: RIGP adsorbent achieved 5.00 ± 0.15 g U/kg-ads., while ATRP adsorbent achieved 6.56 ± 0.33 g U/kg-ads., after 56 days of seawater exposure. These achieved values are the highest adsorption capacities ever reported for uranium extraction from seawater. The study successfully demonstrated new fiber materials with sorption capacity at 5.0 g-U/kg adsorbent under marine testing conditions. Further optimization, investigation of other new materials as well as deepening our understanding will develop adsorbents that have even higher uranium adsorption capacity, increased selectivity, and faster kinetics.

  6. Níveis de Treonina em Rações para Leitões dos 6 aos 15 kg

    Directory of Open Access Journals (Sweden)

    Rodrigues Nair Elizabeth Barreto

    2001-01-01

    Full Text Available Foram utilizados 75 suínos com peso inicial médio de 5,8 ± 0,4 kg, com o objetivo de avaliar níveis de treonina em rações para leitões com alto potencial genético para deposição de carne magra dos 6 aos 15 kg. Foi usado o delineamento experimental de blocos ao acaso com cinco tratamentos (níveis de treonina, cinco repetições e três animais por unidade experimental. Os tratamentos corresponderam a uma ração basal com 18% PB e 1,108% lisina total, suplementada com cinco níveis de L-treonina, resultando em dietas com níveis de 0,682; 0,732; 0,782; 0,832; e 0,883% de treonina total. Observou-se variação quadrática para ganho de peso diário (GDP, que aumentou até o nível de 0,77%, e para consumo de ração (CR, que aumentou até o nível estimado de 0,73%. Os níveis de treonina também influenciaram de forma quadrática a conversão alimentar (CA, que melhorou até o nível de 0,82%. A relação da lisina digestível verdadeira:treonina digestível verdadeira, no nível que proporcionou os melhores resultados de CA, correspondeu a 100:73. Concluiu-se que leitões com alto potencial genético para carne magra dos 6 aos 15 kg exigem 0,77% de treonina total na ração para máximo ganho de peso e 0,82% para melhor conversão alimentar.

  7. Polarisation properties of irradiated ammonia (NH3 and ND3) at 1 K and 25 kG

    International Nuclear Information System (INIS)

    Riechert, H.

    1982-11-01

    Dynamic Nuclear Polarisation (DNP) of irradiated ammonia was examined in some detail at 1 K and 25 kG. In continuation of earlier studies conducted in Bonn, it was attempted to gain information about the prevailing mechanism of DNP in this material. Therefore the frequency dependence of DNP in NH 3 , of deuterons and unsubstituted protons in ND 3 , as well as the polarising time tau and the relaxation time T 1 in NH 3 were measured. Also the shape of the deuteron polarisation signal observed in ND 3 is discussed. The polarisation measurements in ND 3 rule out the equal spin temperature (EST) behaviour of proton and deuteron DNP that is observed in most of the currently used target materials. It is attempted to explain the observations with a differential solid state effect model. Results of calculations for NH 3 and ND 3 incorporating the measured EPR-spectra are presented. (orig.)

  8. Less is better? Intraindividual and interindividual comparison between 0.075 mmol/kg of gadobenate dimeglumine and 0.1 mmol/kg of gadoterate meglumine for cranial MRI

    Energy Technology Data Exchange (ETDEWEB)

    Khouri Chalouhi, Katia, E-mail: khouri.katia@gmail.com [Scuola di Specializzazione in Radiodiagnostica, Università degli Studi di Milano, Via Festa del Perdono 7, 20122 Milan (Italy); Papini, Giacomo D.E., E-mail: docgde@gmail.com [Unità di Radiologia, IRCCS Policlinico San Donato, Via Morandi 30, 20097 San Donato Milanese, Milan (Italy); Bandirali, Michele, E-mail: michele.bandirali@hotmail.it [Scuola di Specializzazione in Radiodiagnostica, Università degli Studi di Milano, Via Festa del Perdono 7, 20122 Milan (Italy); Sconfienza, Luca M., E-mail: io@lucasconfienza.it [Unità di Radiologia, IRCCS Policlinico San Donato, Via Morandi 30, 20097 San Donato Milanese, Milan (Italy); Dipartimento di Scienze Biomediche per la Salute, Università degli Studi di Milano, Via Morandi 30, 20097 San Donato Milanese, Milano (Italy); Di Leo, Giovanni, E-mail: gianni.dileo77@gmail.com [Unità di Radiologia, IRCCS Policlinico San Donato, Via Morandi 30, 20097 San Donato Milanese, Milan (Italy); Sardanelli, Francesco, E-mail: francesco.sardanelli@unimi.it [Unità di Radiologia, IRCCS Policlinico San Donato, Via Morandi 30, 20097 San Donato Milanese, Milan (Italy); Dipartimento di Scienze Biomediche per la Salute, Università degli Studi di Milano, Via Morandi 30, 20097 San Donato Milanese, Milano (Italy)

    2014-07-15

    Purpose: To retrospectively compare a reduced dose (RD) (0.075 mmol/kg) of gadobenate dimeglumine (RD-gadobenate) with standard single dose (SSD) (0.1 mmol/kg) of gadoterate meglumine (SSD-gadoterate) for cranial MRI. Materials and methods: Thirty-one patients (12 males; aged 52 ± 16 years) underwent cranial MRI with SSD-gadoterate and repeated the examination with RD-gadobenate after a median interval of 10 months. Signal-to-noise ratio (SNR) was obtained on contrast-enhanced images for enhancing lesions (n = 10) as well as for right and left transverse venous sinuses, internal carotid arteries, and parotid glands. Moreover, a consecutive series of 100 cranial MRI with SSD-gadoterate (49 males; aged 51 ± 19 years) was compared with a consecutive series of 100 cranial MRI with RD-gadobenate (45 males; aged 54 ± 18 years). Two blinded neuroradiologists (R1, R2) judged contrast enhancement as sufficient, good, or optimal. Wilcoxon, Mann–Whitney, χ{sup 2}, and Cohen κ statistics were used. Results: At intraindividual analysis, median SNR ranged 57–88 for SSD-gadoterate and 79–99 for RD-gadobenate, the latter being systematically higher, the difference being significant for both transverse venous sinuses (p ≤ 0.011), not significant for both internal carotid arteries and both parotid glands, and enhancing lesions (p ≤ 0.101). The two series of interindividual analysis were not significantly different for gender/age (p > 0.415). Contrast enhancement was optimal in 59% (R1) and 76% (R2) of patients using RD-gadobenate, in 39% (R1) and 49% (R2) of patients using SSD-gadoterate (p ≤ 0.016), with substantial reproducibility (κ ≥ 0.606). Conclusion: Both analyses showed an equal or better contrast enhancement when using RD-gadobenate compared to SSD-gadoterate for routine cranial MRI. The high relaxivity of gadobenate allowed for a 25% dose reduction.

  9. Less is better? Intraindividual and interindividual comparison between 0.075 mmol/kg of gadobenate dimeglumine and 0.1 mmol/kg of gadoterate meglumine for cranial MRI

    International Nuclear Information System (INIS)

    Khouri Chalouhi, Katia; Papini, Giacomo D.E.; Bandirali, Michele; Sconfienza, Luca M.; Di Leo, Giovanni; Sardanelli, Francesco

    2014-01-01

    Purpose: To retrospectively compare a reduced dose (RD) (0.075 mmol/kg) of gadobenate dimeglumine (RD-gadobenate) with standard single dose (SSD) (0.1 mmol/kg) of gadoterate meglumine (SSD-gadoterate) for cranial MRI. Materials and methods: Thirty-one patients (12 males; aged 52 ± 16 years) underwent cranial MRI with SSD-gadoterate and repeated the examination with RD-gadobenate after a median interval of 10 months. Signal-to-noise ratio (SNR) was obtained on contrast-enhanced images for enhancing lesions (n = 10) as well as for right and left transverse venous sinuses, internal carotid arteries, and parotid glands. Moreover, a consecutive series of 100 cranial MRI with SSD-gadoterate (49 males; aged 51 ± 19 years) was compared with a consecutive series of 100 cranial MRI with RD-gadobenate (45 males; aged 54 ± 18 years). Two blinded neuroradiologists (R1, R2) judged contrast enhancement as sufficient, good, or optimal. Wilcoxon, Mann–Whitney, χ 2 , and Cohen κ statistics were used. Results: At intraindividual analysis, median SNR ranged 57–88 for SSD-gadoterate and 79–99 for RD-gadobenate, the latter being systematically higher, the difference being significant for both transverse venous sinuses (p ≤ 0.011), not significant for both internal carotid arteries and both parotid glands, and enhancing lesions (p ≤ 0.101). The two series of interindividual analysis were not significantly different for gender/age (p > 0.415). Contrast enhancement was optimal in 59% (R1) and 76% (R2) of patients using RD-gadobenate, in 39% (R1) and 49% (R2) of patients using SSD-gadoterate (p ≤ 0.016), with substantial reproducibility (κ ≥ 0.606). Conclusion: Both analyses showed an equal or better contrast enhancement when using RD-gadobenate compared to SSD-gadoterate for routine cranial MRI. The high relaxivity of gadobenate allowed for a 25% dose reduction

  10. Dissolution experiments of commercial PWR (52 MWd/kgU) and BWR (53 MWd/kgU) spent nuclear fuel cladded segments in bicarbonate water under oxidizing conditions. Experimental determination of matrix and instant release fraction

    Science.gov (United States)

    González-Robles, E.; Serrano-Purroy, D.; Sureda, R.; Casas, I.; de Pablo, J.

    2015-10-01

    The denominated instant release fraction (IRF) is considered in performance assessment (PA) exercises to govern the dose that could arise from the repository. A conservative definition of IRF comprises the total inventory of radionuclides located in the gap, fractures, and the grain boundaries and, if present, in the high burn-up structure (HBS). The values calculated from this theoretical approach correspond to an upper limit that likely does not correspond to what it will be expected to be instantaneously released in the real system. Trying to ascertain this IRF from an experimental point of view, static leaching experiments have been carried out with two commercial UO2 spent nuclear fuels (SNF): one from a pressurized water reactor (PWR), labelled PWR, with an average burn-up (BU) of 52 MWd/kgU and fission gas release (FGR) of 23.1%, and one from a boiling water reactor (BWR), labelled BWR, with an average BU of and 53 MWd/kgU and FGR of 3.9%. One sample of each SNF, consisting of fuel and cladding, has been leached in bicarbonate water during one year under oxidizing conditions at room temperature (25 ± 5)°C. The behaviour of the concentration measured in solution can be divided in two according to the release rate. All radionuclides presented an initial release rate that after some days levels down to a slower second one, which remains constant until the end of the experiment. Cumulative fraction of inventory in aqueous phase (FIAPc) values has been calculated. Results show faster release in the case of the PWR SNF. In both cases Np, Pu, Am, Cm, Y, Tc, La and Nd dissolve congruently with U, while dissolution of Zr, Ru and Rh is slower. Rb, Sr, Cs and Mo, dissolve faster than U. The IRF of Cs at 10 and 200 days has been calculated, being (3.10 ± 0.62) and (3.66 ± 0.73) for PWR fuel, and (0.35 ± 0.07) and (0.51 ± 0.10) for BWR fuel.

  11. Efeitos da temperatura ambiente sobre o desempenho de suínos dos 30 aos 60 kg Effects of environmental temprerature on performance of pigs from 30 to 60 kg live weight

    Directory of Open Access Journals (Sweden)

    Maria Cristina Manno

    2006-04-01

    Full Text Available Este estudo foi conduzido para avaliar o efeito da temperatura ambiente sobre o desempenho, a composição de carcaça e os parâmetros fisiológicos de suínos de 30 a 60 kg. Foram utilizados 36 machos castrados (Landrace x Large White, com peso inicial de 29,94 ± 0,49 kg, dispostos, durante 35 dias, em três tratamentos, com seis repetições e dois animais por unidade experimental. O delineamento experimental foi o inteiramente casualizado e os tratamentos consistiram em: T1 - ambiente de calor (32ºC e alimentação à vontade; T2 - ambiente termoneutro (22ºC e alimentação à vontade; T3 - ambiente termoneutro (22ºC e alimentação equivalente ao consumo à vontade dos animais submetidos ao ambiente de calor. A temperatura ambiente elevada provocou redução do consumo de ração, porém melhorou a conversão alimentar e a eficiência de utilização de lisina para ganho. A deposição de gordura foi menor nos tratamentos 1 e 3, porém, apenas os animais em conforto térmico com alimentação pareada apresentaram declínio na deposição de proteína. Os pesos de jejum e de carcaça dos animais em estresse por calor foram menores que os dos animais em conforto térmico com alimentação à vontade, porém superiores aos dos animais com alimentação pareada. Os tratamentos não influenciaram o rendimento de carcaça e os pesos relativos dos órgãos avaliados, com exceção do estômago, que foi menor no T3. Os parâmetros fisiológicos temperaturas de superfície e freqüência respiratória foram influenciados negativamente pela alta temperatura (T1, mas a temperatura retal não foi alterada pelos tratamentos. Na fase de crescimento, a alta temperatura mantém deposição de proteína na carcaça, mas interfere negativamente no desempenho dos suínos, de modo que seus efeitos não se limitam à redução do consumo de ração.This study was carried out to evaluate the effect of environmental temperature on performance, carcass

  12. Dynamic leaching studies of 48 MWd/kgU UO{sub 2} commercial spent nuclear fuel under oxic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Serrano-Purroy, D., E-mail: Daniel.serrano-purroy@ec.europa.eu [European Commission, Joint Research Centre, Institute for Transuranium Elements, Karlsruhe (Germany); Casas, I. [Department of Chemical Engineering, UPC, Barcelona (Spain); González-Robles, E. [Environmental Technology Department, Fundació CTM Centre Tecnològic, Manresa, Barcelona (Spain); Glatz, J.P.; Wegen, D.H. [European Commission, Joint Research Centre, Institute for Transuranium Elements, Karlsruhe (Germany); Clarens, F. [Environmental Technology Department, Fundació CTM Centre Tecnològic, Manresa, Barcelona (Spain); Giménez, J. [Department of Chemical Engineering, UPC, Barcelona (Spain); Pablo, J. de [Department of Chemical Engineering, UPC, Barcelona (Spain); Environmental Technology Department, Fundació CTM Centre Tecnològic, Manresa, Barcelona (Spain); Martínez-Esparza, A. [High Level Waste Department, ENRESA, Empresa Nacional de Residuos Radioactivos, Madrid (Spain)

    2013-03-15

    The leaching of a high-burn-up spent nuclear fuel (48 MWd/KgU) has been studied in a carbonate-containing solution and under oxic conditions using a Continuously Stirred Tank Flow-Through Reactor (CSTR). Two samples of the fuel, one prepared from the centre of the pellet (labelled CORE) and another one from the fuel pellet periphery, enriched with the so-called High Burn-Up Structure (HBS, labelled OUT) have been used. For uranium and actinides, the results showed that U, Np, Am and Cm gave very similar normalized dissolution rates, while Pu showed slower dissolution rates for both samples. In addition, dissolution rates were consistently two to four times lower for OUT sample compared to CORE sample. Considering the fission products release the main results are that Y, Tc, La and Nd dissolved very similar to uranium; while Cs, Sr, Mo and Rb have up to 10 times higher dissolution rates. Rh, Ru and Zr seemed to have lower dissolution rates than uranium. The lowest dissolution rates were found for OUT sample. Three different contributions were detected on uranium release, modelled and attributed to oxidation layer, fines and matrix release.

  13. Dynamic leaching studies of 48 MWd/kgU UO2 commercial spent nuclear fuel under oxic conditions

    Science.gov (United States)

    Serrano-Purroy, D.; Casas, I.; González-Robles, E.; Glatz, J. P.; Wegen, D. H.; Clarens, F.; Giménez, J.; de Pablo, J.; Martínez-Esparza, A.

    2013-03-01

    The leaching of a high-burn-up spent nuclear fuel (48 MWd/KgU) has been studied in a carbonate-containing solution and under oxic conditions using a Continuously Stirred Tank Flow-Through Reactor (CSTR). Two samples of the fuel, one prepared from the centre of the pellet (labelled CORE) and another one from the fuel pellet periphery, enriched with the so-called High Burn-Up Structure (HBS, labelled OUT) have been used.For uranium and actinides, the results showed that U, Np, Am and Cm gave very similar normalized dissolution rates, while Pu showed slower dissolution rates for both samples. In addition, dissolution rates were consistently two to four times lower for OUT sample compared to CORE sample.Considering the fission products release the main results are that Y, Tc, La and Nd dissolved very similar to uranium; while Cs, Sr, Mo and Rb have up to 10 times higher dissolution rates. Rh, Ru and Zr seemed to have lower dissolution rates than uranium. The lowest dissolution rates were found for OUT sample.Three different contributions were detected on uranium release, modelled and attributed to oxidation layer, fines and matrix release.

  14. Intraoperative use of a reflective blanket (Sirius rescue sheet) for temperature management in dogs less than 10 kg.

    Science.gov (United States)

    Tünsmeyer, J; Bojarski, I; Nolte, I; Kramer, S

    2009-07-01

    To compare the effects of the Sirius rescue sheet with gel pads versus gel pads alone on intraoperative body temperature in dogs less than 10 kg. Forty small breed dogs undergoing elective surgical procedures were randomly assigned to two groups. One group was intraoperatively laid on warmed gel pads, and the other group was additionally wrapped in a Sirius rescue sheet. Oesophageal body temperature was determined every 10 minutes and compared between groups. Temperature of gel pads was measured preoperatively and postoperatively to compare heat loss of the gel pads between groups. The body temperature of dogs wrapped with the Sirius rescue sheet increased intraoperatively. In dogs just lying on warmed gel pads, a decrease in mean body temperature was revealed and mean body temperatures differed between groups after 40 minutes. Extent of heat loss from the gel pads did not differ between the groups. The Sirius rescue sheet, used in addition to warmed gel pads, led to higher intraoperative body temperatures in small breed dogs undergoing surgical procedures to the extremities and the head. The cost-effectiveness and ease of handling make this a useful addition to clinical practice.

  15. Bloodless pediatric cardiopulmonary bypass for a 3.2-kg patient whose parents are of Jehovah's Witness faith.

    Science.gov (United States)

    Ratliff, Todd M; Hodge, Ashley B; Preston, Thomas J; Galantowicz, Mark; Naguib, Aymen; Gomez, Daniel

    2014-06-01

    Patients and parents of Jehovah's Witness (JW) faith present multiple challenges to a medical team, especially in the neonatal and pediatric population. The medical team must balance honoring the parents' request of not receiving blood products and fulfilling our commitment as advocates for the child's wellbeing. A multidisciplinary approach to cardiac surgery must be embraced for bloodless cardiopulmonary bypass (CPB) to be successful. At our institution, we have developed strategies and techniques for blood conservation that are used preoperatively, intraoperatively, and postoperatively for every CPB case with the goal of a bloodless procedure. These protocols include: preoperative erythropoietin, preoperative iron administration, selection of a CPB circuit specific to the patient's height and weight, acute normovolemic hemodilution, retrograde autologous prime and venous autologous prime, tranexamic acid administration, zero-balance ultrafiltration, flushing of the pump suckers post-CPB, modified ultrafiltration, and cell salvage. We present an 8-day-old, 3.2-kg patient of JW faith with aortic valve stenosis and regurgitation and a patent foramen ovale who underwent a bloodless left ventricle-to-aorta tunnel repair and aortic valve repair on CPB.

  16. Benchmarking of pluck lesions at slaughter as a health monitoring tool for pigs slaughtered at 170kg (heavy pigs).

    Science.gov (United States)

    Scollo, Annalisa; Gottardo, Flaviana; Contiero, Barbara; Mazzoni, Claudio; Leneveu, Philippe; Edwards, Sandra A

    2017-09-01

    Abattoir post-mortem inspections offer a useful tool for the development and monitoring of animal health plans and a source of data for epidemiological investigation. The aim of the present work was to develop an abattoir benchmarking system which provides feedback on the prevalence and severity of lesions of the pluck (lung, pleura and liver) in batches of pigs to inform individual producers and their veterinarians of the occurrence of pathological conditions affecting their herds. The weekly collection of data throughout a year (from September 2014 to September 2015) supported the further aim of providing benchmark values for the prevalence of lesions and their seasonality in Italian heavy pig production. Finally, correlations and redundancies among different lesions were evaluated. In total, 727 batches of heavy pigs (around 165kg live weight and 9 months of age) derived from 272 intensive commercial farms located in Northern Italy were monitored. Within each batch, an average number of 100 plucks was individually scored, assigning a value for lesions of lungs (0-24), pleura (0-4) and liver (1-3). Presence of lung scars, abscesses, consolidations, lobular/chessboard pattern lesions and pleural sequestra was also recorded. Statistical analysis showed a strong farm effect (36-68% of variation depending of the lesion) and a seasonal effect on all lesions. Winter showed the lowest percentage of severe lung and pleural lesions (Pbenchmarking of each farm in a determined health class, scores for each quartile of the population are reported. Whilst such a benchmarking scheme provides useful data for herd health management, challenges of repeatability of scoring and cost of implementation need to be overcome. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Transthoracic device closure of ventricular septal defects without cardiopulmonary bypass: experience in infants weighting less than 8 kg.

    Science.gov (United States)

    Xing, Quansheng; Wu, Qin; Pan, Silin; Ren, Yueyi; Wan, Hao

    2011-09-01

    Both surgical and percutaneous device closure of ventricular septal defect (VSD) have drawbacks and limitations in infants. We report our experiences and midterm results of transthoracic device closure of VSDs (TDCVs) without cardiopulmonary bypass (CPB) in infants. Between September 2007 and September 2009, 32 patients, with a mean age of 7.2 ± 4.7 months, body weight of 6.8 ± 2.8 kg, underwent this procedure. The procedure was performed in the operating room. A small subxiphoid incision was made. A purse-string suture was placed on the right ventricular free wall. The free wall was punctured using a trocar, then a guide wire was inserted and advanced to cross the VSD into the left ventricle under transesophageal echocardiographic guidance. A modified delivery sheath was then introduced over the guide wire. The device was delivered and deployed in position along the sheath to close the defect. A total of 30 cases (94%) were successfully closed, and the remaining two cases (6%) were converted to open heart repair. No patients received transfusion. There was no perioperative mortality, or any major complication. The mean size of the devices was 7.6 ± 3.4mm. The total operative time was less than 60 min, and the mean time for device implantation was 18.3 ± 9.4 min. All patients were extubated within 2h, and were discharged within 5 days after operation. The follow-up period ranged from 6 to 31 months (18.3 ± 9.6 months). There was no late major complication detected. Minimally invasive TDCV without CPB is a safe and effective alternative to the conventional operation in low-body-weight infants. Copyright © 2010 European Association for Cardio-Thoracic Surgery. Published by Elsevier B.V. All rights reserved.

  18. Production, purification and characterization of fibrinolytic enzyme from Serratia sp. KG-2-1 using optimized media.

    Science.gov (United States)

    Taneja, Kapila; Bajaj, Bijender Kumar; Kumar, Sandeep; Dilbaghi, Neeraj

    2017-07-01

    Intravascular thrombosis is one of the major causes of variety of cardiovascular disorders leading to high mortality worldwide. Fibrinolytic enzymes from microbial sources possess ability to dissolve these clots and help to circumvent these problems in more efficient and safer way. In the present study, fibrinolytic protease with higher fibrinolytic activity than plasmin was obtained from Serratia sp. KG-2-1 isolated from garbage dump soil. Response surface methodology was used to study the interactive effect of concentration of maltose, yeast extract + peptone (1:1), incubation time, and pH on enzyme production and biomass. Maximum enzyme production was achieved at 33 °C after 24 h at neutral pH in media containing 1.5% Maltose, 4.0% yeast extract + peptone and other trace elements resulting in 1.82 folds increased production. The enzyme was purified from crude extract using ammonium sulfate precipitation and DEAE-Sephadex chromatography resulting in 12.9 fold purification with 14.9% yield. The purified enzyme belongs to metalloprotease class and had optimal activity in conditions similar to physiological environment with temperature optima of 40 °C and pH optima of 8. The enzyme was found to be stable in various solvents and its activity was enhanced in presence of Na + , K + , Ba 2+ , Cu 2+ , Mn 2+ , Hg 2+ but inhibited by Ca 2+ and Fe 3+ . Hence, the obtained enzyme may be used as potential therapeutic agent in combating various thrombolytic disorders.

  19. Rapid intravenous infusion of 20 mL/kg saline alters the distribution of perfusion in healthy supine humans.

    Science.gov (United States)

    Henderson, A C; Sá, R C; Barash, I A; Holverda, S; Buxton, R B; Hopkins, S R; Prisk, G K

    2012-03-15

    Rapid intravenous saline infusion, a model meant to replicate the initial changes leading to pulmonary interstitial edema, increases pulmonary arterial pressure in humans. We hypothesized that this would alter lung perfusion distribution. Six healthy subjects (29 ± 6 years) underwent magnetic resonance imaging to quantify perfusion using arterial spin labeling. Regional proton density was measured using a fast-gradient echo sequence, allowing blood delivered to the slice to be normalized for density and quantified in mL/min/g. Contributions from flow in large conduit vessels were minimized using a flow cutoff value (blood delivered > 35% maximum in mL/min/cm(3)) in order to obtain an estimate of blood delivered to the capillary bed (perfusion). Images were acquired supine at baseline, after infusion of 20 mL/kg saline, and after a short upright recovery period for a single sagittal slice in the right lung during breath-holds at functional residual capacity. Thoracic fluid content measured by impedance cardiography was elevated post-infusion by up to 13% (pchanges in conduit vessels, there were no significant changes in perfusion in dependent lung following infusion (7.8 ± 1.9 mL/min/g baseline, 7.9 ± 2.0 post, 8.5 ± 2.1 recovery, p=0.36). There were no significant changes in lung density. These data suggest that saline infusion increased perfusion to nondependent lung, consistent with an increase in intravascular pressures. Dependent lung may have been "protected" from increases in perfusion following infusion due to gravitational compression of the pulmonary vasculature. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Design and Performance Test of Axial Halbach Brushless DC Motor with Power Density 1.5 Kw/Kg

    Directory of Open Access Journals (Sweden)

    Kevin Dwi Prasetio

    2017-01-01

    . This final task generates Axial Halbach Brushless DC Motor with construction of one rotor and a stator. Axial DC Brushless Halbach Motor consists of 10 pole halbach magnet system permanent and 30 slot on the stator. On the performance test of Axial Halbach Brushless DCMotor it obtained efficiency of 92.72%, power output of 807.34 Watts, torque of 2.24 Nm, moment rpm 3451. As well as the power density of 0.588 kW/kg at 50% throttle openings

  1. 49 CFR 173.477 - Approval of packagings containing greater than 0.1 kg of non-fissile or fissile-excepted uranium...

    Science.gov (United States)

    2010-10-01

    ... kg of non-fissile or fissile-excepted uranium hexafluoride. 173.477 Section 173.477 Transportation... non-fissile or fissile-excepted uranium hexafluoride. (a) Each offeror of a package containing more than 0.1 kg of uranium hexafluoride must maintain on file for at least one year after the latest...

  2. Efficacy, safety and pharmacokinetics of sugammadex 4 mg kg-1 for reversal of deep neuromuscular blockade in patients with severe renal impairment

    NARCIS (Netherlands)

    Panhuizen, I. F.; Gold, S. J. A.; Buerkle, C.; Snoeck, M. M. J.; Harper, N. J. N.; Kaspers, M. J. G. H.; van den Heuvel, M. W.; Hollmann, M. W.

    2015-01-01

    This study evaluated efficacy and safety of sugammadex 4 mg kg(-1) for deep neuromuscular blockade (NMB) reversal in patients with severe renal impairment (creatinine clearance [CLCR] <30 ml min(-1)) vs those with normal renal function (CLCR ≥80 ml min(-1)). Sugammadex 4 mg kg(-1) was administered

  3. Hypertension and diabetes prevalence among adults with moderately increased BMI (23·0-24·9 kg/m2): findings from a nationwide survey in Bangladesh.

    Science.gov (United States)

    Rahman, Muntasirur; Williams, Gail; Mamun, Abdullah Al

    2017-06-01

    BMI is a proxy for fat accumulation in the body. Increased diabetes and CVD risks have been observed for Asian populations at lower BMI than the WHO-recommended BMI cut-off points for overweight (≥25·0 kg/m2) and obesity (≥30·0 kg/m2). The current study aimed to quantify the increased hypertension (HTN) and type 2 diabetes mellitus (T2DM) prevalence in Bangladeshi adults with moderately increased BMI (23·0-24·9 kg/m2). Data from the most recent Bangladesh Demographic and Health Survey (2011) were analysed. Modified Poisson regression models with robust error variance were used to calculate prevalence ratios (PR) for HTN or T2DM by BMI category, considering BMI=18·5-22·9 kg/m2 as the reference. All analyses incorporated the complex sampling design of the survey. BMI, blood pressure, blood sugar and related information were collected from a nationally representative sample. Adults (n 7433) aged≥35 years. About 12 % of Bangladeshi adults, both male and female, were within the BMI range 23·0-24·9 kg/m2 or moderately overweight. Compared with the reference BMI group (18·5-22·9 kg/m2), they had an increased PR for HTN (1·55-1·77) and T2DM (1·54-1·93). These increased PR are similar to those for the WHO-defined overweight group (BMI=25·0-29·9 kg/m2). Our findings support the recommendation that calls for setting the optimum BMI for Asian populations to 18·5-23·0 kg/m2 for health promotion and for public health interventions like leisure-time physical activity. WHO cut-off points for overweight (≥25 kg/m2) should be used to facilitate international comparisons.

  4. BMI > or = 50 kg/m2 is associated with a younger age of onset of overweight and a high prevalence of adverse metabolic profiles.

    LENUS (Irish Health Repository)

    O'Connell, Jean

    2010-07-01

    To study the demographic and clinical parameters of three different categories of obesity, with particular focus on a cohort of individuals with BMI > or = 50 kg\\/m2, the fastest growing category of obesity.

  5. Effects of ginseol k-g3, an Rg3-enriched fraction, on scopolamine-induced memory impairment and learning deficit in mice

    Directory of Open Access Journals (Sweden)

    Ike dela Peña

    2014-01-01

    Conclusion: The effects of ginseol k-g3 in ameliorating scopolamine-induced memory impairment in the passive avoidance and Morris water maze tests indicate its specific influence on reference or long-term memory. The mechanism underlying the reversal of scopolamine-induced amnesia by ginseol k-g3 is not yet known, but is not related to anticholinesterase-like activity.

  6. Emanation of radon-222 in uraniferous phosphorite from Pernambuco, Brazil; Emanação de radônio-222 em fosforito uranífero de Pernambuco

    Energy Technology Data Exchange (ETDEWEB)

    Santos, M.L.O.; França, E.J.; Amaral, D.S.; Silva, K.E.M.; Hazin, C.A.; Farias, E.E.G., E-mail: emersonemiliano@yahoo.com.br [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)

    2017-07-01

    The concentration of radon-222 activity available for transport to the surface through the pore space can be defined as radon emanation. From the decay of radium-226, whose half-life is 1850 years, it is associated with the development of neoplasia, such as lung cancer. In the Metropolitan Region of Recife, sedimentary rocks known as phosphorites have been known since 1959, so, from the radiometric characterization of the Paulista and Igarassu Municipality, in Pernambuco, emanation tests were carried out, aiming to determine the emanation power of radon in samples of uraniferous phosphorite from the Recife Metropolitan Region. Initially, 6 independent samples of phosphorites with activity concentration of {sup 226}Ra> 400 Bq kg{sup -1} were comminuted. Portions of 5g were conditioned in a radon chamber with 500 mL volume for measurements. The linear fit of the model converged after 200 interactions with selection of the best fit by the Chi-Square test, through the Origin® 8.0 program. After analysis of the samples, radon emanation power was estimated in the range of 7% to 15%, with a mean value of 10.8%. The methodology used to determine the emanation parameters in samples of uraniferous phosphorite was adequate, observing an inversely proportional relation between the concentration of the radium-226 and the emanation power.

  7. Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells

    International Nuclear Information System (INIS)

    Fuchs, Dominik; Daniel, Volker; Sadeghi, Mahmoud; Opelz, Gerhard; Naujokat, Cord

    2010-01-01

    Leukemia stem cells are known to exhibit multidrug resistance by expression of ATP-binding cassette (ABC) transporters which constitute transmembrane proteins capable of exporting a wide variety of chemotherapeutic drugs from the cytosol. We show here that human promyeloblastic leukemia KG-1a cells exposed to the histone deacetylase inhibitor phenylbutyrate resemble many characteristics of leukemia stem cells, including expression of functional ABC transporters such as P-glycoprotein, BCRP and MRP8. Consequently, KG-1a cells display resistance to the induction of apoptosis by various chemotherapeutic drugs. Resistance to apoptosis induction by chemotherapeutic drugs can be reversed by cyclosporine A, which effectively inhibits the activity of P-glycoprotein and BCRP, thus demonstrating ABC transporter-mediated drug resistance in KG-1a cells. However, KG-1a are highly sensitive to apoptosis induction by salinomycin, a polyether ionophore antibiotic that has recently been shown to kill human breast cancer stem cell-like cells and to induce apoptosis in human cancer cells displaying multiple mechanisms of drug and apoptosis resistance. Whereas KG-1a cells can be adapted to proliferate in the presence of apoptosis-inducing concentrations of bortezomib and doxorubicin, salinomycin does not permit long-term adaptation of the cells to apoptosis-inducing concentrations. Thus, salinomycin should be regarded as a novel and effective agent for the elimination of leukemia stem cells and other tumor cells exhibiting ABC transporter-mediated multidrug resistance.

  8. Addendum 1 to CSER 96-025: PFP storage of 9.25/9.5 inch tall, 4.4 kg Pu cans on existing Vault 4 pedestals

    International Nuclear Information System (INIS)

    Hillesland, K.E.

    1997-01-01

    A nuclear criticality safety analysis has been performed to increase the approved plutonium mass limit for cans stored in Vault number-sign 4 cubicles at PFP. The original CSER 96-025 accommodated the storage of 4.4 kg of plutonium in PuO, (5.0 kg PuO,) in Vault number-sign 4 by requiring that half the cubicles be left vacant. This addendum allows for all the cubicles to be used, but with a fissile plutonium mass limit of 58 kg per cubicle. A mass limit for each cubical allows for storage of a larger number of cans if some have less than the 4.4 kg Pu limit per can. The highest k., calculated is 0.932 + 0.003 when an overbatched can is present in every fourth cubicle. This is below the criticality safety limit of kff 0.935, and consequently, an increase of plutonium mass to 4.4 kg per can is within acceptable safety limits for the given mass limit

  9. Continuous Czochralski growth. Development of advanced Czochralski growth process to produce low cost 150 kg silicon ingots from a single crucible for technology readiness

    Science.gov (United States)

    The improvement of growth rates using radiation shielding and investigation of the crucible melt interaction for improved yields were emphasized. Growth runs were performed from both 15 and 16 inch diameter crucibles, producing 30 and 37 kg ingots respectively. Efforts to increase the growth rate of 150 mm diameter ingots were limited by temperature instabilities believed to be caused by undesirable thermal convections in the larger melts. The radiation shield improved the growth rate somewhat, but the thermal instability was still evident, leading to nonround ingots and loss of dislocation-free structure. A 38 kg crystal was grown to demonstrate the feasibility of producing 150 kg with four growth cycles. After the grower construction phase, the Hamco microprocessor control system was interfaced to the growth facility, including the sensor for automatic control of seeding temperature, and the sensor for automatic shouldering. Efforts focused upon optimization of the seeding, necking, and shoulder growth automation programs.

  10. CD and MCD of CytC3 and taurine dioxygenase: role of the facial triad in alpha-KG-dependent oxygenases.

    Science.gov (United States)

    Neidig, Michael L; Brown, Christina D; Light, Kenneth M; Fujimori, Danica Galonić; Nolan, Elizabeth M; Price, John C; Barr, Eric W; Bollinger, J Martin; Krebs, Carsten; Walsh, Christopher T; Solomon, Edward I

    2007-11-21

    The alpha-ketoglutarate (alpha-KG)-dependent oxygenases are a large and diverse class of mononuclear non-heme iron enzymes that require FeII, alpha-KG, and dioxygen for catalysis with the alpha-KG cosubstrate supplying the additional reducing equivalents for oxygen activation. While these systems exhibit a diverse array of reactivities (i.e., hydroxylation, desaturation, ring closure, etc.), they all share a common structural motif at the FeII active site, termed the 2-His-1-carboxylate facial triad. Recently, a new subclass of alpha-KG-dependent oxygenases has been identified that exhibits novel reactivity, the oxidative halogenation of unactivated carbon centers. These enzymes are also structurally unique in that they do not contain the standard facial triad, as a Cl- ligand is coordinated in place of the carboxylate. An FeII methodology involving CD, MCD, and VTVH MCD spectroscopies was applied to CytC3 to elucidate the active-site structural effects of this perturbation of the coordination sphere. A significant decrease in the affinity of FeII for apo-CytC3 was observed, supporting the necessity of the facial triad for iron coordination to form the resting site. In addition, interesting differences observed in the FeII/alpha-KG complex relative to the cognate complex in other alpha-KG-dependent oxygenases indicate the presence of a distorted 6C site with a weak water ligand. Combined with parallel studies of taurine dioxygenase and past studies of clavaminate synthase, these results define a role of the carboxylate ligand of the facial triad in stabilizing water coordination via a H-bonding interaction between the noncoordinating oxygen of the carboxylate and the coordinated water. These studies provide initial insight into the active-site features that favor chlorination by CytC3 over the hydroxylation reactions occurring in related enzymes.

  11. Exploring the efficacy of an acceptance, mindfulness & compassionate-based group intervention for women struggling with their weight (Kg-Free): A randomized controlled trial.

    Science.gov (United States)

    Palmeira, Lara; Pinto-Gouveia, José; Cunha, Marina

    2017-05-01

    This randomized-controlled trial aims to test the efficacy of a group intervention (Kg-Free) for women with overweight or obesity based on mindfulness, ACT and compassion approaches. The intervention aimed to reduce weight self-stigma and unhealthy eating patterns and increase quality-of-life (QoL). Seventy-three women, aged between 18 and 55 years old, with BMI ≥25 without binge-eating seeking weight loss treatment were randomly assigned to intervention or control groups. Kg-Free comprises 10 weekly group sessions plus 2 booster fortnightly sessions, of 2h30 h each. The control group maintained Treatment as Usual (TAU). Data was collected at baseline and at the end of the Kg-Free intervention. Overall, participants enrolled in Kg-Free found the intervention to be very important and helpful when dealing with their weight-related unwanted internal experiences. Moreover, when compared with TAU, the Kg-Free group revealed a significant increased health-related QoL and physical exercise and a reduction of weight self-stigma, unhealthy eating behaviors, BMI, self-criticism, weight-related experiential avoidance and psychopathological symptoms at post-treatment. Results for self-compassion showed a trend towards significance, whereas no significant between-groups differences were found for mindfulness. Taken together, evidence was found for Kg-Free efficacy in reducing weight-related negative experiences and promoting healthy behaviors, psychological functioning, and QoL. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. A measurement of the density and compressibility of (U, Pu)-mixed oxide at 3432 kJ/kg (7356 K)

    International Nuclear Information System (INIS)

    Breitung, W.

    1987-05-01

    In a transient in-pile heating test the density of liquid (U, Pu)-mixed oxide at 3432±103 kJ/kg was measured to be 5027±132 kg/m 3 . The corresponding temperature is estimated to 7356±212 K. The isothermal compressibility of the mixed oxide was evaluated to 2.85 (±1.65) x 10 -4 /MPa at the same temperature. Based on these new data and previously existing measurements, new relations are proposed for the following properties of liquid UO 2 and (U, Pu)O 2 , as well: density - enthalpy, density - temperature, thermal expansion - temperature, and isothermal compressibility - temperature. (orig.) [de

  13. NÃveis de isoleucina digestÃvel para suÃnos machos castrados dos 15 aos 30 kg

    OpenAIRE

    Doglas Batista Lazzeri

    2011-01-01

    Com o objetivo de determinar a exigÃncia de isoleucina digestÃvel para suÃnos machos castrados dos 15 aos 30 kg de peso vivo, foram realizados dois experimentos, um de digestibilidade e outro de desempenho. Para determinar o coeficiente de digestibilidade ileal dos aminoÃcidos da raÃÃo basal, foram utilizados 10 suÃnos, machos castrados, mestiÃos, com peso mÃdio inicial de 15,00Â0,27 kg, alojados individualmente em gaiolas de metabolismo, em um delineamento inteiramente ao acaso, com dois tra...

  14. 75 FR 61343 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG (RRD) Models Tay 620-15, Tay 650-15...

    Science.gov (United States)

    2010-10-05

    ... adopting the AD as proposed. Costs of Compliance Based on the service information, we estimate that this AD... cost about $100,000 per product. Based on these figures, we estimate the cost of the AD on U.S... Rolls-Royce Deutschland Ltd & Co KG (Formerly Rolls-Royce plc): Amendment 39-16457. Docket No. FAA-2010...

  15. Data report of a pretest analysis of soil-structure interaction and structural response in low-amplitude explosive testing (50 KG) of the heissdampfreaktor (HDR)

    International Nuclear Information System (INIS)

    Vaughan, D.K.; Sandler, I.; Rubin, D.; Isenberg, J.; Nikooyeh, H.

    1979-01-01

    This report describes a three-dimensional nonlinear TRANAL finite element analysis of a nuclear reactor subjected to ground shaking from a buried 50 kg explosive source. The analysis is a pretest simulation of a test event which was scheduled to be conducted in West Germany on 3 November 1979

  16. State of fuel rods spent in the VVER-1000 reactor up to a fuel burnup of 75 MW·Day/KgU

    International Nuclear Information System (INIS)

    Markov, D.; Zvir, E.; Polenok, V.; Zhitelev, V.; Strozhuk, A.; Volkova, I.

    2011-01-01

    The presented material contains the data on change in form, corrosion state and mechanical properties of fuel rod claddings, change in fuel structure and release of gaseous fission products (GFP) under the cladding. The results of PIEs of the VVER-1000 fuel rods with the high burnup of fuel (average value is 72.3 MW·day/kgU and maximum is 75 MW·day/kgU) carried out in JSC 'SSC RIAR' show that by the basic operational characteristics the lifetime of fuel rods with such burnup of fuel is not exhausted. The state of fuel rods is characterized by following key parameters. The fuel-to-cladding gap on the most part of the fuel meat is absent. With the burnup growth, diameter of the fuel rod increases due to fuel meat swelling. In so doing, the reverse strain achieves the values of 0.40-0.47 %. Ridges on the cladding are formed practically along the entire length of the fuel meat, average height of ridges makes up 25 μm, maximum - 40 μm. At burnups exceeding 55 MW·day/kgU, the rate of the fuel rod elongation is less than at low and average burnups. So if within a burnup range of 20-55 MW·day/kgU, the rate of the fuel rod elongation makes up about 0.330mm per 1 MW·day/kgU, at burnups exceeding 55 MW·day/kgU it is only 0.085mm per 1 MW·day/kgU. Corrosion state of the claddings of fuel rods with high burnup of fuel is satisfactory. The oxide film, as a rule, is uniform, dense, without cracks and exfoliation, its thickness on the external surface does not exceed 13 μm, while on the internal surface - 15 μm. Hydrogenation is insignificant, mass fraction of hydrogen does not exceed 0.01 %. Interaction of fuel rods with spacer grids does not result in significant fretting-corrosion. Based of the results of tests, short-term mechanical properties of the claddings of fuel rods with high burnup of fuel remain at high level. The state of fuel is characterized by absence of the fuel-to-cladding gap on the most part of the fuel meat, fuel is tightly fixed to the cladding

  17. Transcatheter closure of patent ductus arteriosus in children weighing 10 kg or less: Initial experience at Sohag University Hospital.

    Science.gov (United States)

    Ali, Safaa; El Sisi, Amel

    2016-04-01

    To assess the challenges, feasibility, and efficacy of device closure of patent ductus arteriosus (PDA) in small children weighing ⩽10 kg for different types of devices used in an initial experience at Sohag University hospital. Between March 2011 and September 2014, 91 patients with PDA underwent transcatheter closure in our institute, among whom 54 weighed ⩽10 kg. All of these patients underwent transcatheter closure of PDA using either a Cook Detachable Coil, PFM Nit-Occlud, or Amplatzer duct occluder. A retrospective review of the treatment results and adverse events was performed. Successful device placement was achieved in 53/54 small children (98.1%). The median minimum PDA diameter was 2.4 mm [interquartile range (IQR, 1.8-3.5 mm), median weight 8 kg (IQR, 7-10 kg), and median age 10 months (IQR, 8-17 months)]. Mild aortic obstruction occurred in one case (1.9%), as the device became displaced towards the aorta after release. The device embolized in one case (1.9%) and no retrieval attempt was made. Five cases (9.3%) had minor vascular complications. With the current availability of devices for PDA closure, transcatheter closure of PDA is considered safe and efficacious in small children weighing ⩽10 kg with good mid-term outcome. The procedure had a low rate of high-severity adverse events even with the initial experience of the catheterization laboratory.

  18. The feasibility phase of a community antenatal lifestyle programme [The Lifestyle Course (TLC)] for women with a body mass index (BMI)≥ 30 kg/m(2.).

    Science.gov (United States)

    Smith, Debbie M; Taylor, Wendy; Whitworth, Melissa K; Roberts, Stephen; Sibley, Colin; Lavender, Tina

    2015-02-01

    maternal obesity [body mass index (BMI)≥30kg/m(2)] is a cause for concern because of increasing rates and risk of associated complications. However, little is known about how to improve the health of women with a BMI≥30kg/m(2). a 10-week antenatal lifestyle programme (The Lifestyle Course - TLC), underpinned by behaviour change theory, was developed in a programme of research which included a prospective, multicentred, feasibility phase (n=227). Participants had a BMI≥30kg/m(2) at the start of their pregnancy, planned to deliver in two areas of Greater Manchester and were aged 18 or over. The objectives were to (1) assess the feasibility of the intervention and (2) to pilot the trial processes and outcome measures. (1) Trial intervention: only 22% of women in the feasibility phase had received gestational weight advice prior to the study. One or more TLC sessions were attended by 79% of women and 97% said they would recommend TLC to a friend due to the content suitability, perceived personal gains and extra care received. Changes to the TLC were suggested and implemented in the pilot phase. (2) Trial processes: recruitment rates (36%), retention rates (100%) and questionnaire completion rates up to one year (33%) were found. Daily general 'lifestyle' diaries and pedometers were not acceptable data collection tools (response rates of 32% and 16% respectively). However, specific food diaries were acceptable (response rates of 80-81%). The major challenge was the collection of maternal weight data at the follow-up points. the antenatal intervention (TLC) designed for this programme of work appears to suit the needs of women with a BMI≥30kg/m(2). The need for an antenatal intervention is clear from this study and also highlights reflections on effective communication with pregnant women with a BMI≥30kg/m(2). Lessons learnt for designing a future trial include effective ways to communicate with pregnant women with a BMI≥30kg/m(2). ISRCTN29860479. Copyright

  19. NÃveis de isoleucina digestÃvel sobre o desempenho de fÃmeas suÃnas dos 15 aos 30 kg

    OpenAIRE

    Leandro Dalcin Castilha

    2011-01-01

    Com o objetivo de determinar a exigÃncia de isoleucina digestÃvel para fÃmeas suÃnas dos 15 aos 30 kg, foram realizados dois experimentos, um ensaio de desempenho e um balanÃo do nitrogÃnio. No primeiro experimento, foram utilizadas 40 fÃmeas suÃnas, mestiÃas, de alto potencial genÃtico e desempenho mÃdio, com peso vivo inicial de 15,00 Â 0,52kg, distribuÃdas em um delineamento experimental de blocos ao acaso, constituÃdo de cinco tratamentos (0,45; 0,52; 0,59; 0,66; 0,73% de isoleucina diges...

  20. Thermal design of a pressure electroslag remelting furnace applied for 5; Diseno termico de un horno presurizado de refusion por electroescoria de 5 Kg

    Energy Technology Data Exchange (ETDEWEB)

    Cruz M, J P

    1999-07-01

    Actual work defines the thermal design methodology for pressure electroslag remelting furnaces (P ESR) of variable capacity, applied for 5 Kg. It begins with classification and description of secondary refining furnaces, after PESR process and the concept of thermal design are described. Next, in base of the steel weight to remelt (5 Kg); ingot, crucible and electrode dimensions are obtained. These elements will be inside of pressure vessel whose thickness are determined according to ASMECode (Section 8, Division 1, U G-27). It was developed a computer program, where the furnace capacity can be modified, so like other conditions, and display principal dimensions of the furnace. Current and voltage are obtained from the heat necessary to remelt the ingot and the heat transfer in the crucible, is analysed because of it is the most critical element. It was selected too the equipment to registry temperatures and pressure in base of thermocouple characteristics. (Author)

  1. Design and performance of a 100-kg/h, direct calcine-fed electric-melter system for nuclear-waste vitrification

    International Nuclear Information System (INIS)

    Dierks, R.D.

    1980-11-01

    This report describes the physical characteristics of a ceramic-lined, joule-heated glass melter that is directly connected to the discharge of a spray calciner and is currently being used to study the vitrification of simulated nuclear-waste slurries. Melter performance characteristics and subsequent design improvements are described. The melter contains 0.24 m 3 of glass with a glass surface area of 0.76 m 2 , and is heated by the flow of an alternating current (ranging from 600 to 1200 amps) between two Inconel-690 slab-type electrodes immersed in the glass at either end of the melter tank. The melter was maintained at operating temperature (900 to 1260 0 C) for 15 months, and produced 62,000 kg of glass. The maximum sustained operating period was 122 h, during which glass was produced at the rate of 70 kg/h

  2. Effect of Age on Energy Requirement for Maintenance and Growth of Dorper and Hu Crossbred F1 Ewes Weighing 20 to 50 kg

    Science.gov (United States)

    Nie, H. T.; Wan, Y. J.; You, J. H.; Wang, Z. Y.; Lan, S.; Fan, Y. X.; Wang, F.

    2015-01-01

    This research aimed to define the energy requirement of Dorper and Hu Hybrid F1 ewes 20 to 50 kg of body weight, furthermore to study energy requirement changes with age and evaluate the effect of age on energy requirement parameters. In comparative slaughter trial, thirty animals were divided into three dry matter intake treatments (ad libitum, n = 18; low restricted, n = 6; high restricted, n = 6), and were all slaughtered as baseline, intermediate, and final slaughter groups, to calculate body chemical components and energy retained. In digestibility trial, twelve ewes were housed in individual metabolic cages and randomly assigned to three feeding treatments in accordance with the design of a comparative slaughter trial, to evaluate dietary energetic values at different feed intake levels. The combined data indicated that, with increasing age, the net energy requirement for maintenance (NEm) decreased from 260.62±13.21 to 250.61±11.79 kJ/kg0.75 of shrunk body weight (SBW)/d, and metabolizable energy requirement for maintenance (MEm) decreased from 401.99±20.31 to 371.23±17.47 kJ/kg0.75 of SBW/d. Partial efficiency of ME utilization for maintenance (km, 0.65 vs 0.68) and growth (kg, 0.42 vs 0.41) did not differ (p>0.05) due to age; At the similar condition of average daily gain, net energy requirements for growth (NEg) and metabolizable energy requirements for growth (MEg) for ewes during late fattening period were 23% and 25% greater than corresponding values of ewes during early fattening period. In conclusion, the effect of age upon energy requirement parameters in the present study were similar in tendency with previous recommendations, values of energy requirement for growth (NEg and MEg) for Dorper and Hu crossbred female lambs ranged between the NRC (2007) recommendation for early and later maturating growing sheep. PMID:26104522

  3. Laparoscopic Sleeve Gastrectomy for Mildly Obese Patients (Body Mass Index of 30 <35 kg/m2: Operative Outcome and Short-Term Results

    Directory of Open Access Journals (Sweden)

    Roger Noun

    2012-01-01

    Full Text Available Background. Data concerning laparoscopic sleeve gastrectomy (LSG in mild obesity are under investigation. Aim/Objective. May 2010 to May 2012, 122 consecutive patients with preoperative body mass index (BMI of 33±2.5 kg/m2 (range 30–34.9 undergoing LSG were studied. Mean age was 33±10 years (range 15–60, and 105 (86% were women. Mean preoperative weight was 91±9.7 kg (range 66–121, and preoperative excess weight was 30±6.7 kg (range 19–43. Comorbidities were detected in 44 (36% patients. Results. Mean operative time was 58±15 min (range 40–95, and postoperative stay was 1.8±0.19 days (range 1.5–3. There were no admissions to intensive care unit and no deaths within 30 days of surgery. The rates of leaks and strictures were 0%, and of hemorrhage 1.6%. At 12 months, BMI decreased to 24.7±2, and the percentage of excess weight loss (% EWL reached 76.5%. None of the patients had a BMI below 20 kg/m2. Comorbidities resolved in 70.5% or improved in 29.5%. Patient satisfaction scoring (1–5 at least 1 year after was 4.6±0.8 for body image and 4.4±0.6 for food tolerance. Conclusion. LSG for mildly obese patients has proved to be technically relatively easy, safe, and benefic in the short term.

  4. Efficacy, safety and pharmacokinetics of sugammadex 4 mg kg-1 for reversal of deep neuromuscular blockade in patients with severe renal impairment.

    Science.gov (United States)

    Panhuizen, I F; Gold, S J A; Buerkle, C; Snoeck, M M J; Harper, N J N; Kaspers, M J G H; van den Heuvel, M W; Hollmann, M W

    2015-05-01

    This study evaluated efficacy and safety of sugammadex 4 mg kg(-1) for deep neuromuscular blockade (NMB) reversal in patients with severe renal impairment (creatinine clearance [CLCR] Sugammadex 4 mg kg(-1) was administered at 1-2 post-tetanic counts for reversal of rocuronium NMB. Primary efficacy variable was time from sugammadex to recovery to train-of-four (T4/T1) ratio 0.9. Equivalence between groups was demonstrated if two-sided 95% CI for difference in recovery times was within -1 to +1 min interval. Pharmacokinetics of rocuronium and overall safety were assessed. The intent-to-treat group comprised 67 patients (renal n=35; control n=32). Median (95% CI) time from sugammadex to recovery to T4/T1 ratio 0.9 was 3.1 (2.4-4.6) and 1.9 (1.6-2.8) min for renal patients vs controls. Estimated median (95% CI) difference between groups was 1.3 (0.6-2.4) min; thus equivalence bounds were not met. One control patient experienced acceleromyography-determined NMB recurrence, possibly as a result of premature sugammadex (4 mg kg(-1)) administration, with no clinical evidence of NMB recurrence observed. Rocuronium, encapsulated by Sugammadex, was detectable in plasma at day 7 in 6 patients. Bioanalytical data for sugammadex were collected but could not be used for pharmacokinetics. Sugammadex 4 mg kg(-1) provided rapid reversal of deep rocuronium-induced NMB in renal and control patients. However, considering the prolonged sugammadex-rocuronium complex exposure in patients with severe renal impairment, current safety experience is insufficient to support recommended use of sugammadex in this population. NCT00702715. © The Author 2015. Published by Oxford University Press on behalf of the British Journal of Anaesthesia. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. The association between psychological factors and breastfeeding behaviour in women with a body mass index (BMI) ≥30 kg m-2 : a systematic review.

    Science.gov (United States)

    Lyons, S; Currie, S; Peters, S; Lavender, T; Smith, D M

    2018-03-24

    Breastfeeding can play a key role in the reduction of obesity, but initiation and maintenance rates in women with a body mass index (BMI) of ≥30 kg m -2 are low. Psychological factors influence breastfeeding behaviours in the general population, but their role is not yet understood in women with a BMI ≥30 kg m -2 . Therefore, this review aimed to systematically search and synthesize the literature, which has investigated the association between any psychological factor and breastfeeding behaviour in women with a BMI ≥30 kg m -2 . The search identified 20 eligible papers, reporting 16 psychological factors. Five psychological factors were associated with breastfeeding behaviours: intentions to breastfeed, belief in breast milk's nutritional adequacy and sufficiency, belief about other's infant feeding preferences, body image and social knowledge. It is therefore recommended that current care should encourage women to plan to breastfeed, provide corrective information for particular beliefs and address their body image and social knowledge. Recommendations for future research include further exploration of several psychological factors (i.e. expecting that breastfeeding will enhance weight loss, depression, anxiety and stress) and evidence and theory-based intervention development. © 2018 The Authors. Obesity Reviews published by John Wiley & Sons Ltd on behalf of World Obesity Federation.

  6. Development of advanced Czochralski growth process to produce low cost 150 kg silicon ingots from a single crucible for technology readiness

    Science.gov (United States)

    1981-06-01

    The process development continued, with a total of nine crystal growth runs. One of these was a 150 kg run of 5 crystals of approximately 30 kg each. Several machine and process problems were corrected and the 150 kg run was as successful as previous long runs on CG2000 RC's. The accelerated recharge and growth will be attempted when the development program resumes at full capacity in FY '82. The automation controls (Automatic Grower Light Computer System) were integrated to the seed dip temperature, shoulder, and diameter sensors on the CG2000 RC development grower. Test growths included four crystals, which were grown by the computer/sensor system from seed dip through tail off. This system will be integrated on the Mod CG2000 grower during the next quarter. The analytical task included the completion and preliminary testing of the gas chromatograph portion of the Furnace Atmosphere Analysis System. The system can detect CO concentrations and will be expanded to oxygen and water analysis in FY '82.

  7. Development of advanced Czochralski Growth Process to produce low cost 150 KG silicon ingots from a single crucible for technology readiness

    Science.gov (United States)

    1981-01-01

    The goals in this program for advanced czochralski growth process to produce low cost 150 kg silicon ingots from a single crucible for technology readiness are outlined. To provide a modified CG2000 crystal power capable of pulling a minimum of five crystals, each of approximately 30 kg in weight, 150 mm diameter from a single crucible with periodic melt replenishment. Crystals to have: resistivity of 1 to 3 ohm cm, p-type; dislocation density below 1- to the 6th power per cm; orientation (100); after growth yield of greater than 90%. Growth throughput of greater than 2.5 kg per hour of machine operation using a radiation shield. Prototype equipment suitable for use as a production facility. The overall cost goal is $.70 per peak watt by 1986. To accomplish these goals, the modified CG2000 grower and development program includes: (1) increased automation with a microprocessor based control system; (2) sensors development which will increase the capability of the automatic controls system, and provide technology transfer of the developed systems.

  8. Intravenous rocuronium 0.3 mg/kg improves the conditions for tracheal intubation in cats: a randomized, placebo-controlled trial.

    Science.gov (United States)

    Sakai, Daniel M; Zornow, Kailee Anne; Campoy, Luis; Cable, Christina; Appel, Leslie D; Putnam, Holly J; Martin-Flores, Manuel

    2018-01-01

    Objectives We evaluated the use of rocuronium 0.3 mg/kg intravenously (IV) to facilitate tracheal intubation in cats anesthetized for elective ovariohysterectomy. Methods Thirty female cats were randomly allocated to receive rocuronium 0.3 mg/kg IV or an equal volume of normal saline, following induction of anesthesia with ketamine and midazolam. Thirty seconds after induction, a single investigator, unaware of treatment allocation, attempted tracheal intubation. The number of attempts and the time to complete intubation were measured. Intubating conditions were assessed as acceptable or unacceptable based on a composite score consisting of five different components. Duration of apnea after induction was measured and cases of hemoglobin desaturation (SpO 2 rocuronium 12 s [range 8-75 s]; saline 60 s [range 9-120 s]) and with fewer attempts (rocuronium 1 [range 1-2]; saline 2 [range 1-3], both P = 0.006) in cats receiving rocuronium. Unacceptable intubating conditions on the first attempt occurred in 3/15 cats with rocuronium and in 10/15 with saline ( P = 0.01). Apnea lasted 4 ± 1.6 mins with rocuronium and 2.3 ± 0.5 mins with saline ( P = 0.0007). No cases of desaturation were observed. Conclusions and relevance Rocuronium 0.3 mg/kg IV improves intubating conditions compared with saline and reduces the time and number of attempts to intubate with only a short period of apnea in cats.

  9. Understanding internal backgrounds in NaI(Tl) crystals toward a 200 kg array for the KIMS-NaI experiment

    Energy Technology Data Exchange (ETDEWEB)

    Adhikari, P.; Adhikari, G.; Oh, S.Y. [Sejong University, Department of Physics, Seoul (Korea, Republic of); Choi, S.; Joo, H.W.; Kim, K.W.; Kim, S.K. [Seoul National University, Department of Physics and Astronomy, Seoul (Korea, Republic of); Ha, C.; Jeon, E.J.; Kang, W.G.; Kim, H.O.; Kim, N.Y.; Lee, H.S.; Lee, J.H.; Lee, M.H.; Leonard, D.S.; Li, J.; Olsen, S.L.; Park, H.K.; Park, K.S.; So, J.H.; Yoon, Y.S. [Institute for Basic Science, Center for Underground Physics, Daejeon (Korea, Republic of); Hahn, I.S. [Ewha Womans University, Department of Science Education, Seoul (Korea, Republic of); Kim, H.J. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Kim, Y.D. [Sejong University, Department of Physics, Seoul (Korea, Republic of); Institute for Basic Science, Center for Underground Physics, Daejeon (Korea, Republic of); Kim, Y.H. [Institute for Basic Science, Center for Underground Physics, Daejeon (Korea, Republic of); Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of); Park, H.S. [Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of)

    2016-04-15

    The Korea Invisible Mass Search (KIMS) collaboration has developed low-background NaI(Tl) crystals that are suitable for the direct detection of WIMP dark matter. Building on experience accumulated during the KIMS-CsI programs, the KIMS-NaI experiment will consist of a 200 kg NaI(Tl) crystal array surrounded by layers of shielding structures and will be operated at the Yangyang underground laboratory. The goal is to provide an unambiguous test of the DAMA/LIBRA annual modulation signature. Measurements of six prototype crystals show progress in the reduction of internal contamination from radioisotopes. Based on our understanding of these measurements, we expect to achieve a background level in the final detector configuration that is less than 1 count/day/keV/kg for recoil energies around 2 keV. The annual modulation sensitivity for the KIMS-NaI experiment shows that an unambiguous 7σ test of the DAMA/LIBRA signature would be possible with a 600 kg year exposure with this system. (orig.)

  10. Perbandingan Pemberian Ondansetron 8 mg dengan Tramadol 1 mg/ kgBB Intravena untuk Mencegah Menggigil Pascaanestesi Umum pada Operasi Mastektomi Radikal atau Modifikasi

    Directory of Open Access Journals (Sweden)

    Mirza Oktavian

    2014-04-01

    Full Text Available ost anesthetic shivering is a common complication of general anesthesia and preventable with several types of drugs. The aim of this study was to compare the efficacy of intravenous 8mg ondansetron versus tramadol 1 mg/kgBW in preventing post anesthetic shivering after general anesthesia. The research is a prospective, randomized double-blind controlled study involving 38 female patients aged 30–65 years at Dr. Hasan Sadikin Hospital Bandung period March–April 2012, American Society of Anesthesiologist (ASA physical status I–II, who underwent radical or modified mastectomy. Subjects were randomly divided into two groups. One group was given ondansetron 8 mg and the other group was given tramadol 1 mg/kgBW before surgical wound closure. Research results showed that incidence of post anesthetic shivering was less on tramadol group (15.8% compared to ondansetron (52.6% group, which is statistically significant (p<0.05. In conclusion, administration of tramadol 1 mg/kgBW intravenously is more effective in preventing post anesthetic shivering in radical or modified mastectomy.

  11. Targeting 2.5 versus 4 g/kg/day of amino acids for extremely low birth weight infants: a randomized clinical trial.

    Science.gov (United States)

    Burattini, Ilaria; Bellagamba, Maria Paola; Spagnoli, Cristina; D'Ascenzo, Rita; Mazzoni, Nadia; Peretti, Anna; Cogo, Paola E; Carnielli, Virgilio P

    2013-11-01

    To compare the effect of 2.5 vs 4 g/kg/d of amino acid (AA) in parenteral nutrition of extremely low birth weight infants on metabolic tolerance, short-term growth, and neurodevelopment. One hundred thirty-one infants with birth weight between 500 and 1249 g were randomized to 2.5 (standard AA [SAA] group) or 4 (high AA [HAA] group) g/kg/d AA intake, with equal nonprotein energy. The primary outcome was body size at 36 weeks. One hundred thirty-one patients were randomized and 114 analyzed (58 SAA group and 56 HAA group). Study groups had similar demographics and clinical characteristics. Elevated blood urea (BU >70 mg/dL = BU nitrogen >32.6 mg/dL) occurred in 24% vs 59% (P = .000) and hyperglycemia (>175 mg/dL) in 34% vs 11% (P = .003) of the SAA and HAA patients, respectively. Body weight, length, and head circumference at 36 weeks and 2 years were similar between groups. Bayley Scales of Infant and Toddler Development, Third Edition score was 94 ± 13 in the SAA group and 97 ± 15 in the HAA group (P = .35). The HAA group had higher BU levels and better glucose control. An extra 8 g/kg of AA over the first 10 days of life did not improve growth and neurodevelopment. Copyright © 2013 Mosby, Inc. All rights reserved.

  12. Composição corporal e exigências nutricionais em cálcio e fósforo para ganho e mantença de cordeiros Santa Inês dos 15 kg aos 25 kg de peso vivo Body composition and requirements for calcium and phosphorus for gain and maintenance of Santa Ines lambs from 15 to 25 kg of body weight

    Directory of Open Access Journals (Sweden)

    Luciana Castro Geraseev

    2000-02-01

    Full Text Available RESUMO - Este trabalho foi conduzido para determinar a composição corporal e estimar as exigências de cálcio e fósforo de cordeiros da raça Santa Inês. Foram utilizados 18 cordeiros machos inteiros, com peso médio inicial de 15 kg, divididos em três grupos: seis animais abatidos no início do experimento, para avaliar o conteúdo de cálcio e fósforo corporal, servindo como animais referência para o método do abate comparativo; seis animais alimentados ad libitum; e seis com alimentação restrita (em nível de mantença + 20%. Os cordeiros que receberam dietas ad libitum e restritas entraram no experimento aos pares e foram abatidos concomitantemente, quando o primeiro atingiu 25 kg de peso vivo. A composição corporal foi estimada a partir de equações de regressão do logaritmo da quantidade de cálcio e fósforo presentes no corpo vazio, em função do logaritmo do peso corporal vazio. As exigências líquidas de mantença e o coeficiente de absorção destes minerais foram determinados a partir da correlação entre a quantidade de mineral ingerida e a quantidade retida no corpo, enquanto as exigências líquidas para o ganho em peso foram estimadas a partir da derivação de equações de predição da composição corporal. As exigências líquidas de mantença, para animais entre 15 e 25 kg de peso vivo, foram 305 mg de Ca/dia e 325 mg de P/dia e as exigências líquidas por kg de ganho de peso vivo, para animais com 15 e 25 kg de peso vivo, 11,41 e 10,33 g Ca e 5,72 e 4,94 g P, respectivamente. Os coeficientes de absorção encontrados neste trabalho foram 0,44 e 0,55 para Ca e P, respectivamente.ABSTRACT - The research was carried out to determine body composition and calcium and phosphorus requirements of Santa Ines lambs. Eighteen entire male lambs with average initial live weight of 15 kg were used. The animals were allotted to three groups: six animals were slaughtered at the beginning of the experiment, to access the

  13. The MOX fuel behaviour test IFA-597.4/.5. Temperature and pressure data to a burn-up of 15 MWd/kg MOX

    International Nuclear Information System (INIS)

    Takano, K.

    1999-04-01

    The behaviour of MOX fuel should be investigated in detail for more effective use in the future, especially concerning its thermal performance and fission gas release. IFA-597.4 and IFA-597.5, containing two MOX fuel rods each with a fuel centre thermocouple and a pressure transducer, have been irradiated in the Halden Reactor to study the temperature threshold of fission gas release for MOX fuel and to explore potential differences in the thermal and fission gas release behaviour between solid and hollow pellets. The two rods of MOX fuel with an initial Pu-fissile content of 6.07 percent have solid pellets and hollow pellets respectively, and with an active length of about 220 mm. The diameter of the pellets is 8.05 mm with 180μm of diametral gap to the cladding. For the purpose of the test, power ramp operation, in which estimated peak temperature of the MOX pellets increases and decreases above and below the threshold for fission gas release in UO 2 fuel, is planned every 10 MWd/kgMOX of burn-up. The first ramp operation has been successfully performed at 10 MWd/kgMOX. When the estimated peak temperature of the fuel gets close to but below the threshold of UO 2 , fission gas release was observed at around 28 kW/m of power. Densification of the MOX pellets could be estimated to about 1.2 percent for the solid pellets and about 2,3 percent for the hollow pellets from normalised internal rod pressure. After 13.5 MWd/kgMOX the average assembly power has been operated low enough to observe swelling rate of MOX fuel pellets and behaviour after significant fission gas release. The burn-up had reached 15.5 MWd/kgMOX as of the end of 1998. The target burn-up of this MOX test is 60 MWd/kgMOX (author) (ml)

  14. Gallbladder ejection fraction (GBEF): after 0.02(G/KG cholecystokinin (CCK) infusion over 30 minutes in patients with a low probability of gallbladder disease

    International Nuclear Information System (INIS)

    Docherty, P.; Micallef, L.; Gruenewald, S.; Larcos, G.

    2003-01-01

    Full text: Recent literature suggests that an infusion of 0.02 (g/Kg of CCK results in a narrower range of normal GBEF than an infusion 0.01(g/Kg of. Our aim was to investigate the effect of a 30-minutes infusion of 0.02 (g/Kg, in patients with a low probability of gallbladder disease. Sixty patients presenting with abdominal symptoms were referred to West mead Medical Imaging over a 9-month period for DISIDA biliary scans. 1-minute dynamic images were collected over 90 minutes. The CCK infusion was commenced when the gallbladder was well filled. GBEF was calculated from background corrected time activity curves over the gallbladder. Sixteen patients were excluded because of previous cholecystectomy or known gallbladder disease. Thirty-three patients were considered to have a low probability of gallbladder disease after final diagnoses were obtained from referring doctors. The mean GBEF for this group was 65.6%, SD 17.2 with a mean range 28-98% compared with mean 56.9%, SD 18.1 with a mean range 21-85% of our previous study using 0.01(gCCK. Females exhibited lower GBEFs than males while females under 50 gave the lowest mean. We concluded that the higher dose infusion causes more complete gallbladder emptying, and that there is a difference in GBEF between males and females of different ages. We question the validity of the same 'Normal' range being applied to both genders and all age groups. Copyright (2003) The Australian and New Zealand Society of Nuclear Medicine Inc

  15. Outcomes of systemic to pulmonary artery shunts in patients weighing less than 3 kg: analysis of shunt type, size, and surgical approach.

    Science.gov (United States)

    Myers, John W; Ghanayem, Nancy S; Cao, Yumei; Simpson, Pippa; Trapp, Katie; Mitchell, Michael E; Tweddell, James S; Woods, Ronald K

    2014-02-01

    To evaluate outcomes of systemic to pulmonary artery shunts (SPS) in patients weighing less than 3 kg with regard to shunt type, shunt size, and surgical approach. Patients weighing less than 3 kg who underwent modified Blalock-Taussig or central shunts with polytetrafluoroethylene grafts at our institution from January 1, 2000, to May 31, 2011, were reviewed. Patients who had undergone other major concomitant procedures were excluded from the analysis. Primary outcomes included mortality (discharge mortality and mortality before next planned palliative procedure or definitive repair), cardiac arrest and/or extracorporeal membrane oxygenation (ECMO), and shunt reintervention. In this cohort of 80 patients, discharge survival was 96% (77/80). Postoperative cardiac arrest or ECMO occurred in 6/80 (7.5%), and shunt reintervention was required in 14/80 (17%). On univariate analysis, shunt reintervention was more common in patients with 3-mm shunts (11/30, 37%) compared with 3.5-mm (2/36, 6%) or 4-mm shunts (1/14, 7%) (P approach and cardiac arrest/ECMO or mortality. Multiple logistic regression demonstrated that a shunt size of 3 mm (P = .019) and extracardiac anomaly (P = .047) were associated with shunt reintervention, whereas no variable was associated with cardiac arrest/ECMO or mortality. In this high-risk group of neonates weighing less than 3 kg at the time of SPS, survival to discharge and the next planned surgical procedure was high. Outcomes were good with the 3.5- and 4-mm shunts; however, shunt reintervention was common with 3-mm shunts. Copyright © 2014 The American Association for Thoracic Surgery. Published by Mosby, Inc. All rights reserved.

  16. Single Low Dose Primaquine (0.25 mg/kg Does Not Cause Clinically Significant Haemolysis in G6PD Deficient Subjects.

    Directory of Open Access Journals (Sweden)

    Germana Bancone

    Full Text Available Primaquine is the only drug consistently effective against mature gametocytes of Plasmodium falciparum. The transmission blocking dose of primaquine previously recommended was 0.75 mg/kg (adult dose 45 mg but its deployment was limited because of concerns over haemolytic effects in patients with glucose-6-phosphate dehydrogenase (G6PD deficiency. G6PD deficiency is an inherited X-linked enzymatic defect that affects an estimated 400 million people around the world with high frequencies (15-20% in populations living in malarious areas. To reduce transmission in low transmission settings and facilitate elimination of P. falciparum, the World Health Organization now recommends adding a single dose of 0.25 mg/kg (adult dose 15 mg to Artemisinin-based Combination Therapies (ACTs without G6PD testing. Direct evidence of the safety of this low dose is lacking. Adverse events and haemoglobin variations after this treatment were assessed in both G6PD normal and deficient subjects in the context of targeted malaria elimination in a malaria endemic area on the North-Western Myanmar-Thailand border where prevalence of G6PD deficiency (Mahidol variant approximates 15%.The tolerability and safety of primaquine (single dose 0.25 mg base/kg combined with dihydroartemisinin-piperaquine (DHA-PPQ given three times at monthly intervals was assessed in 819 subjects. Haemoglobin concentrations were estimated over the six months preceding the ACT + primaquine rounds of mass drug administration. G6PD deficiency was assessed with a phenotypic test and genotyping was performed in male subjects with deficient phenotypes and in all females. Fractional haemoglobin changes in relation to G6PD phenotype and genotype and primaquine round were assessed using linear mixed-effects models. No adverse events related to primaquine were reported during the trial. Mean fractional haemoglobin changes after each primaquine treatment in G6PD deficient subjects (-5.0%, -4.2% and -4

  17. Bariatric Surgery for Type 2 Diabetes Mellitus in Patients with BMI <30 kg/m2: A Systematic Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    Attit Baskota

    Full Text Available The role of bariatric surgery in non-obese patients with type 2 diabetes (T2DM remains unclear, and its use in clinical practice is controversial. We conducted a systemic review and meta-analysis to investigate the metabolic changes after surgical treatment in diabetic patients with body mass index (BMI <30 kg/m2.We conducted a comprehensive search in MEDLINE (PubMed, EMBASE and the Cochrane Library of published articles from January 2000 to April 2013 reporting the clinical outcome changes in various metabolic outcomes in diabetic patients with BMI <30 kg/m2.Ten prospective studies including 290 patients were included in the meta-analysis. Bariatric surgery led to an overall 2.79 kg/m2 [95%CI 2.05~3.53, P<0.00001] reduction in BMI, a 1.88%[95%CI 1.32~2.43, P<0.00001] reduction in glycosylated hemoglobin, a 3.70 mmol/L [95%CI, 1.93~5.47, P<0.00001] reduction in fasting blood glucose, a 6.69 mmol/L [95%CI, 2.29~11.08, P=0.003] reduction in postprandial glucose, anda 3.37 [95%CI 0.55~6.18, P=0.02] reduction in homeostasis model assessment of insulin resistance (HOMA-IR. After surgical treatment, 76.2% of the patients were insulin free, and 61.8% patients were off medication. In total, 90(42.4%, 10(37% and 34(37.2% patients had post-surgical HbA1c levels of <6%,<6.5% and<7%, respectively. No deaths were observed in the included studies, and the major complication rate was 6.2%.Based on the currently available data, bariatric surgery might improve glycemic control and weight loss in a very limited range with a doubled surgical complication rate in drug-refractory T2DM patients with BMI <30 kg/m2. It remains too premature to suggest bariatric surgery for non-obese T2DM patients.

  18. On the condition of UO{sub 2} nuclear fuel irradiated in a PWR to a burn-up in excess of 110 MWd/kgHM

    Energy Technology Data Exchange (ETDEWEB)

    Restani, R.; Horvath, M. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Goll, W. [AREVA GmbH, P.O. Box 1109, DE-91001 Erlangen (Germany); Bertsch, J.; Gavillet, D.; Hermann, A. [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Martin, M., E-mail: matthias.martin@psi.ch [Paul Scherrer Institut, CH-5232, Villigen PSI (Switzerland); Walker, C.T. [The Grange, 66 High Street, Swinderby, Lincoln LN6 9LU (United Kingdom)

    2016-12-01

    Post-irradiation examination results are presented for UO{sub 2} fuel from a PWR fuel rod that had been irradiated to an average burn-up of 105 MWd/kgHM and showed high fission gas release of 42%. The radial distribution of xenon and the partitioning of fission gas between bubbles and the fuel matrix was investigated using laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) and electron probe microanalysis. It is concluded that release from the fuel at intermediate radial positions was mainly responsible for the high fission gas release. In this region thermal release had occurred from the high burn-up structure (HBS) at some point after the sixth irradiation cycle. The LA-ICP-MS results indicate that gas release had also occurred from the HBS in the vicinity of the pellet periphery. It is shown that the gas pressure in the HBS pores is well below the pressure that the fuel can sustain. - Highlights: • Gas retention measured by laser ablation induction coupled plasma mass spectrometry. • Thermal release from the high burn structure responsible for high gas release. • At a pellet burn-up of 115 MWd/kgHM the high burn-up structure is still evolving. • The gas pressure in HBS pores is well below the pressure that the fuel can sustain.

  19. Concentrations of tylvalosin and 3-O-acetyltylosin attained in the synovial fluid of swine after administration by oral gavage at 50 and 5 mg/kg.

    Science.gov (United States)

    Canning, P; Bates, J; Hammen, K; Coetzee, J; Wulf, L; Rajewski, S; Wang, C; Karriker, L

    2016-12-01

    The objectives of this study were to determine the concentration of tylvalosin (TVN) and its metabolite, 3-O-acetyltylosin (3AT) in the synovial fluid of growing pigs when administered as a single bolus by oral gavage at target doses of 50 mg/kg (Trial 1) and 5 mg/kg (Trial 2). TVN is a water soluble macrolide antimicrobial used in swine production. The stability of the drug in synovial fluid samples stored at -70 °C up to 28 days was also evaluated in Trial 2. In Trial 1, eight pigs were randomly assigned to one of eight time points for euthanasia and synovial fluid collection: 0, 1, 2, 3, 4, 6, 9, 12 h postgavage. For Trial 2, 24 pigs were randomly allocated to one terminal collection time point at 0, 2, 4, 6, 8 or 10 h postgavage. Synovial fluid was analyzed to determine TVN and 3AT concentrations. TVN and 3AT were detected in Trial 1 at all time points, except 0 h. At 2 h postgavage for trial 2, the mean concentrations peaked at 31.17 ng/mL (95% CI: 18.62-52.16) for TVN and at 58.82 ng/mL (95% CI: 35.14-98.46) for 3AT. Storage duration did not impact TVN or 3AT concentrations (P-value 0.9732). © 2016 John Wiley & Sons Ltd.

  20. Semipurified glycerins on starting piglets feeding‏ (15-30 kg - doi: 10.4025/actascianimsci.v35i2.17264

    Directory of Open Access Journals (Sweden)

    Clodoaldo de Lima Costa Filho

    2013-03-01

    Full Text Available The nutritional value and the performance of piglets fed on diets with semipurified glycerin (SPGV and mixed (SPGM vegetable oil was determined and evaluated. Thirty-two crossbred piglets, allotted in a completely randomized block design, were used in the digestibility trial. Two types of glycerin (SPGV and SPGM and three levels of diet (4, 8 and 12% were studied. The experimental unit consisted of one piglet. Glycerins’ metabolizable energy (ME was estimated by regression of ME (kcal kg-1 intake associated with glycerin vs. glycerin intake (kg. ME as-feed-basis rates were 3,373 for SPGV and 2,932 for SPGM, or rather, the glycerins are highly available energy source for piglets. In the performance trial, 90 piglets were allotted in a completely randomized blocks design in a 2 x 4 + 1 factorial scheme, two glycerins, four levels (3, 6, 9 and 12%, five replicates (pens and two piglets per pen. A control diet with no glycerin (0% was additionally formulated. Since no effect of glycerin inclusion on pig performance occurred, it was feasible to use up to 12% of both types of glycerin on piglets feeding.    

  1. Characteristics of WWER-1000 fuel rod claddings and FA components from E635 alloy at burnups up to 72 MWd/kgU

    International Nuclear Information System (INIS)

    Nikulin, A.; Novikov, A.; Peregud, M.; Shishov, V.; Shevyakov, A.; Volkova, I.; Novoselov, A.; Kobylyansky, G.

    2011-01-01

    In this paper operation experience, results of investigated E365 alloy components of Balakovo NPP Unit 1 and Kalinin NPP unit 1 fuel assemblies are presented. Appearance, shape changes and geometric size, corrosion state of guide thimbles, angles and fuel rods, corrosion of fuel claddings are studied. At the end authors concluded that: I) E635 alloy corroborated its high operation reliability as fuel claddings and WWER-1000 FA components during 6 year service to the fuel burnup of 72MWd/kgU; II) Based on the results from the post-irradiation investigations of the fuel rods and other structural elements of WWER-1000 FAA, fabricated from E635 alloy, in terms of the basic operational characteristics, their resources after the 6 year operation cycle have not been exhausted; III) The geometrical parameters, corrosion states, tensile properties of items fabricated from fuel alloy did not attain the values that would prevent their further operation: 1) the elongations of the fuel rods at the mean burnups up to 66.2 MWd/kgU do not exceed 15 mm or 4.9%; 8) the amount of the oxide coat at surface of GT and CT does not exceed 45 μm, the hydrogen content is <0.03% mass; 9) the oxide coat at the surfaces of the frame angles does not exceed 50 μm, the hydrogen content is <0.04% mass

  2. There is no difference in the plasma cortisol level between women with body mass index (BMI) greater than or equal 25 kg/m² and polycystic ovary syndrome and the control group without polycystic ovary syndrome and BMI 25 kg/m².

    Science.gov (United States)

    Mrozińska, Sandra; Milewicz, Tomasz; Kiałka, Marta; Gosztyła, Katarzyna; Lurzyńska, Małgorzata; Kabzińska-Turek, Monika

    2016-01-01

    A 4-8% of women of reproductive age suffer from the polycystic ovary syndrome (PCOS). The clinical and/ or biochemical hyperandrogenemia is found up to 75% of women with PCOS. It is unclear whether the hyperandogenemia in PCOS is caused directly by this disorder or by obesity. The recent studies have shown that the cortisol level in PCOS patients can be elevated, decreased or comparable to the control group. The aim of our study was to assess the cortisol plasma level in women with body mass index greater than or equal to 25 kg/ m², with and without PCOS. The study population consisted of 17 overweight women with PCOS and 44 overweight women without PCOS. There were not statistically significant differences in the body mass (group 1: 88.9 ± 17.0 kg, vs. group 2: 84.4 ± 15.2 kg; NS) nor the body mass index between both groups (group 1: 31.7 ± 5.9 kg/m², vs. group 2: 30.6 ± 5.4 kg/m²; NS). The groups did not differ in TSH, FSH, estradiol, SHBG, prolactin level at the baseline. There was no statistically significant difference between both groups in the cortisol levels at 5 a.m. and 7 a.m. Our study suggests that there is no difference in the morning and 7 p.m. cortisol level between the women with and without PCOS among the population of women with body mass index greater than or equal 25 kg/m².

  3. Characteristics of monsoon waves off Uran, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Nayak, B.U.; Chandramohan, P.; Mandal, S.

    's and the spectral methods for determining various wave parameters. Monsoon wave climate was stronger with the occurrence of the highest significant wave height of 2.45 m and the corresponding maximum wave height of 3.9 m in July. Significant wave height varied from...

  4. Isotope exchange reaction in uranous-uranyl-sulphuric acid system

    International Nuclear Information System (INIS)

    Ling Daren; Yue Tingsheng; Mu Dehai; Wang Yani

    1990-01-01

    The kinetics of the isotope exchange reaction between U(IV) and U(VI) has been studied in low concentrations of sulphuric acid. A minimum exchange rate appears at 0.25 M H 2 SO 4 . From the rates at different temperatures ranging from 20deg to 35deg C, an apparent activation energy of 86 kcal/mole was calculated. The exchange rate was found to be accelerated by the addition of ferrous ions, and a half-life of less than 1 s, was obtained. Probable mechanisms for the acceleration of the uranium isotope exchange reactions by acidity and ferrous ions are proposed. (orig.)

  5. Elucidating bonding preferences in tetrakis(imido)uranate(VI) dianions

    Science.gov (United States)

    Anderson, Nickolas H.; Xie, Jing; Ray, Debmalya; Zeller, Matthias; Gagliardi, Laura; Bart, Suzanne C.

    2017-09-01

    Actinyl species, [AnO2]2+, are well-known derivatives of the f-block because of their natural occurrence and essential roles in the nuclear fuel cycle. Along with their nitrogen analogues, [An(NR)2]2+, actinyls are characterized by their two strong trans-An-element multiple bonds, a consequence of the inverse trans influence. We report that these robust bonds can be weakened significantly by increasing the number of multiple bonds to uranium, as demonstrated by a family of uranium(VI) dianions bearing four U-N multiple bonds, [M]2[U(NR)4] (M = Li, Na, K, Rb, Cs). Their geometry is dictated by cation coordination and sterics rather than by electronic factors. Multiple bond weakening by the addition of strong π donors has the potential for applications in the processing of high-valent actinyls, commonly found in environmental pollutants and spent nuclear fuels.

  6. Hydrolysis of U(VI) and sodium uranates

    International Nuclear Information System (INIS)

    Pongi, N.-K.; Double, Gerard; Hurwic, Jozef

    1980-01-01

    The potentiometric titration curves of UO 2 (NO 3 ) 2 aqueous solutions by NaOH have been interpreted. The results we have got verify and complete those published before. From isohydric species (UO 2 ) 3 (OH) 7 - , with pH = 7,8 and the experimental molar value of the relation xsub(i) = Na/U = 2.33, the following ionic and molecular species in acid medium have been deduced: (UO 2 ) 2 (OH) 2 2+ , (UO 2 ) 3 (OH) 2 2+ , (UO 2 ) 3 (OH) 5 + and (UO 2 ) 3 (OH) 6 . The composition of the precipitates corresponding to the particular points of the potentiometric titration curves, by chemical, thermal decomposition analysis and by X-rays diffraction, have been carried out: (UO 2 ) 6 (OH) 12 .6H 2 O, Na 2 U 8 O 25 , Na 2 U 6 O 19 , Na 2 U 4 O 13 and Na 2 U 2 O 7 for xsub(i) = 1,67 and 2.00, 2.23, 2.33, 2.52, 3.00 and over, respectively. The uranyl hydroxide was obtained for first time from an aqueous solution [fr

  7. Uranium in soils and water; Uran in Boden und Wasser

    Energy Technology Data Exchange (ETDEWEB)

    Dienemann, Claudia; Utermann, Jens

    2012-07-15

    The report of the Umweltbundesamt (Federal Environmental Agency) on uranium in soils and water covers the following chapters: (1) Introduction. (2) Deposits and properties: Use of uranium; toxic effects on human beings, uranium in ground water and drinking water, uranium in surface waters, uranium in soils, uranium in the air. (3) Legal regulations. (4) Uranium deposits, uranium mining, polluted area recultivation. (5) Diffuse uranium entry in soils and water: uranium insertion due to fertilizers, uranium insertion due to atmospheric precipitation, uranium insertion from the air. (6) Diffuse uranium release from soils and transfer in to the food chain. (7) Conclusions and recommendations.

  8. IFPE/NFIR-1, Clad creep-down, power history effect on fission product distribution (6 PWR rods 40-64 MWd/kg in BR-3)

    International Nuclear Information System (INIS)

    Turnbull, J.A.

    2006-01-01

    Description: The NFIR-1 programme was designed to investigate factors likely to affect the fission gas release behaviour of fuel rods operating under normal commercial conditions. The factors which were investigated were: - the effect of fuel/rod design parameters, e.g., wet versus dry route pellet manufacture, fuel-clad gap size and rod pressurization; - the effect of power history i.e., In/Out fuel management strategy; - the effect of burn-up extension. This was accomplished by an extensive PIE campaign on 6 fuel rods irradiated to 40-64 MWd/kg under different prescribed conditions in the BR3 PWR. The examination involved non destructive mensuration and destructive examination using optical, SEM, TEM and EPMA techniques. The dataset is unique in demonstrating the effect of these variables on fuel performance

  9. A comparative study of track registration response of Makrofol-(KG, KL and N) polycarbonate to sup 4 sup 0 Ar ions

    CERN Document Server

    Kumar, A

    1999-01-01

    In the present work a comparative study of track registration response of sup 4 sup 0 Ar ions in different types of Makrofol polycarbonates viz. Makrofol-KG, KL and N have been done. The etched track parameters viz. bulk etch rate, track etch rate, etch rate ratio, cone angle and etching efficiency were calculated. The variation of etching rates with temperature were found to be exponential and follow the Arrhenius equation. The values of activation energy for bulk and track etching were also calculated. Maximum etchable track length/range were also obtained and compared with the theoretical values obtained from computer program RANGE. From the results it is found that the polycarbonates having same chemical composition manufactured by different chemical processes have slightly different behavior

  10. Montaje y puesta en marcha de una nueva línea de cardado de 4900kg/día de una empresa textil

    OpenAIRE

    Pastrana Chaca, Hernan Jesus; Pastrana Chaca, Hernan Jesus; Pastrana Chaca, Hernan Jesus

    2015-01-01

    El proceso de cardado en la industria de la hilandería textil moderna es de vital importancia para una buena calidad de hilo, es por eso que se dice que el origen de un buen hilado proviene de un buen cardado. El presente informe trata del proyecto de sustitución de 8 máquinas de cardado como una alternativa técnica - económica para mejorar la productividad y calidad de la empresa Compañía Industrial Romosa S.A.C. de 3200 kg. /día de capacidad de producción de hilado. En el capítulo 1,...

  11. Association between class III obesity (BMI of 40-59 kg/m2 and mortality: a pooled analysis of 20 prospective studies.

    Directory of Open Access Journals (Sweden)

    Cari M Kitahara

    2014-07-01

    Full Text Available The prevalence of class III obesity (body mass index [BMI]≥40 kg/m2 has increased dramatically in several countries and currently affects 6% of adults in the US, with uncertain impact on the risks of illness and death. Using data from a large pooled study, we evaluated the risk of death, overall and due to a wide range of causes, and years of life expectancy lost associated with class III obesity.In a pooled analysis of 20 prospective studies from the United States, Sweden, and Australia, we estimated sex- and age-adjusted total and cause-specific mortality rates (deaths per 100,000 persons per year and multivariable-adjusted hazard ratios for adults, aged 19-83 y at baseline, classified as obese class III (BMI 40.0-59.9 kg/m2 compared with those classified as normal weight (BMI 18.5-24.9 kg/m2. Participants reporting ever smoking cigarettes or a history of chronic disease (heart disease, cancer, stroke, or emphysema on baseline questionnaires were excluded. Among 9,564 class III obesity participants, mortality rates were 856.0 in men and 663.0 in women during the study period (1976-2009. Among 304,011 normal-weight participants, rates were 346.7 and 280.5 in men and women, respectively. Deaths from heart disease contributed largely to the excess rates in the class III obesity group (rate differences = 238.9 and 132.8 in men and women, respectively, followed by deaths from cancer (rate differences = 36.7 and 62.3 in men and women, respectively and diabetes (rate differences = 51.2 and 29.2 in men and women, respectively. Within the class III obesity range, multivariable-adjusted hazard ratios for total deaths and deaths due to heart disease, cancer, diabetes, nephritis/nephrotic syndrome/nephrosis, chronic lower respiratory disease, and influenza/pneumonia increased with increasing BMI. Compared with normal-weight BMI, a BMI of 40-44.9, 45-49.9, 50-54.9, and 55-59.9 kg/m2 was associated with an estimated 6.5 (95% CI: 5.7-7.3, 8

  12. On the thermal conductivity of UO2 nuclear fuel at a high burn-up of around 100 MWd/kgHM

    International Nuclear Information System (INIS)

    Walker, C.T.; Staicu, D.; Sheindlin, M.; Papaioannou, D.; Goll, W.; Sontheimer, F.

    2006-01-01

    A study of the thermal conductivity of a commercial PWR fuel with an average pellet burn-up of 102 MWd/kgHM is described. The thermal conductivity data reported were derived from the thermal diffusivity measured by the laser flash method. The factors determining the fuel thermal conductivity at high burn-up were elucidated by investigating the recovery that occurred during thermal annealing. It was found that the thermal conductivity in the outer region of the fuel was much higher than it would have been if the high burn-up structure were not present. The increase in thermal conductivity is a consequence of the removal of fission products and radiation defects from the fuel lattice during recrystallisation of the fuel grains (an integral part of the formation process of the high burn-up structure). The gas porosity in the high burn-up structure lowers the increase in thermal conductivity caused by recrystallisation

  13. Five-year field results and long-term effectiveness of 20 mg/kg liposomal amphotericin B (Ambisome for visceral leishmaniasis in Bihar, India.

    Directory of Open Access Journals (Sweden)

    Sakib Burza

    Full Text Available BACKGROUND: Visceral Leishmaniasis (VL; also known as Kala-azar is an ultimately fatal disease endemic in Bihar. A 2007 observational cohort study in Bihar of 251 patients with VL treated with 20 mg/Kg intravenous liposomal amphotericin B (Ambisome demonstrated a 98% cure rate at 6-months. Between July 2007 and August 2012, Médecins Sans Frontières (MSF and the Rajendra Memorial Research Institute (RMRI implemented a VL treatment project in Bihar, India-an area highly endemic for Leishmania donovani-using this regimen as first-line treatment. METHODS AND PRINCIPAL FINDINGS: Intravenous Ambisome 20 mg/kg was administered in four doses of 5 mg/kg over 4-10 days, depending on the severity of disease. Initial clinical cure at discharge was defined as improved symptoms, cessation of fever, and recession of spleen enlargement. This observational retrospective cohort study describes 8749 patients with laboratory-confirmed primary VL treated over a 5-year period: 1396 at primary healthcare centers, 7189 at hospital, and 164 at treatment camps. Initial clinical cure was achieved in 99.3% of patients (8692/8749; 0.3% of patients (26/8749 defaulted from treatment and 0.4% (31/8749 died. Overall, 1.8% of patients (161/8749 were co-infected with HIV and 0.6% (51/8749 with tuberculosis. Treatment was discontinued because of severe allergic reactions in 0.1% of patients (7/8749. Overall, 27 patients (0.3% were readmitted with post Kala-azar dermal leishmaniasis (PKDL. Risk factors for late presentation included female sex, age >15 years and being from a scheduled caste. In 2012, a long-term efficacy survey in the same area of Bihar determined relapse rates of VL after 5 years' intervention with Ambisome. Of 984 immunocompetent patients discharged between September 2010 and December 2011, 827 (84.0% were traced in order to determine their long-term outcomes. Of these, 20 patients (2.4% had relapsed or received further treatment for VL. Of those completing 6

  14. The MOX Fuel Behaviour Test IFA-597.4: Temperature And Pressure Data To A Burn-Up Of 5.4 MWd/kg MOX

    International Nuclear Information System (INIS)

    McGrath, M. A.; Teshima, H.

    1998-02-01

    Characterising the behaviour of MOX fuel is becoming increasingly important as many commercial reactors are or will be operating with this type of fuel. With this as a driving force, a new joint programme experiment, IFA-597.4, has been loaded into the reactor at Halden for the purpose of establishing the fission gas release behaviour of MOX fuel. Both annular and solid pellet fuel is being utilised and the irradiation is being conducted such that the fuel is initially operated below the onset of fission gas release. The fuel will later be subjected to small power up ratings which will be held for short periods of time. These are designed to bring the fuel to just above the temperature threshold for fission gas release thus allowing the FGR behaviour of both solid and annular MOX fuel to be established. The rig contains two fuel rods of active length 220 mm and diameter 8.05 mm. Both fuel rods contain MOX fuel with an initial Pu-fissile content of 6.07% and both are instrumented with a fuel centre thermocouple and a pressure transducer. The test is being performed under HBWR conditions and at the time of the reactor shutdown at the end of 1997 a mean burn-up of 5.4 MWd/kg MOX had been achieved with the rods at an average rating of 30 kW/m. The rod pressure data show that no fission gas had been released up to the shutdown. The fuel centre temperatures of both rods exhibit an initial increase concurrent with a fall in the monitored rod internal pressures as a result of fuel densification. It was estimated that about 1-1.4% fuel densification by volume had occurred in the two rods by a burn-up of about 3 MWd/kg MOX. (author)

  15. Cafeína (150 mg/kg y aprendizaje espacial (retención y adquisición en ratones

    Directory of Open Access Journals (Sweden)

    María del Pilar Santacruz

    2003-01-01

    Full Text Available En este trabajo se evaluó el papel que juega la cafeína (150mg/kg en el aprendizaje espacial (adquisición y retención en ratones mediante las mediciones de la latencia de salida, velocidad, aciertos, regresos, errores y excretas en un laberinto de 3 x 3 metros. Los sujetos fueron moldeados para una ruta en el laberinto y luego se aleatorizaron 20 machos y 20 hembras para la administración de cafeína (s.c. y solución salina durante ocho días consecutivos; luego se observó la retención de este aprendizaje y se moldeó otra ruta para evaluar su retención 24 horas después: La cafeína incrementó la retención del aprendizaje 1, donde hubo los mayores aciertos, y en el segundo las hembras con cafeína exhibieron mayor velocidad y aciertos mientras que los machos, presentaron menores aciertos y velocidad que todos los grupos; como vemos, en el segundo caso, la cafeína fortaleció la retención del aprendizaje 2 en las hembras y la debilitó en los machos. Se concluye que la cafeína (150mg/kg influyó positivamente en la retención del aprendizaje espacial, mas no en la adquisición. Este artículo está asociado a la línea de investigación en Cafeína y Cognición de la Universidad de la Sabana.

  16. Postoperative impairment of motor function at train-of-four ratio ≥0.9 cannot be improved by sugammadex (1 mg kg-1).

    Science.gov (United States)

    Baumüller, E; Schaller, S J; Chiquito Lama, Y; Frick, C G; Bauhofer, T; Eikermann, M; Fink, H; Blobner, M

    2015-05-01

    A train-of-four ratio (TOFR) ≥0.9 measured by quantitative neuromuscular monitoring is accepted as an indication of sufficient neuromuscular recovery for extubation, even though many postsynaptic acetylcholine receptors may still be inhibited. We investigated whether antagonism with sugammadex after spontaneous recovery to TOFR≥0.9 further improves muscle function or subjective well-being. Following recovery to TOFR≥0.9 and emergence from anaesthesia, 300 patients randomly received either sugammadex 1.0 mg kg(-1) or placebo. Fine motor function (Purdue Pegboard Test) and maximal voluntary grip strength were measured before and after surgery (before and after test drug administration). At discharge from the postanaesthesia care unit, well-being was assessed with numerical analogue scales and the Quality-of-Recovery Score 40 (QoR-40). Patients' fine motor function [6 (sd 4) vs 15 (3) pegs (30 s)(-1), Psugammadex or placebo, motor function was significantly improved in both groups but did not reach the preoperative level. There was no difference between groups at any time. Global well-being was unaffected (QoR-40: placebo, 174 vs 185; sugammadex, 175 vs 186, P>0.05). Antagonizing rocuronium at TOF≥0.9 with sugammadex 1.0 mg kg(-) (1) did not improve patients' motor function or well-being when compared with placebo. Our data support the view that TOFR≥0.9 measured by electromyography signifies sufficient recovery of neuromuscular function. The trial is registered at ClinicalTrials.gov (NCT01101139). © The Author 2014. Published by Oxford University Press on behalf of the British Journal of Anaesthesia. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Pilot scale electron bombardment furnace for continuous casting; application to the trial preparation of 20 kg of uranium monocarbide rods; Appareil pilote de fusion par bombardement d'electrons et coulee continue - application a un essai de fabrication portant sur 20 kg de barreaux de monocarbure d'uranium

    Energy Technology Data Exchange (ETDEWEB)

    Trouve, J; Genard, R; Treillou, A; Accary, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-07-01

    The authors describe a pilot scale electron beam furnace designed for continuous melting and casting of uranium-carbon alloys. This equipment allows the melting and casting processes to be completely automatically controlled, the cooling being carried out under vacuum and the discharge being effected without breaking the vacuum. In a pre-production run of 20 kg of slugs, the composition of practically all the pieces was controlled within {+-} 0,1 per cent C. The output of the furnace was 2,2 kg/hour. (authors) [French] Les auteurs decrivent un appareil pilote de fusion par bombardement d'electrons et coulee continue. Cet appareil, muni d'un systeme de coulee automatique, permet la fusion et la coulee d'alliages uranium-carbone, leur refroidissement sous vide et leur defournement, toutes ces operations se deroulant d'une maniere continue. Ils montrent qu'au cours d'une campagne preliminaire de fusion et coulee de 20 kg de barreaux, la teneur en carbone de la quasi-totalite des barreaux obtenus est controlee a 0,1 pour cent pres. La production horaire de l'appareillage est de 2,2 kg. (auteurs)

  18. Preparation procedure and certification of uranous-uranic oxide and nitric acid solution of neptunium as standard specimens of plant

    International Nuclear Information System (INIS)

    Bulyanitsa, L.S.; Lipovskij, A.A.; Ryzhinskij, M.V.; Preobrazhensskaya, L.D.; Aleksandruk, V.M.; Alekseeva, N.A.; Gromova, E.A.; Solntseva, L.F.; Shereshevskaya, I.I.

    1981-01-01

    Two techniques of certification of standard specimens of plant (SSP) are considered. The first technique-comparison with initial SS-metallic uranium NBS-960 - is used for certification of uranium. protoxide-oxide. The mass part of the sum of analyzed impurities in prepared initial SS is (8.4+-0.8)x10 -3 %. For certification according to mass uranium part the method of gravimetric potentiometric titration with semiautomatic titrator is used; the mean quadratic deviation of the method is s=0.0002-0.0003, certified value of uranium mass part in SSP (taking account of the error of initial SS) is (84.80+-0.02)%. The second technigue - a simplified circular experiment - is used for certification of SSP-nitric acid solution of neptunium as to Np mass part. Coulometry at controlled potential and coulometry at controlled current and two variants of potentiometric titration are used as certification methods of analysis. Relative mean quadratic deviations of the methods are ssub(r)=0.0014-0.0023. When calculating total error of certified value of neptunium mass part constituents of both accidental and unremoved systematic errors of the methods were included. The final certification result of SSP is (5.707+-0.018)% [ru

  19. IFPE/IFA-597.3, centre-line temperature, fission gas release and clad elongation at high burn-up (60-62 MWd/kg)

    International Nuclear Information System (INIS)

    Turnbull, J.A.

    2003-01-01

    Description: The fuel segments for the high burn-up integral rod behaviour test IFA-597 were taken from fuel rod 33-25065, which was irradiated in the Ringhals 1 BWR for approximately 12 years. The irradiation of this rod and its sibling rod 33-25046 was performed in two stages. During the first irradiation, 1980 to 1986, the rods were part of Ringhals assembly 6477 and an approximate rod averaged burn-up of 31 MWd/kg UO 2 was reached. The rods were then placed into fuel assembly 9902 for a second period of irradiation from 1986 to 1992. The location of the fuel rods 33-25065 and 33-25046 in this assembly were in positions 9902/D and 9902/E4 respectively. A final rod averaged burn-up of 52 MWd/kg UO 2 was achieved. The burn-up at the location of the Halden segments was estimated as 59 MWd/kg UO 2 , well beyond the formation of High Burn-up Structure (Hobs) formation at the pellet rim. At the rim, the burn-up was estimated as 130 MWd/kg UO 2 . After commercial irradiation, PIE was performed at Studsvik. Inner and outer clad oxide thickness measurements were 42 and 5 microns respectively. The measured cold rod diameter varied between 12.20 and 12.25 mm, thus only a small amount of creep-down had occurred from the original diameter of 12.25 mm. Cold gap measurements were taken by diametral compression of the clad onto the fuel. The stiffness changes twice during these measurements, the first (relocated gap) associated with the onset of pellet fragment movement, the second (compressed gap) when the fragments are together and the pellet is compressed. For these rods, the compressed diametral gap was measured as 30 microns. This is in agreement with the pellet and cladding being in contact during the final irradiation cycle, i.e., at ∼12 kW/m. FGR measurements were made after puncturing and values of 2.5%-3.3% were calculated from the extracted gas. The uncertainty is due to different methods of calculation. Ceramography showed a normal crack pattern and no evidence of

  20. Níveis de energia metabolizável em rações formuladas com base no conceito de proteína ideal e suplementadas com fitase para leitões dos 15 aos 35 kg Metabolizable energy levels in diets formulated according to the ideal protein concept and supplemented with phytase for piglets from 15 to 35 kg

    Directory of Open Access Journals (Sweden)

    Marcelo José Milagres de Almeida

    2008-05-01

    Full Text Available Um experimento foi conduzido para avaliar a influência de diferentes níveis de energia metabolizável (EM e proteína bruta (PB em rações formuladas segundo o conceito de proteína ideal com suplementação de fitase sobre o desempenho e as características de carcaça de leitões dos 15 aos 35 kg. Foram utilizados 84 leitões híbridos comerciais (Agroceres × MS60 com peso médio inicial de 15,3 kg, distribuídos em delineamento de blocos casualizados, em esquema fatorial 3 × 2 + 1, composto de três níveis de energia metabolizável (3.080, 3.230 e 3.380 kcal/kg, dois de proteína bruta (14% e 16% e da suplementação com aminoácidos sintéticos e fitase (1.000 uft/kg de ração, por meio da redução do teor de cálcio em 25% e o de fósforo em 30%. A ração controle com 18% de PB foi formulada segundo o conceito de proteína bruta e sem adição de fitase, visando atender às exigências nutricionais de leitões, totalizando sete tratamentos, cada um com seis repetições e dois animais por unidade experimental. As rações não influenciaram o ganho de peso, a conversão alimentar, o consumo de energia metabolizável e os pesos dos órgãos (tanto absoluto como relativo dos leitões. O consumo de ração foi maior e a taxa de deposição de gordura foi menor nos leitões alimentados com rações contendo 3.080 kcal EM/kg. Verificaram-se redução no consumo de nitrogênio, aumento na eficiência de utilização de nitrogênio para ganho e menor teor de uréia sanguínea nos leitões alimentados com as rações com 14% PB em comparação àquelas com 18%. A redução dos níveis de EM, PB, fósforo disponível (Pd e cálcio (Ca para 3.080 kcal/kg, 14; 0,54 e 0,28%, respectivamente, em rações para leitões, formuladas segundo o conceito de proteína ideal e fitase, não prejudica o desempenho de leitões dos 15 aos 35 kg.A total of 84 barrows and females from a commercial hybrid (Agroceres × MS60, averaging 15.3 kg, was raised from

  1. Níveis de proteína bruta para leitoas dos 30 aos 60 kg mantidas em ambiente de alta temperatura (31ºC

    Directory of Open Access Journals (Sweden)

    Orlando Uislei Antonio Dias

    2001-01-01

    Full Text Available O experimento foi conduzido para avaliar níveis de proteína bruta (PB para leitoas em crescimento, mantidas em ambiente de alta temperatura. A temperatura interna da sala foi mantida em 30,7 ± 0,61°C; a umidade relativa, em 66,4 ± 7,7%; e o índice de temperatura de globo e umidade (ITGU foi calculado em 81,1 ± 1,36. Foram utilizadas 40 leitoas mestiças, com peso inicial médio de 29,7 ± 1,60 kg, em delineamento de blocos ao acaso com cinco tratamentos (16, 17, 18, 19 e 20% de PB, quatro repetições e dois animais por unidade experimental. As rações experimentais isoenergéticas (3400 kcal de ED/kg de ração foram formuladas para satisfazer as exigências dos animais, exceto em PB. Ração e água foram fornecidas à vontade até o final do experimento, quando os animais atingiram peso médio de 60,0 ± 1,93 kg. Os tratamentos não influenciaram o ganho de peso. Entretanto, a conversão alimentar melhorou de forma quadrática até o nível de 18,26%. Os consumos diários de proteína e lisina aumentaram linearmente em razão do nível de PB da ração, porém não se observou efeito dos tratamentos sobre os consumos de ração e de energia digestível diários. A taxa de deposição diária de gordura (TDG na carcaça variou de forma quadrática, reduzindo até o nível de 19,48% de PB, enquanto a de proteína (TDP aumentou de forma linear. Apesar dos efeitos quadrático e linear dos tratamentos sobre a TDG e a TDP, respectivamente, o modelo "Linear Response Plateau" (LRP foi o que melhor se ajustou aos dados, estimando-se em 18,38 e 18,12% os níveis de PB, a partir dos quais a TDG e a TDP permaneceram em um platô. Leitoas em crescimento, mantidas em ambiente de alta temperatura, exigem 18,26% de PB na ração para melhor desempenho e composição de carcaça.

  2. Perbandingan Insidensi Hipotensi Saat Induksi Intravena Propofol 2 Mg/Kg Bb Pada Posisi Supine dengan Perlakuan dan Tanpa Perlakuan Elevasi Tungkai

    Directory of Open Access Journals (Sweden)

    Beni Indra

    2016-01-01

      of blood to venous reservoir, especially capacitance venule of legs. Leg elevation can provide hemodynamic stability by increases cardiac preload and recruits blood contained in the venous reservoir. This is Open Randomized Control Trial include 184 elective surgery patients with American Society of Anaesthesiologist (ASA physical status I and II. Anesthesia  was induced with propofol. Patients were randomly allocated into two groups with 92 patients in each. All the patients received Ringer’s Lactate (10 ml/kg and premedicated with fentanyl (2 mcg/kg and midazolam (0,05 mg/kg before induction of anesthesia. Group A was performed passive leg raising 45 degree 1 minute before injection of propofol until  the end of study and group B (control did not receive any maneuver. Parametric data were analyzed with t-test and categorical data was done by using Chi-square test. A p value of less than 0,05 was consider significant. Demografic characteristics (age, sex, body weight and height and  baseline haemodynamic parameters of the patients were similar in two groups (p > 0.05 except for BMI (p < 0.05 . The incidence of hypotension was significantly lower in group A (12 %, than group  B (27,2% at the first minute after propofol  injection, p value = 0.016 (p < 0,05. In the third minute, incidence of hypotension was also significantly lower in group A (15,2% than group B (23,9%, p value = 0,014 (p < 0,05. Leg elevation maneuver 45º significantly decrease incidence of hypotension after propofol induction. Keywords: Propofol, hypotension, leg elevation

  3. Final results of the EDELWEISS-II WIMP search using a 4-kg array of cryogenic germanium detectors with interleaved electrodes

    International Nuclear Information System (INIS)

    Armengaud, E.; Augier, C.; Benoit, A.; Berge, L.; Bluemer, J.; Broniatowski, A.; Brudanin, V.; Censier, B.; Chardin, G.; Chapellier, M.; Charlieux, F.; Coulter, P.; Cox, G.A.; Defay, X.; De Jesus, M.; Dolgorouki, Y.; Domange, J.; Dumoulin, L.

    2011-01-01

    The EDELWEISS-II Collaboration has completed a direct search for WIMP dark matter with an array of ten 400-g cryogenic germanium detectors in operation at the Laboratoire Souterrain de Modane. The combined use of thermal phonon sensors and charge collection electrodes with an interleaved geometry enables the efficient rejection of γ-induced radioactivity as well as near-surface interactions. A total effective exposure of 384 kg d has been achieved, mostly coming from fourteen months of continuous operation. Five nuclear recoil candidates are observed above 20 keV, while the estimated background is 3.0 events. The result is interpreted in terms of limits on the cross-section of spin-independent interactions of WIMPs and nucleons. A cross-section of 4.4x10 -8 pb is excluded at 90%CL for a WIMP mass of 85 GeV. New constraints are also set on models where the WIMP-nucleon scattering is inelastic.

  4. Research, development and demonstration of lead-acid batteries for electric vehicle propulsion. Annual report, 1979. [165 Ah, 36. 5 Wh/kg

    Energy Technology Data Exchange (ETDEWEB)

    Bodamer, G.W.; Branca, G.C.; Cash, H.R.; Chrastina, J.R.; Yurick, E.M.

    1980-06-01

    Progress during the 1979 fiscal year is reported. All the tooling and capital equipment required for the pilot line production has been installed. A limited amount of plate production has been realized. A highly automated and versatile testing facility was established. The fabrication and testing of the initial calculated design is discussed. Cell component adjustments and the trade-offs associated with those changes are presented. Cells are being evaluated at the 3-hour rate. They have a capacity of 165 Ah and an energy density of 36.5 Wh/kg, and have completed 105 cycles to date. Experimental results being pursued under the advanced battery development program to enhance energy density and cycle life are presented. Data on the effects of different electrolyte specific gravity, separators, retainers, paste densities, battery additives and grid alloy composition on battery performance are presented and evaluated. Advanced battery prototype cells are under construction. Quality Assurance activities are summarized. They include monitoring the cell and battery fabrication and testing operations as well as all relevant documentation procedures. 12 figures, 28 tables.

  5. Behavior to the fracture of an AISI 304 stainless steel sensitized in BWR reactor conditions (288 degrees Centigrade and 80 Kg/cm2)

    International Nuclear Information System (INIS)

    Hernandez C, R.; Diaz S, A.; Garcia R, R.; Aguilar T, A.; Gachuz M, M.; Arganis J, C.; Merino C, J.

    1999-01-01

    It is a knew fact that ductility of a lot of structural alloys can be deteriorated by the environment effect which are exposed, and that their consequent embrittlement can put in doubt the safety of their functioning; such is the case of austenitic stainless steels used in internal components of the BWR type reactors which not only is subjected to the effect combined of the aggressive environment which surround it (pressure, temperature, corrosion potential, conductivity medium, local state of efforts, etc.), but also to the action of present neutron radiation, manifesting microstructural changes which are reflected in the augmentation of its susceptibility to the intergranular cracking, phenomena generally known as IASCC ''Irradiation Assisted Stress Corrosion Cracking''. Once appeared the cracking in the material, the useful life of a component is limited by the rapidity to growth of these cracking, making necessary evaluations which can to predict its behavior, therefore the present work shows the preliminary results for determining the behavior to the fracture of an AISI 304 stainless steel sensitized, in a dynamic recirculation circuit which allows to simulate the operation conditions of a BWR reactor (288 Centigrade and 80 kg/cm 2 ). (Author)

  6. Protonation thermodynamics of some aminophenol derivatives in NaCl{sub (aq)} (0 {<=} I {<=}3 mol . kg{sup -1}) at T = 298.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Bretti, Clemente; De Stefano, Concetta; Foti, Claudia [Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Universita di Messina, Viale F. Stagno d' Alcontres, 31, I-98166 Messina (Vill. S. Agata) (Italy); Sammartano, Silvio, E-mail: ssammartano@unime.it [Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Universita di Messina, Viale F. Stagno d' Alcontres, 31, I-98166 Messina (Vill. S. Agata) (Italy); Vianelli, Giuseppina [Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Universita di Messina, Viale F. Stagno d' Alcontres, 31, I-98166 Messina (Vill. S. Agata) (Italy)

    2012-01-15

    Highlights: > Protonation thermodynamics of four aminophenol derivatives were determined. > Dependence on ionic strength was analysed by using different models. > Neutral species activity coefficient was determined by distribution measurements. > Acid-base behaviour of this ligand class was modelled. - Abstract: The acid-base properties of four aminophenol derivatives, namely m-aminophenol (L1), 4-amino-2-hydroxytoluene (L2), 2-amino-5-ethylphenol (L3) and 5-amino-4-chloro-o-cresol (L4), are studied by potentiometric and titration calorimetric measurements in NaCl{sub (aq)} (0 {<=} I {<=} 3 mol . kg{sup -1}) at T = 298.15 K. The dependence of the protonation constants on ionic strength is modelled by the Debye-Hueckel, SIT (Specific ion Interaction Theory) and Pitzer equations. Therefore, the values of protonation constants at infinite dilution and the relative interaction coefficients are calculated. The dependence of protonation enthalpies on ionic strength is also determined. Distribution (2-methyl-1-propanol/aqueous solution) measurements allowed us to determine the Setschenow coefficients and the activity coefficients of neutral species. Experimental results show that these compounds behave in a very similar way, and common class parameters are reported, in particular for the dependence on ionic strength of both protonation constants and protonation enthalpies.

  7. Improvement of producer gas of Palm Oil Empty Fruit Bunch in a 50 kg/ hr prototype down draft gasifier by palletization

    International Nuclear Information System (INIS)

    Kerdsuwan, Somrat; Cherdphong, Somphot; Uthaikiattikul, Tada

    2010-01-01

    The main residue from palm oil industry is Palm Oil Empty Fruit Bunch (PEFB) which was considered as null-waste, can be rethinking and used as renewable or alternative fuel, since there is still hiding energy storage within. The proper technology for converting PEFB to renewable energy carrier is gasification technology. The gasification process of PEFB with and without feedstock preparation was investigated and compared in order to improve the efficiency of gasification process by pelletizing PEFB and to characterize the gasification reaction of pelletized PEFB. As received PEFB is solar dried and pelletized in a cylindrical form. The proximate and ultimate analysis of pelletized PEFB is investigated. Thereafter, the gasification process of as-received PEFB and pelletized PEFB was carried out in a 50 kg/ hr prototype down draft gasifier with varying the operating conditions, to characterize the gasification behavior of pelletized PEFB. From the experiments, the feedstock preparation, in this case pelletizing, can improve the performance of PEFB gasification. The results of experiment reveals that the heating value of producer gas and cold gas efficiency increases from 5.18 MJ/ Nm 3 for PEFB gasification without preparation to 6.5 MJ/ Nm 3 with feedstock preparation and from 61.72% to 79.73% respectively. (author)

  8. Metal impurities profile in a 450kg multi-crystalline silicon ingot by Cold Neutron Prompt Gamma-ray Activation Analysis

    International Nuclear Information System (INIS)

    Baek, Hani; Sun, Gwang Min; Kim, Ji seok; Oh, Mok; Chung, Yong Sam; Moon, Jong Hwa; Kim, Sun Ha; Baek, Sung Yeol; Tuan, Hoang Sy Minh

    2014-01-01

    Metal impurities are harmful to multi-crystalline silicon solar cells. They reduce solar cell conversion efficiencies through increased carrier recombination. They are present as isolated point-like impurities or precipitates. This work is to study the concentration profiles of some metal impurities of the directionally solidified 450kg multi-crystalline silicon ingot grown for solar cell production. The concentration of such impurities are generally below 10 15 cm -3 , and as such cannot be detected by physical techniques such as secondary-ion-mass spectroscopy(SIMS). So, we have tried to apply Cold Neutron - Prompt Gamma ray Activation Analysis(CN-PGAA) at the HANARO reactor research. The impurity concentrations of Au, Mn, Pt, Mo of a photovoltaic grade multi-crystalline silicon ingot appear by segregation from the liquid to the solid phase in the central region of the ingot during the crystallization. In the impurities concentration of the bottom region is higher than middle region due to the solid state diffusion. Towards the top region the segregation impurities diffused, during cooling process

  9. Development of a lead acid battery suitable for electric vehicle propulsion. Final report. [96 V, 20 kWh, 50 Wh/kg

    Energy Technology Data Exchange (ETDEWEB)

    Schlotter, W J

    1977-08-26

    This report contains two detailed designs, and the design rationale, for an improved state-of-the-art electric vehicle battery incorporating expanded metal grids. The nominal 96-volt and 20-kWh battery incorporating this improved design is expected to cost about 25% less when manufactured in a mature plant. This report also contains detailed estimates for the capital cost and operating cost of a pilot plant to produce electric vehicle battery plates incorporating expanded metal grids. It is expected that the first electric vehicle batteries incorporating expanded metal grids can be available fifteen months after approval of this program. An additional program to improve lead acid batteries for electric vehicles further is also described. The advanced batteries resulting from this program are expected to incorporate either expanded metal grids and/or composite lead/plastic grids. In addition, these batteries are expected to contain low-density active materials. It is anticipated that those additional developments will result in an advanced battery capable of delivering 45 to 50 watt-hours/kg. As a result of the design and cost study, a ''First Buy'' improved state-of-the art vehicle battery proposed is included as part of this report. Eltra proposes to manufacture and deliver the required 2500 vehicle batteries within the time limits set forth by the Electric and Hybrid Vehicle Research, Development, and Demonstration Act of 1976. 20 figures, 13 tables.

  10. Protonation thermodynamics of some aminophenol derivatives in NaCl(aq) (0 ≤ I ≤3 mol . kg-1) at T = 298.15 K

    International Nuclear Information System (INIS)

    Bretti, Clemente; De Stefano, Concetta; Foti, Claudia; Sammartano, Silvio; Vianelli, Giuseppina

    2012-01-01

    Highlights: → Protonation thermodynamics of four aminophenol derivatives were determined. → Dependence on ionic strength was analysed by using different models. → Neutral species activity coefficient was determined by distribution measurements. → Acid-base behaviour of this ligand class was modelled. - Abstract: The acid-base properties of four aminophenol derivatives, namely m-aminophenol (L1), 4-amino-2-hydroxytoluene (L2), 2-amino-5-ethylphenol (L3) and 5-amino-4-chloro-o-cresol (L4), are studied by potentiometric and titration calorimetric measurements in NaCl (aq) (0 ≤ I ≤ 3 mol . kg -1 ) at T = 298.15 K. The dependence of the protonation constants on ionic strength is modelled by the Debye-Hueckel, SIT (Specific ion Interaction Theory) and Pitzer equations. Therefore, the values of protonation constants at infinite dilution and the relative interaction coefficients are calculated. The dependence of protonation enthalpies on ionic strength is also determined. Distribution (2-methyl-1-propanol/aqueous solution) measurements allowed us to determine the Setschenow coefficients and the activity coefficients of neutral species. Experimental results show that these compounds behave in a very similar way, and common class parameters are reported, in particular for the dependence on ionic strength of both protonation constants and protonation enthalpies.

  11. Electrolytic reduction runs of 0.6 kg scale-simulated oxide fuel in a Li2O-LiCl molten salt using metal anode shrouds

    Science.gov (United States)

    Choi, Eun-Young; Lee, Jeong; Heo, Dong Hyun; Lee, Sang Kwon; Jeon, Min Ku; Hong, Sun Seok; Kim, Sung-Wook; Kang, Hyun Woo; Jeon, Sang-Chae; Hur, Jin-Mok

    2017-06-01

    Ten electrolytic reduction or oxide reduction (OR) runs of a 0.6 kg scale-simulated oxide fuel in a Li2O-LiCl molten salt at 650 °C were conducted using metal anode shrouds. During this procedure, an anode shroud surrounds a platinum anode and discharges hot oxygen gas from the salt to outside of the OR apparatus, thereby preventing corrosion of the apparatus. In this study, a number of anode shrouds made of various metals were tested. Each metallic anode shroud consisted of a lower porous shroud for the salt phase and an upper nonporous shroud for the gas phase. A stainless steel (STS) wire mesh with five-ply layer was a material commonly used for the lower porous shroud for the OR runs. The metals tested for the upper nonporous shroud in the different OR runs are STS, nickel, and platinum- or silver-lined nickel. The lower porous shroud showed no significant damage during two consecutive OR runs, but exhibited signs of damage from three or more runs due to thermal stress. The upper nonporous shrouds made up of either platinum- or silver-lined nickel showed excellent corrosion resistance to hot oxygen gas while STS or nickel without any platinum or silver lining exhibited poor corrosion resistance.

  12. Pharmacokinetic and pharmacodynamic evaluations of a 10 mg/kg enrofloxacin intramuscular administration in bearded dragons (Pogona vitticeps): a preliminary assessment.

    Science.gov (United States)

    Salvadori, M; Vercelli, C; De Vito, V; Dezzutto, D; Bergagna, S; Re, G; Giorgi, M

    2017-01-01

    Enrofloxacin (E) is commonly used in veterinary medicine. It is necessary to perform pharmacokinetic/dynamic studies to minimize the selection of resistant mutants of bacteria and extend the efficacy of antimicrobial agents. Eight healthy adult Pogona vitticeps were assigned into two groups of equal size and treated with a single intramuscular injection of E at 10 mg/kg. Blood samples were withdrawn at different scheduled times for each group, and rectal swabs were collected. E and ciprofloxacin (active metabolite) blood concentrations were quantified by an HPLC validated method, while the in vitro antimicrobial susceptibility was evaluated by the Kirby-Bauer disc diffusion susceptibility test. The pharmacokinetic profiles of E gave similar pharmacokinetic parameters irrespective of the collection time schedule. Bacteria isolation showed the presence of both E. coli, Salmonella enterica subspecies enterica and subspecies 3a, Proteus spp., and Pseudomonas spp. The majority of isolated colonies were sensitive to E, but the treatment did not reduce the number of bacteria in faeces. Results suggest that E is able to reach blood concentrations high enough to kill susceptible bacteria (MIC < 0.9 μg/mL), but at the same time does not significantly affect intestinal bacteria. © 2016 John Wiley & Sons Ltd.

  13. Review of interventional procedures in the very low birth-weight infant (<1.5 kg): complications, lessons learned and current practice

    Energy Technology Data Exchange (ETDEWEB)

    Laffan, Eoghan E. [Children' s Hospital of Eastern Ontario, Department of Diagnostic Imaging, Ottawa, ON (Canada); McNamara, Patrick J.; Whyte, Hilary; L' Herault, Johanne [The Hospital for Sick Children, Division of Neonatology, Toronto, ON (Canada); Amaral, Joao; Temple, Michael; John, Philip; Connolly, Bairbre L. [The Hospital for Sick Children, The Image-Guided Therapy Unit, Toronto, ON (Canada)

    2009-08-15

    Interventional radiology (IR) procedures in very low birth-weight (VLBW) infants (<1.5 kg) are challenging due to size, immaturity, comorbidities and lack of devices of suitable size. Infants are moved from the neonatal intensive care unit to the IR suite, further exposing them to risk. Our purpose was to review our experience of interventional procedures in VLBW infants, specifically complications and potential risks. VLBW infants referred for image-guided therapy between 1998 and 2005 were identified and medical records reviewed. ''Complications'' were divided into: major or minor, periprocedural or postprocedural, and intervention-/device-related, patient-related or equipment-related. Transport risk index of physiological stability (TRIPS) scores were calculated. A total of 116 infants (68 male, 48 female) underwent 176 procedures (159 vascular access-related and 17 nonvascular). Of 158 complications identified, 116 were major and 42 were minor. Major complications included hypothermia (n=33), line manipulations/removals (n=25), bleeding (n=12), thrombosis (n=4), cardiac arrest (n=3), tamponade (n=2), and multiorgan failure (n=1). Of the complications, 119 were categorized as intervention-/device-related, 32 patient-related and 7 equipment-related. There were no significant differences between pre- and postprocedural TRIPS scores. Successful completion of IR procedures in the VLBW infant is possible, but complications still occur in these fragile infants. (orig.)

  14. Limits on light WIMPs with a 1 kg-scale germanium detector at 160 eVee physics threshold at the China Jinping Underground Laboratory

    Science.gov (United States)

    Yang, Li-Tao; Li, Hau-Bin; Yue, Qian; Kang, Ke-Jun; Cheng, Jian-Ping; Li, Yuan-Jing; Tsz-King Wong, Henry; Aǧartioǧlu, M.; An, Hai-Peng; Chang, Jian-Ping; Chen, Jing-Han; Chen, Yun-Hua; Deng, Zhi; Du, Qiang; Gong, Hui; He, Li; Hu, Jin-Wei; Hu, Qing-Dong; Huang, Han-Xiong; Jia, Li-Ping; Jiang, Hao; Li, Hong; Li, Jian-Min; Li, Jin; Li, Xia; Li, Xue-Qian; Li, Yu-Lan; Lin, Fong-Kay; Lin, Shin-Ted; Liu, Shu-Kui; Liu, Zhong-Zhi; Ma, Hao; Ma, Jing-Lu; Pan, Hui; Ren, Jie; Ruan, Xi-Chao; Sevda, B.; Sharma, Vivek; Shen, Man-Bin; Singh, Lakhwinder; Singh, Manoj Kumar; Tang, Chang-Jian; Tang, Wei-You; Tian, Yang; Wang, Ji-Min; Wang, Li; Wang, Qing; Wang, Yi; Wu, Shi-Yong; Wu, Yu-Cheng; Xing, Hao-Yang; Xu, Yin; Xue, Tao; Yang, Song-Wei; Yi, Nan; Yu, Chun-Xu; Yu, Hai-Jun; Yue, Jian-Feng; Zeng, Xiong-Hui; Zeng, Ming; Zeng, Zhi; Zhang, Yun-Hua; Zhao, Ming-Gang; Zhao, Wei; Zhou, Ji-Fang; Zhou, Zu-Ying; Zhu, Jing-Jun; Zhu, Zhong-Hua; CDEX Collaboration

    2018-01-01

    We report results of a search for light weakly interacting massive particle (WIMP) dark matter from the CDEX-1 experiment at the China Jinping Underground Laboratory (CJPL). Constraints on WIMP-nucleon spin-independent (SI) and spin-dependent (SD) couplings are derived with a physics threshold of 160 eVee, from an exposure of 737.1 kg-days. The SI and SD limits extend the lower reach of light WIMPs to 2 GeV and improve over our earlier bounds at WIMP mass less than 6 GeV. Supported by the National Key Research and Development Program of China (2017YFA0402200, 2017YFA0402201), the National Natural Science Foundation of China (11175099, 11275107, 11475117, 11475099, 11475092, 11675088), the National Basic Research Program of China (973 Program) (2010CB833006). We thank the support of grants from the Tsinghua University Initiative Scientific Research Program (20121088494, 20151080354) and the Academia Sinica Investigator Award 2011-15, contracts 103-2112-M-001-024 and 104-2112-M-001-038-MY3 from the Ministry of Science and Technology of Taiwan.

  15. Test Results of a 1.2 kg/s Centrifugal Liquid Helium Pump for the ATLAS Superconducting Toroid Magnet System

    CERN Document Server

    Pengo, R; Passardi, Giorgio; Pirotte, O; ten Kate, H H J

    2002-01-01

    The toroid superconducting magnet of ATLAS-LHC experiment at CERN will be indirectly cooled by means of forced flow of liquid helium at about 4.5 K. A centrifugal pump will be used, providing a mass flow of 1.2 kg/s and a differential pressure of 40 kPa (ca. 400 mbar) at about 4300 rpm. Two pumps are foreseen, one for redundancy, in order to feed in parallel the cooling circuits of the Barrel and the two End-Caps toroid magnets. The paper describes the tests carried out at CERN to measure the characteristic curves, i.e. the head versus the mass flow at different rotational speeds, as well as the pump total efficiency. The pump is of the "fullemission" type, i.e. with curved blades and it is equipped with an exchangeable inducer. A dedicated pump test facility has been constructed at CERN, which includes a Coriolis-type liquid helium mass flow meter. This facility is connected to the helium refrigerator used for the tests at CERN of the racetrack magnets of the Barrel and of the End-Cap toroids.

  16. Comparison of Efficacy and Safety of Liraglutide 3.0 mg in Individuals with BMI above and below 35 kg/m²: A Post-hoc Analysis.

    Science.gov (United States)

    le Roux, Carel; Aroda, Vanita; Hemmingsson, Joanna; Cancino, Ana Paula; Christensen, Rune; Pi-Sunyer, Xavier

    2017-01-01

    To investigate whether the efficacy and safety of liraglutide 3.0 mg differed between two subgroups, BMI 27 to 3.0 mg were evaluated by testing the interaction between treatment group and baseline BMI subgroup. Significantly greater weight loss (0-56 weeks) was observed with liraglutide 3.0 mg versus placebo in all patient groups while on treatment. There was no evidence that the weight-lowering effect of liraglutide 3.0 mg differed between BMI subgroups (interaction p > 0.05). Similarly, for most secondary endpoints significantly greater improvements were observed with liraglutide 3.0 mg versus placebo, with no indication treatment effects differing between subgroups. The safety profile of liraglutide 3.0 mg was broadly similar across BMI subgroups. This post-hoc analysis did not indicate any differences in the treatment effects, or safety profile, of liraglutide 3.0 mg for individuals with BMI 27 to 3.0 mg can therefore be considered for individuals with a BMI of ≥35 as well as for those with a BMI of 27 to <35 kg/m². © 2017 The Author(s) Published by S. Karger GmbH, Freiburg.

  17. Comparison of Efficacy and Safety of Liraglutide 3.0 mg in Individuals with BMI above and below 35 kg/m²: A Post-hoc Analysis

    Science.gov (United States)

    le Roux, Carel; Aroda, Vanita; Hemmingsson, Joanna; Cancino, Ana Paula; Christensen, Rune; Pi-Sunyer, Xavier

    2018-01-01

    Objective To investigate whether the efficacy and safety of liraglutide 3.0 mg differed between two subgroups, BMI 27 to 3.0 mg were evaluated by testing the interaction between treatment group and baseline BMI subgroup. Results Significantly greater weight loss (0–56 weeks) was observed with liraglutide 3.0 mg versus placebo in all patient groups while on treatment. There was no evidence that the weight-lowering effect of liraglutide 3.0 mg differed between BMI subgroups (interaction p > 0.05). Similarly, for most secondary endpoints significantly greater improvements were observed with liraglutide 3.0 mg versus placebo, with no indication treatment effects differing between subgroups. The safety profile of liraglutide 3.0 mg was broadly similar across BMI subgroups. Conclusion This post-hoc analysis did not indicate any differences in the treatment effects, or safety profile, of liraglutide 3.0 mg for individuals with BMI 27 to 3.0 mg can therefore be considered for individuals with a BMI of ≥35 as well as for those with a BMI of 27 to <35 kg/m². PMID:29145215

  18. Silla bipedestadora para personas con movilidad restringida grado iv en las extremidades inferiores con una capacidad de carga de 100kg

    Directory of Open Access Journals (Sweden)

    Fabio Eduardo Obando-Herrera

    2017-07-01

    Full Text Available This paper describes the design and construction process of a wheelchair capable of allowing standing position to patients with grade IV disability in lower limbs, up to 100 kg weight, located in the Conocoto parish - Quito, Ecuador, the P 95 percentiles of the anthropometric measurements of the patients of the center. Using Autodesk Force Effect software, the patient’s movement was simulated by moving from sitting to standing, and thus controlling relative positions of lower limbs and trunk, in a range of motion from 15 ° to 75 °, and having a database for the selection of the drive system in the chair. Through a static analysis of loads on the patient’s body, critical design loads were assigned to critical chair members, which were tested through stress analysis with Autodesk Inventor V15 software. We also present the tests and evaluation supervised by 10 physical therapists professionals, through in situ tests with patients of CRIE N ° 1 and with a survey to the physical therapist professionals

  19. Three-dimensional contrast-enhanced magnetic-resonance angiography of the renal arteries: Interindividual comparison of 0.2 mmol/kg gadobutrol at 1.5 T and 0.1 mmol/kg gadobenate dimeglumine at 3.0 T

    International Nuclear Information System (INIS)

    Attenberger, Ulrike I.; Wintersperger, Bernd J.; Sourbron, Steven P.; Reiser, Maximilian F.; Michaely, Henrik J.; Schoenberg, Stefan O.; Lodemann, Klaus-Peter

    2008-01-01

    The purpose was to evaluate the image quality of high-spatial resolution MRA of the renal arteries at 1.5 T after contrast-agent injection of 0.2 mmol/kg body weight (BW) in an interindividual comparison to 3.0 T after contrast-agent injection of 0.1 mmol/kg BW contrast agent (CA). After IRB approval and informed consent, 40 consecutive patients (25 men, 15 women; mean age 53.9 years) underwent MRA of the renal arteries either at a 1.5-T MR system with 0.2 mmol/kg BW gadobutrol or at a 3.0-T MR scanner with 0.1 mmol/kg BW gadobenate dimeglumine used as CA in a randomized order. A constant volume of 15 ml of these contrast agents was applied. The spatial resolution of the MRA sequences was 1.0 x 0.8 x 1.0 mm 3 at 1.5 T and 0.9 x 0.8 x 0.9 mm 3 at 3.0 T, which was achieved by using parallel imaging acceleration factors of 2 at 1.5 T and 3 at 3.0 T, respectively. Two radiologists blinded to the administered CA and the field strength assessed the image quality and the venous overlay for the aorta, the proximal and distal renal arteries independently on a four-point Likert-type scale. Phantom measurements were performed for a standardized comparison of SNR at 1.5 T and 3.0 T. There was no significant difference (p > 0.05) between the image quality at 3.0 T with 0.1 mmol/kg BW gadobenate dimeglumine compared to the exams at 1.5 T with 0.2 mmol/kg BW gadobutrol. The median scores were between 3 and 4 (good to excellent vessel visualization) for the aorta (3 at 1.5 T/4 at 3.0 T for reader 1 and 2). For the proximal renal arteries, median scores were 3 for the left and right renal artery at 1.5 T for both readers. At 3.0 T, median scores were 3 (left proximal renal artery) and 4 (right proximal renal artery) for reader 1 and 3 (left/right) for reader 2 at 3.0 T. For the distal renal arteries, median scores were between 2 and 3 at both field strengths (moderate and good) for both readers. The κ values for both field strengths were comparable and ranged between 0

  20. Three-dimensional contrast-enhanced magnetic-resonance angiography of the renal arteries: Interindividual comparison of 0.2 mmol/kg gadobutrol at 1.5 T and 0.1 mmol/kg gadobenate dimeglumine at 3.0 T

    Energy Technology Data Exchange (ETDEWEB)

    Attenberger, Ulrike I.; Wintersperger, Bernd J.; Sourbron, Steven P.; Reiser, Maximilian F. [University Hospitals-Grosshadern, Ludwig-Maximilians-University Munich, Institute of Clinical Radiology, Munich (Germany); Michaely, Henrik J.; Schoenberg, Stefan O. [University Hospital Mannheim, University of Heidelberg, Institute of Clinical Radiology, Mannheim (Germany); Lodemann, Klaus-Peter [Bracco-Altana Pharma, Konstanz (Germany)

    2008-06-15

    The purpose was to evaluate the image quality of high-spatial resolution MRA of the renal arteries at 1.5 T after contrast-agent injection of 0.2 mmol/kg body weight (BW) in an interindividual comparison to 3.0 T after contrast-agent injection of 0.1 mmol/kg BW contrast agent (CA). After IRB approval and informed consent, 40 consecutive patients (25 men, 15 women; mean age 53.9 years) underwent MRA of the renal arteries either at a 1.5-T MR system with 0.2 mmol/kg BW gadobutrol or at a 3.0-T MR scanner with 0.1 mmol/kg BW gadobenate dimeglumine used as CA in a randomized order. A constant volume of 15 ml of these contrast agents was applied. The spatial resolution of the MRA sequences was 1.0 x 0.8 x 1.0 mm{sup 3} at 1.5 T and 0.9 x 0.8 x 0.9 mm{sup 3} at 3.0 T, which was achieved by using parallel imaging acceleration factors of 2 at 1.5 T and 3 at 3.0 T, respectively. Two radiologists blinded to the administered CA and the field strength assessed the image quality and the venous overlay for the aorta, the proximal and distal renal arteries independently on a four-point Likert-type scale. Phantom measurements were performed for a standardized comparison of SNR at 1.5 T and 3.0 T. There was no significant difference (p > 0.05) between the image quality at 3.0 T with 0.1 mmol/kg BW gadobenate dimeglumine compared to the exams at 1.5 T with 0.2 mmol/kg BW gadobutrol. The median scores were between 3 and 4 (good to excellent vessel visualization) for the aorta (3 at 1.5 T/4 at 3.0 T for reader 1 and 2). For the proximal renal arteries, median scores were 3 for the left and right renal artery at 1.5 T for both readers. At 3.0 T, median scores were 3 (left proximal renal artery) and 4 (right proximal renal artery) for reader 1 and 3 (left/right) for reader 2 at 3.0 T. For the distal renal arteries, median scores were between 2 and 3 at both field strengths (moderate and good) for both readers. The {kappa} values for both field strengths were comparable and ranged

  1. Desempenho de cordeiros inteiros ou submetidos a diferentes métodos de castração abatidos aos 30 kg de peso vivo Performance of intact or submitted to different methods of castration lambs slaughtered at 30 kg of live weight

    Directory of Open Access Journals (Sweden)

    Edson Luis de Azambuja Ribeiro

    2003-06-01

    Full Text Available Foram utilizados neste experimento 31 cordeiros cruzados Hampshire Down, Ile de France e Suffolk, distribuídos em quatro tratamentos: inteiros ou castrados com burdizzo, borracha ou faca. A castração ocorreu aos 58 dias de idade. Após o desmame, aos 84 dias, os animais foram confinados até atingirem o peso vivo de 30 a 32 kg, quando abatidos. Não houve diferença significativa entre os tratamentos e entre os grupos genéticos para os pesos ao nascimento, desmame e abate, para o ganho de peso médio diário do nascimento ao abate e para a idade ao abate. As médias para os ganhos de peso foram 0,179; 0,177; 0,170 e 0,147 kg e para a idade ao abate de 152,0; 156,0; 161,5 e 188,9 dias para os cordeiros inteiros, castrados com burdizzo, com borracha e com faca, respectivamente. Os cordeiros Hampshire Down, Ile de France e Suffolk ganharam, respectivamente, 0,176; 0,163 e 0,166 kg diariamente. Os animais inteiros apresentaram menores rendimentos verdadeiros de carcaça quente ou fria; não havendo outras diferenças importantes entre os tratamentos para as demais características de carcaça estudadas. Os cordeiros Hampshire Down apresentaram maiores rendimentos de carcaça fria, enquanto os Suffolk tiveram menores rendimentos verdadeiros de carcaça e menor percentagem de pescoço, e os Ile de France apresentaram as carcaças mais curtas. O peso ao nascimento teve efeito significativo sobre o ganho de peso e a idade ao abate dos cordeiros. Os resultados mostraram não haver diferenças no desempenho de cordeiros inteiros ou castrados por diferentes métodos abatidos entre 30 e 32 kg de peso vivo, e que pode ocorrer diferenças entre animais de diferentes grupos genéticos quando abatidos com peso semelhante.Thirty-one Hampshire Down, Ile de France and Suffolk crossbred lambs divided into four treatments: intact, castrated with burdizzo, with rubber bands and with knife, were used in this experiment. Castration occurred at 58 days of age. After

  2. Unconscious collusion: An interpretative phenomenological analysis of the maternity care experiences of women with obesity (BMI≥30kg/m²).

    Science.gov (United States)

    Atkinson, Sandra; McNamara, Patricia Mannix

    2017-06-01

    obstetric and midwifery literature continually emphasise incidence and consequence of obesity in pregnancy. However, they offer less consensus on how best to support women who are obese. Therefore, this study explores in depth the lived experience of women who have a Body Mass Index (BMI) ≥30kg/m². This exploration provides a bio-psycho-social understanding of the lived experience of women to identify how best to support them throughout their childbirth experience. an Interpretative Phenomenological Analysis (IPA) design was adopted for this qualitative study. Purposive sampling of participants was conducted on the postnatal wards of a maternity hospital in the Republic of Ireland. In total, 15 participants volunteered to take part in semi-structured interviews conducted at six to ten weeks postnatally. Data were analysed utilising the IPA framework. the results indicate that participants were conscious of the problematics of communicating obesity in pregnancy. The narrative data revealed an unconscious collusion between healthcare professionals and women as they navigate obesity related conversations. The behaviours related to unconscious collusion are incorporated in the sub-ordinate themes; 'just recorded and that's all', 'but what's eating healthy? 'pussy footing around' and 'I hate that word obesity. the findings highlight a lack of information received by participants from healthcare professionals regarding increased BMI or weight management. The data suggests that healthcare professionals appeared to collude with women to avoid challenging discussions regarding obesity. This may be related to avoidance on participants' part and/or may be linked with healthcare professionals' reluctance to communicate issues relating to increased BMI. Although participants were generally unhappy with the communication skills of health professionals, they readily acknowledged the sensitive nature of obesity related communications. The findings provide healthcare

  3. Thoracic epidural analgesia in obese patients with body mass index of more than 30 kg/m 2 for off pump coronary artery bypass surgery

    Directory of Open Access Journals (Sweden)

    Sharma Munish

    2010-01-01

    Full Text Available Perioperative Thoracic epidural analgesia (TEA is an important part of a multimodal approach to improve analgesia and patient outcome after cardiac and thoracic surgery. This is particularly important for obese patients undergoing off pump coronary artery bypass surgery (OPCAB. We conducted a randomized clinical trial at tertiary care cardiac institute to compare the effect of TEA and conventional opioid based analgesia on perioperative lung functions and pain scores in obese patients undergoing OPCAB. Sixty obese patients with body mass index> 30 kg/m 2 for elective OPCAB were randomized into two groups (n=30 each. Patients in both the groups received general anesthesia but in group 1, TEA was also administered. We performed spirometry as preoperative assessment and at six hours, 24 hours, second, third, fourth and fifth day after extubation, along with arterial blood gases analysis. Visual analogue scale at rest and on coughing was recorded to assess the degree of analgesia. The other parameters observed were: time to endotracheal extubation, oxygen withdrawal time and intensive care unit length of stay. On statistical analysis there was a significant difference in Vital Capacity at six hours, 24 hours, second and third day postextubation. Forced vital capacity and forced expiratory volume in one second followed the same pattern for first four postoperative days and peak expiratory flow rate remained statistically high till second postoperative day. ABG values and PaO 2 /FiO 2 ratio were statistically higher in the study group up to five days. Visual analogue scale at rest and on coughing was significantly lower till fourth and third postoperative day respectively. Tracheal extubation time, oxygen withdrawal time and ICU stay were significantly less in group 1. The use of TEA resulted in better analgesia, early tracheal extubation and shorter ICU stay and should be considered for obese patients undergoing OPCAB.

  4. Abundance, Distribution and Estimated Consumption (kg fish) of Piscivorous Birds Along the Yakima River, Washington State; Implications for Fisheries Management, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Major, III, Walter; Grassley, James M.; Ryding, Kristen E. (University of Washington, Quantitive Ecology Program, Seattle, WA)

    2003-05-01

    This report is divided into two chapters. The abstract for chapter one is--Understanding of the abundance and spatial and temporal distributions of piscivorous birds and their potential consumption of fish is an increasingly important aspect of fisheries management. During 1999-2002, we determined the abundance and distribution and estimated the maximum consumption (kg biomass) of fish-eating birds along the length of the Yakima River in Washington State. Sixteen different species were observed during the 4-yr study, but only half of those were observed during all years. Abundance and estimated consumption of fish within the upper and middle sections of the river were dominated by common mergansers (Mergus merganser) which are known to breed in those reaches. Common mergansers accounted for 78 to 94% of the estimated total fish take for the upper river or approximately 28,383 {+-} 1,041 kg over the 4 yrs. A greater diversity of avian piscivores occurred in the lower river and potential impacts to fish populations was more evenly distributed among the species. In 1999-2000, great blue herons potentially accounted for 29 and 36% of the fish consumed, whereas in 2001-2002 American white pelicans accounted for 53 and 55%. We estimated that approximately 75,878 {+-} 6,616 kg of fish were consumed by piscivorous birds in the lower sections of the river during the study. Bird assemblages differed spatially along the river with a greater abundance of colonial nesting species within the lower sections of the river, especially during spring and the nesting season. The abundance of avian piscivores and consumption estimates are discussed within the context of salmonid supplementation efforts on the river and juvenile out-migration. The abstract for chapter two is--Consumption of fish by piscivorous birds may be a significant constraint on efforts to enhance salmonid populations within tributaries to the Columbia River in Washington State. During 1999-2002, we determined the

  5. Exigência de metionina + cistina digestíveis para suínos machos castrados mantidos em ambiente termoneutro dos 30 aos 60 kg Digestible methionine + cystine requirement for barrows maintained in thermoneutral environment from 30 to 60 kg

    Directory of Open Access Journals (Sweden)

    Charles Kiefer

    2005-06-01

    Full Text Available Foram utilizados 50 suínos dos 29,97 ± 0,36 kg aos 60,38 ± 0,49 kg, para determinar a exigência de metionina + cistina digestíveis. Utilizou-se o delineamento experimental de blocos ao acaso, composto por cinco níveis de metionina + cistina digestíveis (0,448; 0,490; 0,531; 0,573 e 0,614%, cinco repetições e dois animais por unidade experimental. Os tratamentos influenciaram o ganho de peso diário e a conversão alimentar, que variaram de forma quadrática, sendo o nível de metionina + cistina digestíveis estimado em 0,549% para máximo ganho de peso e melhor conversão alimentar. Não se observou efeito dos tratamentos sobre o consumo de ração. O consumo de metionina + cistina digestíveis elevou de forma linear com o aumento dos níveis de metionina + cistina digestíveis na dieta. Verificou-se efeito quadrático dos tratamentos sobre as deposições diárias de proteína e de gordura na carcaça, que aumentaram até os níveis de metionina + cistina digestíveis estimados de 0,548 e 0,547%, respectivamente. Concluiu-se que a exigência de metionina + cistina digestíveis para suínos machos castrados, mantidos em ambiente termoneutro dos 30 aos 60 kg, é de 0,549%, correspondente à relação metionina + cistina digestíveis:lisina digestível de 66%.Fifty barrows from 29.97 ± 0.36 kg to 60.38 ± 0.49 kg were used to evaluate the requirement of digestible methionine + cystine. A completely randomized blocks design, with five digestible methionine + cystine levels (0.448; 0.490; 0.531; 0.573 and 0.614%, with five replicates and two animals per experimental unity, was used. The digestible methionine + cystine levels of the diet influenced in a quadratic way the average daily gain and the feed:gain being the level of digestible methionine + cystine estimated in 0.549% for the maximum weight gain and better feed:gain. No effect of the treatments on the feed intake was observed. The digestible methionine + cystine intake increased

  6. The hydrolysis and precipitation of Pd(II) in 0.6 mol kg-1 NaCl: A potentiometric, spectrophotometric, and EXAFS study

    International Nuclear Information System (INIS)

    Boily, Jean-Francois F.; Seward, Terry M.; Charnock, John M.

    2007-01-01

    The hydrolysis of palladium was investigated in 0.6 mol kg -1 NaCl at 298.2 K. Potentiometric titrations of solutions at various total concentrations of palladium(II) revealed that dilute (millimolar) conditions can be used to monitor the proton release due to hydrolysis reactions up to 2 protons per palladium(II) as long as the equilibration time is kept small. Spectrophotometric titrations were used to corroborate the homogeneous changes in speciation for the PdCl 3 OH 2- species and to extract its correlative molar absorption coefficients in the 210-320 nm range. The molar absorption coefficients are similar to those of PdCl42- but exhibit a broader distribution of excitation energies resulting from the blue shift of the dominant charge transfer bands due to the presence of OH-. The longer-term potentiometric titrations systematically yielded, on the other hand, precipitates which matured over a period of 6 weeks and resulted in a more extensive release of protons to the solution. Precipitation experiments at six different total palladium(II) concentrations in the 3-11 pH range showed the dominant precipitating phase as Pd(OH)1.72Cl0.28. The coordination environment of Pd in this solid was investigated by extended X-ray absorption fine structure spectroscopy (EXAFS) and yielded an average 1.75 O and 0.25 Cl per Pd atoms with a Pd-O distance of 2.0 (angstrom) and Pd-Cl of 2.1 (angstrom). Finally, the precipitation experiments showed the final products to be of larger solubility than a literature Pd(OH)2 solubility study in which the KCl media induced a solid phase transformation to Pd(OH)1.72Cl0.28. Polynuclear complexes Pdq(OH)r2q-r with q=r=[3,9] explain the combined precipitation and hydrolysis data and may represent subsets of [Pd(OH)2]n and/or [Pd(OH)1.72Cl0.28]n chains coiled into nanometer-sized spheroids previously described in the literature

  7. Alteration of glycine receptor immunoreactivity in the auditory brainstem of mice following three months of exposure to radiofrequency radiation at SAR 4.0 W/kg.

    Science.gov (United States)

    Maskey, Dhiraj; Kim, Hyung Gun; Suh, Myung-Whan; Roh, Gu Seob; Kim, Myeung Ju

    2014-08-01

    The increasing use of mobile communication has triggered an interest in its possible effects on the regulation of neurotransmitter signals. Due to the close proximity of mobile phones to hearing-related brain regions during usage, its use may lead to a decrease in the ability to segregate sounds, leading to serious auditory dysfunction caused by the prolonged exposure to radiofrequency (RF) radiation. The interplay among auditory processing, excitation and inhibitory molecule interactions plays a major role in auditory function. In particular, inhibitory molecules, such a glycine, are predominantly localized in the auditory brainstem. However, the effects of exposure to RF radiation on auditory function have not been reported to date. Thus, the aim of the present study was to investigate the effects of exposure to RF radiation on glycine receptor (GlyR) immunoreactivity (IR) in the auditory brainstem region at 835 MHz with a specific absorption rate of 4.0 W/kg for three months using free-floating immunohistochemistry. Compared with the sham control (SC) group, a significant loss of staining intensity of neuropils and cells in the different subdivisions of the auditory brainstem regions was observed in the mice exposed to RF radiation (E4 group). A decrease in the number of GlyR immunoreactive cells was also noted in the cochlear nuclear complex [anteroventral cochlear nucleus (AVCN), 31.09%; dorsal cochlear nucleus (DCN), 14.08%; posteroventral cochlear nucleus (PVCN), 32.79%] and the superior olivary complex (SOC) [lateral superior olivary nucleus (LSO), 36.85%; superior paraolivary nucleus (SPN), 24.33%, medial superior olivary nucleus (MSO), 23.23%; medial nucleus of the trapezoid body (MNTB), 10.15%] of the mice in the E4 group. Auditory brainstem response (ABR) analysis also revealed a significant threshold elevation of in the exposed (E4) group, which may be associated with auditory dysfunction. The present study suggests that the auditory brainstem region

  8. Níveis de lisina para leitoas dos 6 aos 16 kg com alto potencial para deposição de carne magra na carcaça Lysine levels for gilts from 6 to 16 kg with high genetic potential for lean gain

    Directory of Open Access Journals (Sweden)

    Huedy Flavio Vasconcelos Moreira

    2005-08-01

    Full Text Available O experimento foi conduzido para se estabelecer as exigências de lisina para leitoas com alto potencial de deposição de carne magra na carcaça, na fase inicial de crescimento, dos 6 aos 16 kg. Foram utilizadas 60 leitoas híbridas, de linhagem comercial, selecionadas para alta deposição de carne magra na carcaça, com peso inicial de 6,0±0,21 kg e peso final de 16,0±0,32 kg, em delineamento experimental de blocos ao acaso, com cinco tratamentos, quatro repetições e três animais por unidade experimental. Os tratamentos corresponderam a uma ração basal com 21,60% de proteína bruta, suplementada com cinco níveis de L-lisina HCl, resultando em rações com 1,3; 1,4; 1,5; 1,6 e 1,7% de lisina total. Observou-se que o ganho de peso não foi influenciado pelos tratamentos. Houve efeito quadrático dos tratamentos sobre o consumo de ração, o consumo de lisina diário sobre a conversão alimentar, que melhorou, respectivamente, até o nível estimado de 1,56%. Não foi constatado efeito dos tratamentos sobre a porcentagem de proteína e a taxa de deposição de proteína na carcaça, entretanto, verificou-se efeito linear sobre a porcentagem de gordura, taxa de deposição de gordura e porcentagem de água na carcaça. Leitoas com alto potencial genético para deposição de carne magra na carcaça, dos 6 aos 16 kg, exigem 1,56% de lisina total ou 1,38% de lisina digestível, para melhor desempenho, e 1,70% de lisina total ou 1,50% de lisina digestível, para a melhor composição de carcaça, o que corresponde, respectivamente, a um consumo estimado de 8,46 e 10,06 g de lisina total/dia.The experiment was carried out to establish the lysine requirement of females swine, from 6 to 16 kg live weight. Sixty crossbreed gilts with high genetic potential for lean gain and average initial and final weight of 6.0 ± 0.21 kg and 16.0 ± 0.32 kg, respectively, were assigned to a randomized blocks design, with five treatments, four replications

  9. Levels of digestible isoleucine on performance, carcass traits and organs weight of gilts (15 - 30 KG Níveis de isoleucina digestível sobre o desempenho, características de carcaça e peso de órgãos de fêmeas suínas (15 - 30 kg

    Directory of Open Access Journals (Sweden)

    Leandro Dalcin Castilha

    2012-08-01

    Full Text Available The ideal protein concept for pigs has allowed reducing levels of crude protein in the diet, since synthetic amino acids are included because the branched chain amino acids may be limiting. In order to determine the digestible isoleucine requirement for gilts from 15 to 30 kg, a performance assay was accomplished, using 40 crossbreed gilts of high genetic potential, averaging 15.00 ± 0.52 kg of body weight, alloted in a randomized blocks design, consisting of five treatments (0.45, 0.52, 0.59, 0.66, 0.73% of digestible isoleucine, four replicates and two animals per experimental unit. Performance traits were determined and at the end of the experiment one animal per experimental unit was slaughtered to determine carcass composition and organs weight. Levels from 0.45 to 0.73% of digestible isoleucine did not affect the carcass traits and organs weight of gilts from 15 to 30 kg. A quadratic effect (PO conceito de proteína ideal, para suínos, tem permitido reduzir os níveis de proteína bruta da dieta, desde que haja a inclusão de aminoácidos sintéticos, pois os aminoácidos de cadeia ramificada podem ser limitantes. Com o objetivo de determinar a exigência de isoleucina digestível para fêmeas suínas dos 15 aos 30 kg, foi realizado um ensaio de desempenho, utilizando-se 40 fêmeas suínas, mestiças de alto potencial genético, com peso vivo inicial de 15,00 ± 0,52kg, distribuídas em um delineamento experimental de blocos ao acaso, constituído de cinco tratamentos (0,45; 0,52; 0,59; 0,66; 0,73% de isoleucina digestível, quatro repetições e dois animais por unidade experimental. Foram determinadas características de desempenho e, ao final do experimento, um animal de cada unidade experimental foi abatido, para a determinação da composição de carcaça e peso de órgãos. Níveis de 0,45 a 0,73% de isoleucina digestível não influenciaram as características de carcaça e peso de órgãos dos animais. Houve efeito quadr

  10. Níveis de lisina digestível em rações, utilizando-se o conceito de proteína ideal, para suínos machos castrados de alto potencial genético dos 15 aos 30 kg Dietary digestible lysine levels, using the ideal protein concept, for barrows with high genetic potential from 15 to 30 kg

    Directory of Open Access Journals (Sweden)

    Márvio Lobão Teixeira de Abreu

    2006-06-01

    Full Text Available Foram utilizados 40 leitões machos castrados, de alto potencial genético para deposição de carne magra na carcaça, com pesos inicial e final de 15,76 + 0,93 e 30,23 + 1,56 kg, respectivamente, para avaliar o efeito de níveis de lisina digestível, utilizando-se o conceito de proteína ideal, sobre o desempenho e a composição da carcaça. Os tratamentos corresponderam a uma ração basal com 19,46% de PB e 3.280 kcal de EM/kg, suplementada com L-lisina HCl, resultando em rações com 0,90; 1,.00; 1,10 e 1,20% de lisina digestível. As rações foram suplementadas com níveis crescentes de aminoácidos sintéticos, resultando em rações com relações constantes entre metionina + cistina, treonina, triptofano e valina com a lisina (60, 60, 19 e 69%, respectivamente, com base na digestibilidade verdadeira. Não se observou efeito dos tratamentos sobre o consumo diário de ração, a concentração de uréia no plasma e as porcentagens de água, proteína e gordura na carcaça dos animais. Houve efeito quadrático dos níveis de lisina digestível sobre o ganho de peso diário, que aumentou até o nível estimado de 1,10% de lisina na ração, e a conversão alimentar, que melhorou até o nível estimado de 1,12%. Houve efeito dos tratamentos sobre o consumo diário de lisina, que aumentou de forma linear. As deposições de proteína e gordura na carcaça foram influenciadas de forma quadrática, aumentando até os níveis estimados de 1,12 e 1,08% de lisina digestível, respectivamente. O nível de 1,12% de lisina digestível foi o que proporcionou os melhores resultados de desempenho e de características de carcaça de suínos machos castrados de alto potencial genético na fase de 15 a 30 kg, o que correspondeu a um consumo de lisina digestível de 12,03 g/dia (3,42 g de Lis/Mcal de EM.Fourty barrows with high genetic potential for lean gain averaging initial and final body weights of 15.76 + 0.93 kg and 30.23 + 1.56 kg, respectively

  11. The use of lipidic sources and digestible energy levels on testicles parameters of 60 Kg boars Uso de diferentes fontes de lipídios e níveis de energia digestível sobre parâmetros testiculares de suínos machos a partir dos 60 kg

    Directory of Open Access Journals (Sweden)

    Rita Flávia Miranda de Oliveira

    2008-09-01

    Full Text Available This experiment was carried out to study the lipidic sources (coconut oil and soybean oil and digestible energy levels (3350, 3450, 3550 e 3650 kcal de DE/kg of ration effect on swine reproductive performance. It was used eighty 60 kg boars distributed in different treatments. There was no treatment effect on VLDL and lipase concentrations. The coconut oil provided higher HDL levels than soybean oil. The cholesterol, LDL and triglicerides levels were increased in a linear way with both lipidic sources. The treatments did not cause a modification in testosterone seric concentration. The semen volume and spermatic vigor was influenced by DE level when coconut oil was used. The spermatic concentration was increase by soybean oil use. Considering the interaction between lipidic source x DE level for spermatic motility the coconut oil reduced this parameter in a quadratic way. The semen morphological alterations were not altered. The coconut oil at 4499 and 3492 kcal of DE level provided the higher results for STD and SET. The increase of the coconut oil on diet rise cholesterol, LDL, HDL and triglicerides levels in the blood.Visando-se estudar o efeito de fontes (gordura de coco e óleo de soja e níveis de energia digestível (3350, 3450, 3550, 3650 kcal de ED/kg de ração sobre o desempenho reprodutivo de suínos, foram utilizados 80 animais, machos inteiros recebendo a partir dos 60 kg os diferentes tratamentos. O delineamento experimental foi de blocos casualizados. Não se observou efeito dos tratamentos nas concentrações de VLDL e lipase. A gordura de coco proporcionou maiores valores de HDL que o óleo de soja. Houve efeito dos níveis de ED sobre o colesterol total (CT, LDL e triglicerídeos que aumentaram linearmente com o aumento do nível de ED, quando a gordura de coco foi utilizada. A concentração sanguínea de testosterona não foi alterada pelos tratamentos. O volume do sêmen e o vigor espermático foram influenciados pelo n

  12. Pulsed Neutron Studies of BeO-Natural Uranium Lattices; Etudes de Reseaux Uranium Naturel-Glucine, par la Methode des Neutrons Pulses; Issledovanie reshetok BeO-prirodnyj uran s pomoshch'yu impul'snykh nejtronov; Estudio de Reticulados de Beo-Uranio Natural con Ayuda de Neutrones Pulsados

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, B. V.; Nargundkar, V. R.; Subbarao, K. [Atomic Energy Establishment Trombay, Bombay (India)

    1965-10-15

    . Las rafagas de neutrones se produjeron con un acelerador de cascada pulsando la fuente de iones y empleando la reaccion Be(d, n). Como detectores se emplearon contadores proporcionales de BF{sub 3} enriquecido. Los armonicos espaciales y temporales se eliminaron por el metodo descrito por Joshi y sus colaboradores en otra memoria presentada en este simposio. Se determino la constante de decrecimiento del modo fundamental para diversos laplacianos cuando la criticidad estaba muy lejos de alcanzarse. En estos calculos se tuvo en cuenta el efecto del enfriamiento por difusion, asi como el de la anisotropic. Todas las constantes de difusion y de multiplicacion se determinaron mediante ajuste por cuadrados minimos siguiendo tres procedimientos distintos. El laplaciano crftico inmediato se obtuvo resolviendo la ecuacion de la constante de decrecimiento para {lambda} = 0. Los resultados finales fueron los siguientes: Longitud de difusion L = 15,2 cm. Constante de absorcion {lambda}{sub 0} = 162,5 s{sup -1}. Coeficiente de difusion D = 1,761 * 10{sup 5} cm{sup 2}/s. Constante de enfriamiento por difusion C = -8,766 * 10{sup 5} cm{sup 4}/s. Edad {tau} = 150,7 cm{sup 2} Factor de multiplicacion infinita k{sub {infinity}}= 1,126. Laplaciano crftico inmediato B{sup 2} = 3,00 * 10{sup -4} cm{sup -2}. (author) [Russian] Opisyvaetsja primenenie metoda impul'snyh nejtronov dlja opredelenija dif- fuzionnyh parametrov i postojannyh razmnozhenija reshetok. S pomoshh'ju jetogo metoda po- lucheny diffuzionnye parametry i postojannye razmnozhenija dlja reshetok VeO-prirodnyj uran. Ispol'zovavshiesja uranovye sterzhni imeli v diametre 2,92 sm i byli pokryty alju- miniem tolshhinoj v 0,072 sm. Oni byli raspolozheny vertikal'no v kanalah, imejushhih kva- dratnoe sechenie 5 h 5 sm v kvadratnoj reshetke s shagom 15 sm. Impul'sy nejtronov polu- chali s pomoshh'ju kaskadnogo uskoritelja v rezul'tate pul'sirovanija istochnika ionov i is- pol'zovanija reakcij Be (d,n). Detektorami sluzhili

  13. Construction, Cost and Use of an Enriched Uranium, Light-Water Subcritical Assembly; Assemblage Sous-Critique a Uranium Enrichi et Eau Legere; Realisation, Cout et Application; Realizatsiya i stoimost' podkriticheskoj sborki na obogashchennom urane i legkoj vode; Construccion, Coste y Aplicacion de un Conjunto Subcritico de Uranio Enriquecido

    Energy Technology Data Exchange (ETDEWEB)

    Vittoz, B.; Berthet, P.; Gavin, P.; Mandrin, C.; Robert, P.; Thurnheer, J. [Ecole Polytechnique de l' Universite de Lausanne (Switzerland)

    1964-02-15

    ecuaciones de dispersion en teoria de dos grupos. Basta conocer las caracteristicas de un solo plano de barras para prever el flujo neutronico debido a los n planos. Estas caracteristicas se determinan experimentalmente teniendo en cuenta la variacion vertical del flujo neutronico. El estudio se prosigue por evaluacion de la influencia de la distancia entre las banas pertenecientes a un mismo plano. (author) [Russian] Prednaznachennaja dlja jeksperimental'nogo izuchenija reshetok umnozhitelja podkriticheskaja sborka ispol'zuetsja takzhe dlja celej obuchenija. Ustanovka obladaet bol'shimi vozmozhnostjami ispol'zovanija. Izlagajutsja prichiny, po kotorym laboratorija jadernoj tehniki Politehnicheskoj shkoly Lozannskogo universiteta reshila realizovat', naskol'ko jeto vozmozhno, podkriticheskuju sborku svoimi sobstvennymi sredstvami i izbrat' reshetku slaboobogashennyj uran-legkaja voda. Daetsja opisanie principa i realizacii ustrojstv, kotorye pozvoljajut udobno i bystro izmenjat' parametry reshetki i nejtronnogo pitanija: 1. Uranovye sterzhni podveshivajutsja vertikal'no, i kazhdaja tochka podveski imeet dva gradusa svobodnogo hoda bez ogranichenija samogo processa. Jetot princip pozvoljaet, naprimer, var'irovat' posledovatel'no shag reshetki. 2. Nejtronnoe pitanie obespechivaetsja pjat'ju istochnikami, kotorye pomeshajutsja v grafitovom cokole. Rasstojanie jetih istochnikov mozhet takzhe regulirovat'sja posledovatel'nym obrazom. Rassmatrivajutsja problemy bezopasnosti, kotorye sozdaet ustanovka, tem. chto reaktivnost' mozhet sil'no izmenjat'sja ot odnoj konfiguracii k drugoj. Nakonec, privodjatsja rashody po stroitel'stvu i jekspluatacii jetoj podkriticheskoj sborki. S pomoshh'ju podkriticheskoj sborki izuchalas' neperiodicheskaja reshetka, kogda byla predprinjata popytka poluchit' odnorodnyj potok. S jetoj cel'ju ispol'zovana geterogennaja teorija Fajnberga i Horninga. Vnachale rassmatrivaetsja reshetka sterzhnej, raspolozhennyh odinakovym obrazom v n-parallel'nyh planah na

  14. Dissolution experiments of commercial PWR (52 MWd/kgU) and BWR (53 MWd/kgU) spent nuclear fuel cladded segments in bicarbonate water under oxidizing conditions. Experimental determination of matrix and instant release fraction

    Energy Technology Data Exchange (ETDEWEB)

    González-Robles, E., E-mail: ernesto.gonzalez-robles@kit.edu [CTM Centre Tecnològic, Plaça de la Ciència 2, 08243 Manresa (Spain); Serrano-Purroy, D. [European Commission - EC, Joint Research Centre (JRC), Institute for Transuranium Elements - ITU, Postfach 2340, D-76125 Karlsruhe (Germany); Sureda, R. [CTM Centre Tecnològic, Plaça de la Ciència 2, 08243 Manresa (Spain); Casas, I. [Chemical Engineering Department, Universitat Politècnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain); Pablo, J. de [CTM Centre Tecnològic, Plaça de la Ciència 2, 08243 Manresa (Spain); Chemical Engineering Department, Universitat Politècnica de Catalunya, Av. Diagonal 647, 08028 Barcelona (Spain)

    2015-10-15

    The denominated instant release fraction (IRF) is considered in performance assessment (PA) exercises to govern the dose that could arise from the repository. A conservative definition of IRF comprises the total inventory of radionuclides located in the gap, fractures, and the grain boundaries and, if present, in the high burn-up structure (HBS). The values calculated from this theoretical approach correspond to an upper limit that likely does not correspond to what it will be expected to be instantaneously released in the real system. Trying to ascertain this IRF from an experimental point of view, static leaching experiments have been carried out with two commercial UO{sub 2} spent nuclear fuels (SNF): one from a pressurized water reactor (PWR), labelled PWR, with an average burn-up (BU) of 52 MWd/kgU and fission gas release (FGR) of 23.1%, and one from a boiling water reactor (BWR), labelled BWR, with an average BU of and 53 MWd/kgU and FGR of 3.9%. One sample of each SNF, consisting of fuel and cladding, has been leached in bicarbonate water during one year under oxidizing conditions at room temperature (25 ± 5)°C. The behaviour of the concentration measured in solution can be divided in two according to the release rate. All radionuclides presented an initial release rate that after some days levels down to a slower second one, which remains constant until the end of the experiment. Cumulative fraction of inventory in aqueous phase (FIAP{sub c}) values has been calculated. Results show faster release in the case of the PWR SNF. In both cases Np, Pu, Am, Cm, Y, Tc, La and Nd dissolve congruently with U, while dissolution of Zr, Ru and Rh is slower. Rb, Sr, Cs and Mo, dissolve faster than U. The IRF of Cs at 10 and 200 days has been calculated, being (3.10 ± 0.62) and (3.66 ± 0.73) for PWR fuel, and (0.35 ± 0.07) and (0.51 ± 0.10) for BWR fuel.

  15. Rechargeable Lithium Sulfur (Li-S) Battery with Specific Energy 400 Wh/kg and Operating Temperature Range -60°C to 60°C, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Sion Power is developing a rechargeable lithium sulfur (Li-S) battery with a demonstrated specific energy exceeding 350 Wh/kg and the range of operating temperatures...

  16. Behavior to the fracture of an AISI 304 stainless steel sensitized in BWR reactor conditions (288 degrees Centigrade and 80 Kg/cm{sup 2}); Comportamiento a la fractura de un acero inoxidable AISI 304 sensibilizado en condiciones de reactor BWR (288 grados Centigrados y 80 Kg/cm{sup 2})

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez C, R.; Diaz S, A.; Garcia R, R.; Aguilar T, A.; Gachuz M, M.; Arganis J, C.; Merino C, J. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    1999-07-01

    It is a knew fact that ductility of a lot of structural alloys can be deteriorated by the environment effect which are exposed, and that their consequent embrittlement can put in doubt the safety of their functioning; such is the case of austenitic stainless steels used in internal components of the BWR type reactors which not only is subjected to the effect combined of the aggressive environment which surround it (pressure, temperature, corrosion potential, conductivity medium, local state of efforts, etc.), but also to the action of present neutron radiation, manifesting microstructural changes which are reflected in the augmentation of its susceptibility to the intergranular cracking, phenomena generally known as IASCC ''Irradiation Assisted Stress Corrosion Cracking''. Once appeared the cracking in the material, the useful life of a component is limited by the rapidity to growth of these cracking, making necessary evaluations which can to predict its behavior, therefore the present work shows the preliminary results for determining the behavior to the fracture of an AISI 304 stainless steel sensitized, in a dynamic recirculation circuit which allows to simulate the operation conditions of a BWR reactor (288 Centigrade and 80 kg/cm{sup 2}). (Author)

  17. Níveis de lisina para leitoas selecionadas geneticamente para deposição de carne magra na carcaça, dos 15 aos 30 kg Lysine levels for gilts with high genetic potential for lean gain from 15 to 30 kg

    Directory of Open Access Journals (Sweden)

    Dalton de Oliveira Fontes

    2005-02-01

    Full Text Available Foram utilizadas 50 leitoas híbridas, com alto potencial genético para deposição de carne magra na carcaça e peso inicial e final de 15,39 ± 0,59 e 30,93 ± 1,72 kg, respectivamente, para avaliar diferentes níveis de lisina. O delineamento experimental foi o de blocos ao acaso, com cinco tratamentos, cinco repetições e dois animais por unidade experimental. Os tratamentos corresponderam a uma ração basal com 19% de proteína bruta, suplementada com cinco níveis de L-lisina HCl, resultando em rações com 0,95; 1,05; 1,15; 1,25; e 1,35% de lisina total. Observou-se que o ganho de peso e o consumo de lisina diário elevaram-se de forma linear com o aumento do nível de lisina da ração. Houve efeito quadrático dos níveis de lisina sobre o consumo de ração diário e a conversão alimentar, que melhorou até o nível de 1,26% de lisina total (0,365%/Mcal de ED ou 1,13% (0,328%/Mcal de ED de lisina digestível, correspondendo a um consumo estimado de lisina total e digestível de 14,62 g/dia e 13,12 g/dia, respectivamente. Não se observou efeito dos tratamentos sobre a porcentagem de proteína e de água na carcaça e os níveis de uréia no soro sangüíneo, entretanto, houve efeito quadrático sobre a porcentagem de gordura e a taxa de deposição de gordura na carcaça, que diminuíram até o nível de 1,25 e 1,18% de lisina, respectivamente. Observou-se que a taxa de deposição de proteína elevou de forma linear com o aumento do nível de lisina na ração. Os níveis de lisina total que proporcionaram os melhores resultados de desempenho e qualidade de carcaça situaram-se entre 1,18 e 1,35%. Portanto, concluiu-se que a exigência de lisina total de leitoas dos 15 aos 30 kg é de 1,26% ou de 1,13% de lisina digestível, correspondendo a consumo estimado de lisina total e digestível de 14,6 e 13,1 g/dia, respectivamente.Fifty hybrid gilts, with high genetic potential for lean gain and initial and final weight of 15.39 ± 0

  18. Conscious Sedation Efficacy of 0.3 and 0.5 mg/kg Oral Midazolam for Three to Six Year-Old Uncooperative Children Undergoing Dental Treatment: A Clinical Trial

    Directory of Open Access Journals (Sweden)

    Masoud Fallahinejad Ghajari

    2016-10-01

    Full Text Available Objectives: Midazolam with variable dosages has been used to induce sedation in pediatric dentistry. The aim of this study was to compare the efficacy of two dosages of oral midazolam for conscious sedation of children undergoing dental treatment.Materials and Methods: In this randomized crossover double blind clinical trial, 20 healthy children (ASA I aged three to six years with negative or definitely negative Frankl behavioral rating scale were evaluated. Half of the children received 0.5mg/kg oral midazolam plus 1mg/kg hydroxyzine (A orally in the first session and 0.3mg/kg oral midazolam plus 1mg/kg hydroxyzine (B in the next session. The other half received the drugs on a reverse order. Sedation degree by Houpt sedation rating scale, heart rate and level of SpO2 were assessed at the beginning and after 15 and 30 minutes. The data were analyzed using SPSS 19 and Wilcoxon Signed Rank and McNemar’s tests.Results: The results showed that although administration of 0.5mg/kg oral midazolam was slightly superior to 0.3mg/kg oral midazolam in terms of sedation efficacy, the differences were not significant (P>0.05. The difference in treatment success was not significant either (P>0.05. Heart rate, oxygen saturation (SpO2 and respiratory rate were within the normal range and did not show a significant change (P>0.05.Conclusions: The overall success rate of the two drug combinations namely 0.5mg/kg oral midazolam plus hydroxyzine and 0.3mg/kg oral midazolam plus hydroxyzine was not significantly different for management of pediatric patients.Keywords: Conscious Sedation; Pediatric Dentistry; Midazolam; Hydroxyzine

  19. Ractopamine hydrochloride in formulated rations for barrows or gilts from 94 to 130 kg Cloridrato de ractopamina em rações formuladas para suínos machos castrados ou para fêmeas na fase dos 94 aos 130 kg

    Directory of Open Access Journals (Sweden)

    Nikolas de Oliveira Amaral

    2009-08-01

    Full Text Available An experiment was carried out to evaluate the performance, carcass composition, cutting yields and economic viability of 5 or 10 ppm of ractopamine hydrochloride (RAC in diets for barrows and gilts from 94 to 130 kg. Sixty commercial hybrid pigs within a gender, were individually kept in pens and assigned a randomized experimental block design, in a 3 × 2 factorial arrangement, with three levels of RAC (0; 5 and 10 ppm and two sexs (barrows and gilts. There were no RAC × sex interactions for all evaluated parameters. There were significant improvements for the groups of RAC-treated on final weight, average daily gain (ADG and feed:gain (F:G. The RAC, independent from the level (5 or 10 ppm, improved the F:G, but did not influence the average feed intake. The gilts had smaller final weight, smaller average feed intake and better F:G. The supplementation with 10 ppm of RAC provided better carcass yield, better longissimus muscle area and better meat percentage. The pigs supplemented with RAC showed better tenderloin yield, better ham weight and better meat percentage of ham. The gilts had better meat percentage, better back fat thickness, bigger belly flexibility and smaller fat thickness of the belly than barrows. On economic viability, the RAC-treated pigs increased the allowance index, gross earnings and net earnings. Compared to the barrows, gilts showed lower total cost, better allowance index and higher net earnings. The supplementation with 5 ppm of RAC was enough to improve performance, carcass composition and cutting yields in the heavy pigs. Furthermore, 5 or 10 ppm of RAC was economically viable and the heavy gilts were more profitable than heavy barrows.Foi realizado um experimento com o objetivo de avaliar o desempenho, a composição de carcaça e a viabilidade econômica do uso de 5 e 10 ppm de cloridrato de ractopamina (RAC em rações formuladas para suínos machos castrados ou para fêmeas dos 94 aos 130 kg. Utilizaram-se 60 su

  20. Materials Control in the Fabrication of Enriched Uranium Fuels; Controle des Matieres au Cours de la Fabrication des Combustibles a Base d'Uranium Enrichi; Uchet materialov pri izgotovlenii topliva na obogashchennom urane; Control de Materiales en la Elaboracion de Combustibles de Uranio Enriquecido

    Energy Technology Data Exchange (ETDEWEB)

    Cardwell, Jr., R. G. [Oak Ridge National Laboratory, Oak Ridge, TN (United States)

    1966-02-15

    densidad. La manipulacion de la chatarra tuvo una importante influencia en el balance de los materiales que confirmo el contenido de combustible y aseguro una buena contabilizacion. Los procedimientos de manipulacion y registro, y en particular los metodos de determinacion de las partidas y de marcacion fisica, se formularon de tal manera que constituyeron una buena ayuda para el fabricante en lo que respecta al control de la criticidad. (author) [Russian] Usilennaja dejatel'nost' v oblasti tehnologii teplovydeljajushhih jelementov, provodivshajasja v Okridzhskoj nacional'noj laboratorii na protjazhenii poslednih 15 let, privela k vyrabotke racional'nyh tehnologicheskih processov i metodov ucheta obogashhennyh materialov, kotorye sejchas shiroko primenjajutsja pri izgotovlenii teplovydeljajushhih jelementov v promyshlennom masshtabe. V hode proektirovanija i izgotovlenija prototipov teplovydeljajushhih jelementov dlja zapuska reaktora dlja ispytanija materialov, reaktora s massovoj zashhitoj ili {sup b}assejnovogo tipa{sup ,} kompaktnogo jenergeticheskogo reaktora voennogo obrazca, reaktora s bashennoj zashhitoj, pokazatel'nogo reaktora dlja Zhenevskoj konferencii, izotopnogo reaktora s potokom bol'shoj intensivnosti i jeksperimentol'nogo reaktora s gazovym ohlazhdeniem byli vyrabotany i prinjaty v kachestve ustanovlennyh norm nadezhnye metody obrashhenija s obogashhennym toplivom v vide splavov, suspenzii ili okisej. Nakoplennyj opyt posluzhil osnovoj dlja dannogo doklada, v kotorom podcherkivajutsja problemy ucheta materialov i ih razreshenie pri izgotovlenii razlichnyh sostavnyh chastej teplovydeljajushhih jelementov razlichnyh tipov na obogashhennom urane. Osnovnymi zadachami pri vyrabotke horoshej sistemy ucheta materialov javljajutsja: 1) sokrashhenie chisla edinic podotchetnogo materiala; 2) vyrabotka otdel'nyh uchetnyh dokumentov dlja kazhdoj vazhnoj stadii izgotovlenija i sostavlenie ih svodki sposobom, pozvoljajushhim s naimen'shej zatratoj truda vyjavljat' mesta

  1. Research with a Natural-Uranium Light-Water Subcritical Assembly; Recherches au Moyen d'un Ensemble Sous-Critique a Uranium Naturel et a Eau Ordinaire; Issledovaniya na podkriticheskoj sborke,rabotayushchej na prirodnom urane i obychnoj vode; Investigaciones con un Conjunto Subcritico de Uranio Natural y Agua Ligera

    Energy Technology Data Exchange (ETDEWEB)

    Koskinen, H. [Institute of Technical Physics, Otaniemi (Finland)

    1964-02-15

    natural-agua ligera, en especial de la validez de los modelos de frenado de pocos grupos para cuerpos de estructura uniforme y no uniforme. Los conjuntos con una sola fuente de fision espontanea se consideran particularmente adecuados para las investigaciones de esta clase, aunque la estadistica solo abarca un numero reducido de observaciones. Esto se debe a dos hechos: 1. El espectro de la fuente primaria se puede considerar identico al de la fision inducida, por lo que no existen fluctuaciones transitorias de energia como en el caso de una fuente puntiforme de neutrones rapidos. 2. La intensidad de la fuente primaria en cada punto del espacio es proporcional a la seccion eficaz de fision del combustible cuando esta ultima se considera en funcion de las coordenadas espaciales. Esta particularidad contribuye a simplificar las ecuaciones de flujo y permite, en muchos casos, hallar una analogia con los sistemas criticos. Un analisis minucioso de las distribuciones de flujo en sistemas de esta clase proporciona datos sobre la validez de modelos especiales de frenado. Tambien es posible obtener algunas aclaraciones sobre problemas como la fision rapida por interaccion y la probabilidad de escape por resonancia en funcion del espacio. El autor estima que, debido a sus multiples aplicaciones y a su seguridad intrinseca, los conjuntos subcriticos con moderador liquido constituyen casi la unica posibilidad de estudiar sistematicamente reticulados no uniformes. Existe el proposito de anadir a ese conjunto elementos enriquecidos. Ello permitira proceder al estudio sistematico de reticulados mixtos, y debido al flujo mas elevado, facilitara tambien el estudio de otros factores no uniformes. La memoria expone algunos aspectos de ese programa futuro. (author) [Russian] Soobshhaetsja ob issledovanijah na podkriticheskoj sborke, rabotajushhej na prirodnom urane i obychnoj vode. Predstavleny takzhe nekotorye temy iz programmy budushhih issledovanij. Material bol'shej chast'ju javljaetsja

  2. 700 kg jern med de smukkeste krystaller

    DEFF Research Database (Denmark)

    Pedersen, Jens Olaf Pepke

    2017-01-01

    Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/).......Anmeldelse af Holger Pedersen, “Pallas Iron – Russia’s first meteorite”, 260 sider, 190 kr. BoD 2017 (www.bod.dk/bog/)....

  3. Contrast-enhanced magnetic resonance angiography (MRA): evaluation of three different contrast agents at two different doses (0.05 and 0.1 mmol/kg) in pigs at 1.5 Tesla

    Energy Technology Data Exchange (ETDEWEB)

    Voth, M.; Vos, B.; Pietsch, H. [Bayer Schering Pharma AG, Diagnostic Imaging, Berlin (Germany); Michaely, Henrik J. [University of Heidelberg, Institute of Clinical Radiology and Nuclear Medicine, University Medical Center Mannheim, Medical Faculty Mannheim, Mannheim (Germany); Schwenke, C. [ScoSSiS - Statistical Consulting, Berlin (Germany)

    2011-02-15

    To compare the image quality of contrast-enhanced magnetic resonance angiography (CE-MRA) of the supra-aortic vessels at 0.05 mmol/kg bw and 0.1 mmol/kg bw, between gadobutrol, Gd-DTPA and Gd-BOPTA quantitatively and qualitatively a total of eight pigs were evaluated intraindividually at 1.5 T. Each pig was examined using 0.1 mmol/kg gadobutrol, Gd-DTPA and Gd-BOPTA on day one and 0.05 mmol/kg on day two. MRA datasets for the carotid artery and the infraorbital artery were qualitatively assessed regarding overall image quality on an ordinal four-point scale (4-excellent, 1-non-diagnostic). The signal-to noise-ratio (SNR) was measured. The qualitative assessment of the carotid artery showed a higher median image quality for the 0.1 mmol dose than for the 0.05 mmol dose for all three compounds. No difference was found for the infraorbital artery. Mean SNR of Gd-BOPTA, Gd-DTPA, gadobutrol at 0.05 mmol/kg were 36.0 {+-} 13.4/37.9 {+-} 16.3/43.7 {+-} 0.4 and at 0.1 mmol/kg they were 50.1 {+-} 12.4/46.6 {+-} 6.5 / 54.6 {+-} 10.2. Gd-BOPTA 0.05 revealed a significantly lower SNR than all other agents at normal dose. Full-dose gadolinium MRA results in higher image quality and significantly higher SNR compared with the half dose. Gadobutrol and Gd-BOPTA have similar enhancement properties at full dose but at half dose, gadobutrol appears superior. (orig.)

  4. Adequacy of a hospital-wide standard dose of 7mg/kg bodyweight gentamicin sufficient to achieve an adequate prophylactic maximum serum concentration (Cmax) in burn patients undergoing surgical burn wound treatment

    NARCIS (Netherlands)

    Borra, L.C.P.; Bosch, T.M.; Baar, M.E. van; Dokter, J.; Oen, I.M.; Ruijgrok, E.J.

    2016-01-01

    INTRODUCTION: Pharmacokinetics of drugs can be significantly altered in burn patients. The aim of our study was to validate if the current hospital-wide standard dosage of 7mg/kg total bodyweight gentamicin is sufficient to achieve an adequate prophylactic Cmax (Cmax>/=20mg/L). MATERIALS AND

  5. Weight Management Guides for Pregnant Women with a Body Mass index (BMI) Greater than or Equal to 40kg/m[Superscript 2]: A Qualitative Exploration of Their Use in Maternity Care

    Science.gov (United States)

    Smith, Debbie M.; Ward, Christine; Forbes, Shareen; Reynolds, Rebecca M.; Denison, Fiona C.

    2013-01-01

    Objective: Maternal obesity (Body Mass Index [BMI] greater than or equal to 30kg/m([superscript 2]) is associated with numerous maternal and fetal complications. Recent guidelines have called for advice to be given to women as pregnancy is a good time for intervention as due to women's motivations for change being high and changes may impact on…

  6. Corn Yield and Soil Nitrous Oxide Emission under Different Fertilizer and Soil Management: A Three-Year Field Experiment in Middle Tennessee.

    Science.gov (United States)

    Deng, Qi; Hui, Dafeng; Wang, Junming; Iwuozo, Stephen; Yu, Chih-Li; Jima, Tigist; Smart, David; Reddy, Chandra; Dennis, Sam

    2015-01-01

    A three-year field experiment was conducted to examine the responses of corn yield and soil nitrous oxide (N2O) emission to various management practices in middle Tennessee. The management practices include no-tillage + regular applications of urea ammonium nitrate (NT-URAN); no-tillage + regular applications of URAN + denitrification inhibitor (NT-inhibitor); no-tillage + regular applications of URAN + biochar (NT-biochar); no-tillage + 20% applications of URAN + chicken litter (NT-litter), no-tillage + split applications of URAN (NT-split); and conventional tillage + regular applications of URAN as a control (CT-URAN). Fertilizer equivalent to 217 kg N ha(-1) was applied to each of the experimental plots. Results showed that no-tillage (NT-URAN) significantly increased corn yield by 28% over the conventional tillage (CT-URAN) due to soil water conservation. The management practices significantly altered soil N2O emission, with the highest in the CT-URAN (0.48 mg N2O m(-2) h(-1)) and the lowest in the NT-inhibitor (0.20 mg N2O m(-2) h(-1)) and NT-biochar (0.16 mg N2O m(-2) h(-1)) treatments. Significant exponential relationships between soil N2O emission and water filled pore space were revealed in all treatments. However, variations in soil N2O emission among the treatments were positively correlated with the moisture sensitivity of soil N2O emission that likely reflects an interactive effect between soil properties and WFPS. Our results indicated that improved fertilizer and soil management have the potential to maintain highly productive corn yield while reducing greenhouse gas emissions.

  7. Maternal obesity is the new challenge; a qualitative study of health professionals’ views towards suitable care for pregnant women with a Body Mass Index (BMI ≥30 kg/m2

    Directory of Open Access Journals (Sweden)

    Smith Debbie M

    2012-12-01

    Full Text Available Abstract Background An increase in the number of women with maternal obesity (Body Mass Index [BMI] ≥30 kg/m2 has had a huge impact on the delivery of maternity services. As part of a programme of feasibility work to design an antenatal lifestyle programme for women with a BMI ≥30 kg/m2, the current study explored health professionals’ experiences of caring for women with a BMI ≥30 kg/m2 and their views of the proposed lifestyle programme. Method Semi-structured interviews with 30 health professionals (including midwives, sonographers, anaesthetists and obstetricians were conducted and analysed using thematic analysis. Recruitment occurred in two areas in the North West of England in early 2011. Results Three themes were evident. Firstly, obesity was seen as a conversation stopper; obesity can be a challenge to discuss. Secondly, obesity was seen as a maternity issue; obesity has a direct impact on maternity care and therefore intervention is needed. Finally, the long-term impact of maternal obesity intervention; lifestyle advice in pregnancy has the potential to break the cyclic obesity relationship. The health professionals believed that antenatal lifestyle advice can play a key role in addressing the public health issue of obesity as pregnancy is a time of increased motivation for women with a BMI ≥30 kg/m2. Conclusions Maternal obesity is a challenge and details of the training content required for health professionals to feel confident to approach the issue of maternal obesity with women are presented. Support for the antenatal lifestyle programme for women with a BMI ≥30 kg/m2 highlights the need for further exploration of the impact of interventions on health promotion.

  8. Maternal obesity is the new challenge; a qualitative study of health professionals' views towards suitable care for pregnant women with a Body Mass Index (BMI) ≥ 30 kg/m².

    Science.gov (United States)

    Smith, Debbie M; Cooke, Alison; Lavender, Tina

    2012-12-19

    An increase in the number of women with maternal obesity (Body Mass Index [BMI] ≥30 kg/m2) has had a huge impact on the delivery of maternity services. As part of a programme of feasibility work to design an antenatal lifestyle programme for women with a BMI ≥30 kg/m2, the current study explored health professionals' experiences of caring for women with a BMI ≥30 kg/m2 and their views of the proposed lifestyle programme. Semi-structured interviews with 30 health professionals (including midwives, sonographers, anaesthetists and obstetricians) were conducted and analysed using thematic analysis. Recruitment occurred in two areas in the North West of England in early 2011. Three themes were evident. Firstly, obesity was seen as a conversation stopper; obesity can be a challenge to discuss. Secondly, obesity was seen as a maternity issue; obesity has a direct impact on maternity care and therefore intervention is needed. Finally, the long-term impact of maternal obesity intervention; lifestyle advice in pregnancy has the potential to break the cyclic obesity relationship. The health professionals believed that antenatal lifestyle advice can play a key role in addressing the public health issue of obesity as pregnancy is a time of increased motivation for women with a BMI ≥30 kg/m2. Maternal obesity is a challenge and details of the training content required for health professionals to feel confident to approach the issue of maternal obesity with women are presented. Support for the antenatal lifestyle programme for women with a BMI ≥30 kg/m2 highlights the need for further exploration of the impact of interventions on health promotion.

  9. Pharmacokinetics of marbofloxacin in pigs after intravenous and intramuscular administration of a single dose of 8 mg/kg: dose proportionality, influence of the age of the animals and urinary elimination.

    Science.gov (United States)

    Schneider, M; Paulin, A; Dron, F; Woehrlé, F

    2014-12-01

    The pharmacokinetics of marbofloxacin in pigs were evaluated as a function of dose and animal age following intravenous and intramuscular administration of a 16% solution (Forcyl(®) ). The absolute bioavailability of marbofloxacin as well as the dose proportionality was evaluated in 27-week-old fattening pigs. Blood PK and urinary excretion of marbofloxacin were evaluated after a single intramuscular dose of 8 mg/kg in 16-week-old male pigs. An additional group of 12-week-old weaned piglets was used for the evaluation of age-related kinetics. The plasma and urine concentration of marbofloxacin was determined using a HPLC method. Pharmacokinetic parameters were calculated using noncompartmental methods. After intravenous administration in 27-week-old fattening pigs, the total body clearance was 0.065 L/h·kg. After intramuscular administration to the same animals, the mean observed Cmax was 6.30 μg/mL, and the AUCINF was 115 μg·h/mL. The absolute bioavailability was 91.5%, and dose proportionality was shown within the dose range of 4-16 mg/kg. The renal clearance was about half of the value of the total clearance. The total systemic clearance values significantly decreased as a function of age, being 0.092 L/h·kg and 0.079 L/h·kg in pigs aged 12 and 16 weeks, respectively. © 2014 The Authors. Journal of Veterinary Pharmacology and Therapeutics Published by John Wiley & Sons Ltd.

  10. An analysis of the composition of gain and growth of primal cuts of Iberian pigs of 10 to 150 kg body weight as affected by the level of feeding and dietary protein concentration

    Directory of Open Access Journals (Sweden)

    Rosa Nieto

    2014-10-01

    Full Text Available A meta-analysis was made of data from a total of 211 growing-finishing Iberian (IB pigs from four separate and independent sets of trials. Within each set of trials, a factorial arrangement of treatments was used, involving several concentrations of ideal protein in the diets and two or three levels of feed intake. Pigs were slaughtered at several stages of growth from 10 to 150 kg body weight (BW. The partition of dietary protein in the body of the pigs, the empty-body gain (EBG, the chemical composition of EBG, growth of primal cuts in the cold eviscerated carcass (without head, feet, and tail, and mass of dissected tissues in trimmed shoulder and ham were determined. Linear regression equations allowed estimating N requirements for maintenance as 175 mg/(kg BW0.75 · kg dry-matter intake · d-1 and an average value for the net efficiency of utilization of the dietary protein apparently absorbed of 0.386. In pigs offered adequate protein to energy diets, EBG was predicted as a function of average BW and feeding level (p<0.001. Multiple regression equations were constructed, which derived nutrient (g kg-1 or energy (MJ kg-1 composition of EBG as a function of empty-body weight (EBW, dietary protein to energy ratio, and level of feeding (p<0.001. These predictive equations, not applicable to pigs of lean and conventional genotypes, can contribute to the design of optimal feeding strategies to improve the efficiency of IB pig production systems and to achieve high quality standards in end products for the market.

  11. A high protein diet (3.4 g/kg/d) combined with a heavy resistance training program improves body composition in healthy trained men and women--a follow-up investigation.

    Science.gov (United States)

    Antonio, Jose; Ellerbroek, Anya; Silver, Tobin; Orris, Steve; Scheiner, Max; Gonzalez, Adriana; Peacock, Corey A

    2015-01-01

    The consumption of a high protein diet (>4 g/kg/d) in trained men and women who did not alter their exercise program has been previously shown to have no significant effect on body composition. Thus, the purpose of this investigation was to determine if a high protein diet in conjunction with a periodized heavy resistance training program would affect indices of body composition, performance and health. Forty-eight healthy resistance-trained men and women completed this study (mean ± SD; Normal Protein group [NP n = 17, four female and 13 male]: 24.8 ± 6.9 yr; 174.0 ± 9.5 cm height; 74.7 ± 9.6 kg body weight; 2.4 ± 1.7 yr of training; High Protein group [HP n = 31, seven female and 24 male]: 22.9 ± 3.1 yr; 172.3 ± 7.7 cm; 74.3 ± 12.4 kg; 4.9 ± 4.1 yr of training). Moreover, all subjects participated in a split-routine, periodized heavy resistance-training program. Training and daily diet logs were kept by each subject. Subjects in the NP and HP groups were instructed to consume their baseline (~2 g/kg/d) and >3 g/kg/d of dietary protein, respectively. Subjects in the NP and HP groups consumed 2.3 and 3.4 g/kg/day of dietary protein during the treatment period. The NP group consumed significantly (p protein during the treatment period compared to their baseline intake. The HP group consumed more (p protein during the treatment period compared to their baseline intake. Furthermore, the HP group consumed significantly more (p protein compared to the NP group. There were significant time by group (p ≤ 0.05) changes in body weight (change: +1.3 ± 1.3 kg NP, -0.1 ± 2.5 HP), fat mass (change: -0.3 ± 2.2 kg NP, -1.7 ± 2.3 HP), and % body fat (change: -0.7 ± 2.8 NP, -2.4 ± 2.9 HP). The NP group gained significantly more body weight than the HP group; however, the HP group experienced a greater decrease in fat mass and % body fat. There was a significant time effect

  12. Test report: Preliminary tests for the High Flux Reactor: Experimental determination of flow redistribution conditions at pressures between 4 and 5 kg/cm2 abs in a rectangular channel 2 mm thick and 60 cm long

    International Nuclear Information System (INIS)

    Schleisiek, K.; Dumaine, J.C.

    1989-01-01

    In the context of safety research for the OSIRIS reactor, tests have been performed on the Super BOB cell with a view to determining experimentally the internal characteristics (or ''S'' curves) of a channel with a rectangular heating cross-section 2 x 38 mm and 600 mm long. During these tests the maximum pressure at the channel exit was brought to 3 kg/cm 2 abs. The pressurization level in the High Flux Reactor will be higher. That is why tests have been carried out at maximum pressure of 5 kg/cm 2 abs allowable on the ''super BOB'' loop without modifying it. The first objective of this test series was to determine the ''S'' curves and the exchange coefficients experimentally. This document discusses the test conditions and test results

  13. Processes of change in quality of life, weight self-stigma, body mass index and emotional eating after an acceptance-, mindfulness- and compassion-based group intervention (Kg-Free) for women with overweight and obesity.

    Science.gov (United States)

    Palmeira, Lara; Cunha, Marina; Pinto-Gouveia, José

    2017-01-01

    This study examined the effectiveness of Kg-Free: an acceptance-, mindfulness- and compassion-based group intervention for women with overweight and obesity at post-treatment and 3-month follow-up and explored the psychological processes that underlie changes in quality of life, weight self-stigma, body mass index and emotional eating at post-treatment. Overall, 53 women completed Kg-Free. At post-treatment and 3-month follow-up, participants reported increased quality of life, mindfulness and self-compassion abilities and decreased weight self-stigma, emotional eating, shame, weight-related experiential avoidance, self-criticism and body mass index. Shame and self-criticism reductions were important mediators of changes in health-related outcomes, whereas weight-related experiential avoidance, mindfulness and self-compassion mediated changes in weight and eating-related outcomes.

  14. Reduction of Portion Size and Eating Rate Is Associated with BMI-SDS Reduction in Overweight and Obese Children and Adolescents: Results on Eating and Nutrition Behaviour from the Observational KgAS Study

    OpenAIRE

    Torbahn, Gabriel; Gellhaus, Ines; Koch, Benjamin; von Kries, Rüdiger; Obermeier, Viola; Holl, Reinhard W.; Fink, Katharina; van Egmond-Fröhlich, Andreas

    2017-01-01

    Objective: Treatment of paediatric obesity focuses on changes of nutrition and eating behaviour and physical activity. The evaluation of the patient education programme by KgAS was utilised to analyse the association of changes of portion size, eating rate and dietary habits with BMI-SDS reductions. Methods: Patients (n = 297) were examined at the beginning and at the end of treatment and after 1-year follow-up at different out-patient centres. Their parents completed questionnaires including...

  15. Comparison between radiation exposure levels using an image intensifier and a flat-panel detector-based system in image-guided central venous catheter placement in children weighing less than 10 kg

    Energy Technology Data Exchange (ETDEWEB)

    Miraglia, Roberto; Maruzzelli, Luigi; Cortis, Kelvin; Gerasia, Roberta; Maggio, Simona; Luca, Angelo [Diagnostic and Therapeutic Services, Mediterranean Institute for Transplantation and Advanced Specialized Therapies (ISMETT), Palermo (Italy); Piazza, Marcello [Department of Anesthesia, Mediterranean Institute for Transplantation and Advanced Specialized Therapies (ISMETT), Palermo (Italy); Tuzzolino, Fabio [Department of Information Technology, Mediterranean Institute for Transplantation and Advanced Specialized Therapies (ISMETT), Palermo (Italy)

    2014-09-10

    Ultrasound-guided central venous puncture and fluoroscopic guidance during central venous catheter (CVC) positioning optimizes technical success and lowers the complication rates in children, and is therefore considered standard practice. The purpose of this study was to compare the radiation exposure levels recorded during CVC placement in children weighing less than 10 kg in procedures performed using an image intensifier-based angiographic system (IIDS) to those performed in a flat-panel detector-based interventional suite (FPDS). A retrospective review of 96 image-guided CVC placements, between January 2008 and October 2013, in 49 children weighing less than 10 kg was performed. Mean age was 8.2 ± 4.4 months (range: 1-22 months). Mean weight was 7.1 ± 2.7 kg (range: 2.5-9.8 kg). The procedures were classified into two categories: non-tunneled and tunneled CVC placement. Thirty-five procedures were performed with the IIDS (21 non-tunneled CVC, 14 tunneled CVC); 61 procedures were performed with the FPDS (47 non-tunneled CVC, 14 tunneled CVC). For non-tunneled CVC, mean DAP was 113.5 ± 126.7 cGy cm{sup 2} with the IIDS and 15.9 ± 44.6 cGy . cm{sup 2} with the FPDS (P < 0.001). For tunneled CVC, mean DAP was 84.6 ± 81.2 cGy . cm{sup 2} with the IIDS and 37.1 ± 33.5 cGy cm{sup 2} with the FPDS (P = 0.02). The use of flat-panel angiographic equipment reduces radiation exposure in small children undergoing image-guided CVC placement. (orig.)

  16. Milestone Report - Demonstrate Braided Material with 3.5 g U/kg Sorption Capacity under Seawater Testing Condition (Milestone M2FT-15OR0310041 - 1/30/2015)

    Energy Technology Data Exchange (ETDEWEB)

    Janke, Christopher James [ORNL; Das, Sadananda [ORNL; Oyola, Yatsandra [ORNL; Mayes, Richard T [ORNL; Gill, Gary [Pacific Northwest National Laboratory (PNNL); Kuo, Li-Jung [Pacific Northwest National Laboratory (PNNL); Wood, Jordana [Pacific Northwest National Laboratory (PNNL)

    2015-01-01

    This report describes work on the successful completion of Milestone M2FT-15OR0310041 (1/30/2015) entitled, Demonstrate braided material with 3.5 g U/kg sorption capacity under seawater testing condition . This effort is part of the Seawater Uranium Recovery Program, sponsored by the U.S. Department of Energy, Office of Nuclear Energy, and involved the development of new adsorbent braided materials at the Oak Ridge National Laboratory (ORNL) and marine testing at the Pacific Northwest National Laboratory (PNNL). ORNL has recently developed four braided fiber adsorbents that have demonstrated uranium adsorption capacities greater than 3.5 g U/kg adsorbent after marine testing at PNNL. The braided adsorbents were synthesized by braiding or leno weaving high surface area polyethylene fibers and conducting radiation-induced graft polymerization of itaconic acid and acrylonitrile monomers onto the braided materials followed by amidoximation and base conditioning. The four braided adsorbents demonstrated capacity values ranging from 3.7 to 4.2 g U/kg adsorbent after 56 days of exposure in natural coastal seawater at 20 oC. All data are normalized to a salinity of 35 psu.

  17. The design of a community lifestyle programme to improve the physical and psychological well-being of pregnant women with a BMI of 30 kg/m2 or more

    Directory of Open Access Journals (Sweden)

    Chmiel Catherine

    2010-05-01

    Full Text Available Abstract Background Obesity is a global public health issue. Having a BMI of 30 kg/m2 or more (classifying a person as obese at the start of pregnancy is a significant risk factor for maternal and fetal morbidity. There is a dearth of evidence to inform suitable inteventions to support pregnant women with a BMI of 30 kg/m2 or more. Here we describe a study protocol to test the feasibility of a variety of potential healthy lifestyle interventions for pregnant women with a BMI of 30 kg/m2 or more in a community based programme. Methods/Design Four hundred women will be approached to attend a 10-week community lifestyle programme. The programme will be provided as a supplement to standard antenatal care. The programme is multi-faceted, aimed at equipping participants with the skills and knowledge needed to adopt healthy behaviours. The social (cognitive learning theory will be used as a tool to encourage behaviour change, the behaviour change techniques are underpinned by five theoretical components; self-efficacy, outcome expectancies, goal setting, feedback and positive reinforcement. The main outcomes are pregnancy weight gain and caesarean section rate. Other important outcomes include clinical outcomes (e.g., birth weight and psychological outcomes (e.g., well-being. Secondary outcomes include women's experience of pregnancy and health care services, amount of physical activity, food intake and the suitability of the intervention components. A prospective study using quantitative and qualitative methods will inform the feasibility of implementing the community lifestyle programme with pregnant women with a BMI of 30 kg/m2 or more. Mixed methods of data collection will be used, including diaries, focus groups/interviews, pedometers, validated and specifically designed questionnaires, a programme register, weight gain during pregnancy and perinatal outcome data. Discussion Findings from this current feasibility study will inform future

  18. Surgical Results of Laparoscopic Loop Duodenojejunal Bypass with Sleeve Gastrectomy (LDJB-SG in Obese Asians (BMI ≥ 27.5 kg/m2 with Type 2 Diabetes Mellitus (T2DM: A New Promising Bariatric and Metabolic Surgery

    Directory of Open Access Journals (Sweden)

    Voraboot Taweerutchana, M.D. F.R.C.S.T.

    2018-03-01

    Full Text Available Objective: To demonstrate surgical outcomes, safety and complications in obese Asians (BMI > 27.5 kg/m2 who underwent LDJB-SG in our center. Methods: We retrospectively reviewed ninety-one patients who underwent LDJB-SG from October 2011 to March 2014. One-year surgical outcomes regarding the efficacy of weight loss, safety as well as complications of this procedure were demonstrated. Remission of T2DM and co-morbidities resolution after one year were also analyzed. Results: The median duration of T2DM was 60 months and the median operative time was 140 min. Interestingly, the mean/median preoperative BMI, HbA1C and FPG levels dropped significantly from 30.7 kg/m2 , 8.9%, and 139.0 mg% to 23.7 kg/m2 , 6.2%, and 95.0 mg% respectively at 1 year after operation (p<0.001. Furthermore, 61.5% of patients who had completed 1 year follow-up showed complete diabetic remission and 92.3% experienced glycemic control (HbA1c<7% without any medication. The postoperative complications were intra-abdominal bleeding (4.4%, leakage (1.1%, stricture (3.3% and port site hernia (2.2%. Conclusion: LDJB-SG is a safe and feasible bariatric and metabolic surgery, which has demonstrated excellent outcomes in terms of weight reduction, co-morbidities resolution as well as glycemic control in short-term follow-up.

  19. Evaluación y adecuación de un tanque con agitador y chaqueta de vapor de 0,9 mc3 para la pasteurización de 880 kg. de pulpa de fruta

    OpenAIRE

    Espol; Palacios Ponce, Arturo Sócrates

    2015-01-01

    El presente trabajo tiene como finalidad instalar y adecuar un tanque con agitación y chaqueta de vapor para la pasteurización de 800kg por parada de pulpa de fruta con calidad y precio competitivo. Se evaluaron las condiciones operacionales del equipo y se validará la operatividad del mismo en condiciones ideales, posteriormente se determinarán los parámetros de proceso de tiempo y temperatura a través de corridas experimentales in situ. Los valores obtenidos en las pruebas experimentales se...

  20. Efficacy and safety of intravenous alteplase at 0.6 mg/kg more than 3 h after acute middle cerebral artery occlusion in patients selected using perfusion-diffusion mismatch

    International Nuclear Information System (INIS)

    Nakashima, Kazuya; Ohnishi, Hideyuki; Taomoto, Katsushi; Kuga, Yoshihiro; Kodama, Yuuji; Kubota, Hisashi; Tominaga, Takashi; Hayashi, Masato; Miyata, Shiro

    2011-01-01

    Thrombolytic treatment with alteplase at 0.6 mg/kg is approved for use within 3 h of stroke onset in Japan. Thus, only a small percentage of patients can benefit. A meta-analysis and more recent studies suggest a benefit to patients beyond 3 h with alteplase at 0.9 mg/kg or desmoteplase. We assessed the efficacy and safety of intravenous alteplase at 0.6 mg/kg more than 3 h after stroke onset in patients with acute MCA occlusion who were selected using perfusion-diffusion mismatch. Patients with MCA occlusion eligible for intravenous alteplase within 3 h were selected using MRI (diffusion-weighted (DW), fluid-attenuated inversion recovery (FLAIR), T2*, T2)/MR angiography (MRA) and beyond 3 h using evidence of perfusion-diffusion mismatch. Recanalization was evaluated using MRA within 24 h after treatment. Baseline characteristics, recanalization rates, early and late good clinical outcomes (National Institute of Health Stroke Scale (NIHSS) scores of 0 to 1 or 8-points or greater improvement at 24 h and mRS scores of 0 or 1 on the 90th day), symptomatic intracranial hemorrhage (within 72 h) and mortality (at the 90th day) were evaluated for both groups. Also for both groups, the relationships between recanalization and early and late good clinical outcomes were evaluated. 63 patients with MCA occlusion were treated using intravenous alteplase within 3 h (n=53) and beyond 3 h (n=10). No statistically significant differences were found between the two groups for recanalization rates (52.8 vs. 70.0%), early and late good clinical outcomes (early: 41.5 vs. 60.0%, late: 37.7 vs. 50.0%), symptomatic intracranial hemorrhage (0 vs. 0%), or mortality (1.9 vs. 0%). Our data suggest that intravenous alteplase at 0.6 mg/kg beyond 3 h after MCA occlusion for patients selected using perfusion-diffusion mismatch has the same efficacy and safety as treatment within 3 h. However, a larger sample size is needed to evaluate the relationship between recanalization and clinical outcomes

  1. Redução do nível de proteína bruta e suplementação de aminoácidos em rações para suínos machos castrados mantidos em ambiente termoneutro dos 30 aos 60 kg Reduction of crude protein levels of ration with amino acid supplementation to castrated swines maintained in a termoneutral environment from 30 to 60 kg

    Directory of Open Access Journals (Sweden)

    Rony Antonio Ferreira

    2005-04-01

    Full Text Available Este estudo foi conduzido para avaliar a influência da redução do nível de proteína bruta (PB da ração com suplementação de aminoácidos sobre o desempenho de suínos machos castrados (Landrace x Large White mantidos em ambiente termoneutro. Cinqüenta leitões mestiços (peso médio inicial de 30,2 kg foram distribuídos em delineamento experimental inteiramente ao acaso, com cinco tratamentos (17, 16, 15, 14 e 13% PB, cinco repetições e dois animais por unidade experimental. As rações experimentais e a água foram fornecidas à vontade até o final do experimento, quando os animais atingiram o peso médio de 60,2 kg. A temperatura média no interior da sala foi mantida em 22,0ºC e a umidade relativa média em 82,8%, correspondendo a um índice de temperatura de globo e umidade (ITGU de 69,2. A redução do nível de PB da ração influenciou o ganho de peso (GP dos animais; aqueles que consumiram a ração com 17% de PB apresentaram redução significativa no GP em relação aos que receberam as rações com 15 e 14% de PB. O consumo de ração e a conversão alimentar não foram influenciados pelos tratamentos. A redução do nível de PB aumentou as deposições de gordura e de proteína na carcaça e levou à diminuição da excreção de nitrogênio total. O nível de PB da ração para suínos machos dos 30 aos 60 kg mantidos em ambiente termoneutro pode ser reduzido de 17 para 13%, sem influenciar negativamente o desempenho, desde que as rações sejam devidamente suplementadas com aminoácidos essenciais limitantes.An study was conducted to evaluate the influence of reduction of crude protein (CP levels and amino acid supplementation in diets on the performance of castrated swines (Landracex Large White maintained in a termoneutral environment. Fifty crossbreed piglets (average initial body weight of 30.2 kg were allotted to a completely randomized experimental design with five treatments (17, 16, 15, 14 and 13% CP and

  2. UO2 fuel behaviour at rod burn-ups up to 105 MWd/kgHM. A review of 10 years of high burn-up examinations commissioned by AREVA NP

    International Nuclear Information System (INIS)

    Goll, W.; Hoffmann, P.B.; Hellwig, C.; Sauser, W.; Spino, J.; Walker, C.T.

    2007-01-01

    Irradiation experience gained on fuel rods with burn-ups greater than 60 MWd/kgHM irradiated in the Nuclear Power Plant Goesgen, Switzerland, is described. Emphasis is placed on the fuel behaviour, which has been analysed by hot cell examinations at the Institute for Transuranium Elements and the Paul-Scherrer-Institute. Above 60 MWd/kgHM, the so-called high burn-up structure (HBS) forms and the fission gas release increases with burn-up and rod power. Examinations performed in the outer region of the fuel revealed that most if not all of the fission gas created was retained in the HBS, even at 25% porosity. Furthermore, the HBS has a relatively low swelling rate, greatly increased plasticity, and its thermal conductivity is higher than expected from the porosity. The post-irradiation examinations showed that the HBS has no detrimental effects on the performance of stationary irradiated PWR fuel irradiated to the high burn-ups that can be achieved with 5 wt% U-235 enrichment. On the contrary, the HBS results in fuel performance that is generally better than it would have been if the HBS had not formed. (orig.)

  3. The determined exposures by radon in uran ore mining by WISMUT are artifacts; Die ermittelten Radon-Expositionen im Uran-Erzbergbau der WISMUT sind Artefakte

    Energy Technology Data Exchange (ETDEWEB)

    Eigenwillig, Gerd Georg

    2017-04-01

    The uranium ore mining by WISMUT in Object 09 in Saxony and the inhalation exposure by radon ({sup 222}Rn) and its decay products in 1956 are used as example. Measurement results are not available any more. Ultimately only one arithmetic mean is used - a single value for hewer. This single value and models/concepts are applied to estimate exposures for thousands of underground workers. The result of the procedure are artifacts with unknown uncertainties. Nevertheless the artifacts are used uncritically.

  4. Níveis de lisina digestível em rações, utilizando-se o conceito de proteína ideal, para suínos machos castrados de alto potencial genético, dos 30 aos 60 kg Dietary digestible lysine requirements, based on the ideal protein concept, for barrows with high genetic potential from 30 to 60 kg

    Directory of Open Access Journals (Sweden)

    Márvio Lobão Teixeira de Abreu

    2007-02-01

    Full Text Available Objetivou-se determinar o efeito de níveis de lisina digestível, utilizando-se o conceito de proteína ideal, sobre o desempenho e as características de carcaça de 40 leitões machos castrados (peso inicial de 30,02 ± 1,38 kg e peso final 60,44 ± 1,81 kg de alto potencial genético para deposição de carne magra. Os animais foram distribuídos em delineamento de blocos ao acaso, com quatro tratamentos, cinco repetições e dois animais por unidade experimental. Os tratamentos consistiram de uma ração basal (18,08% de PB e 3.250 kcal de EM/kg suplementada com L-lisina HCL, resultando em rações com 0,80; 0,90; 1,00 e 1,10% de lisina digestível. As rações foram suplementadas com níveis crescentes de aminoácidos sintéticos, mantendo-se constantes as relações entre os níveis desses aminoácidos essenciais e os de lisina, com base na digestibilidade verdadeira. Não houve efeito dos tratamentos sobre o consumo de ração, o ganho de peso diário e a concentração de uréia no plasma dos animais. Observou-se comportamento linear da conversão alimentar, que melhorou, e do consumo de lisina digestível diário, que aumentou em função dos níveis de lisina digestível da ração. Os tratamentos não influenciaram as porcentagens de água, proteína e gordura e a deposição de gordura na carcaça dos animais. Os níveis de lisina digestível afetaram de forma linear crescente a deposição de proteína na carcaça. O nível de 1,10% de lisina digestível, correspondente a um consumo de lisina digestível de 21,94 g/dia (3,43 g de Lis/Mcal de EM proporcionou os melhores resultados de desempenho e características de carcaça de suínos machos castrados de alto potencial genético dos 30 aos 60 kg.The effect of increasing dietary digestible lysine levels, based on the ideal protein concept, on performance and carcass characteristics of forty barrows with high genetic potential for lean gain averaging initial and final body weights of

  5. Concentrations in plasma, epithelial lining fluid, alveolar macrophages and bronchial mucosa after a single intravenous dose of 1.6 mg/kg of iclaprim (AR-100) in healthy men.

    Science.gov (United States)

    Andrews, J; Honeybourne, D; Ashby, J; Jevons, G; Fraise, A; Fry, P; Warrington, S; Hawser, S; Wise, R

    2007-09-01

    A validated microbiological assay was used to measure concentrations of iclaprim (AR-100) in plasma, bronchial mucosa (BM), alveolar macrophages (AM) and epithelial lining fluid (ELF) after a single 1.6 mg/kg intravenous 60 min iv infusion of iclaprim. Male volunteers were randomly allocated to three nominal sampling time intervals 1-2 h (Group A), 3-4 h (Group B) and 5.5-7.0 h (Group C) after the start of the drug infusion. Mean iclaprim concentrations in plasma, BM, AM and ELF, respectively, were for Group A 0.59 mg/L (SD 0.18), 0.51 mg/kg (SD 0.17), 24.51 mg/L (SD 21.22) and 12.61 mg/L (SD 7.33); Group B 0.24 mg/L (SD 0.05), 0.35 mg/kg (SD 0.17), 7.16 mg/L (SD 1.91) and 6.38 mg/L (SD 5.17); and Group C 0.14 mg/L (SD 0.05), no detectable level in BM, 5.28 mg/L (SD 2.30) and 2.66 mg/L (SD 2.08). Iclaprim concentrations in ELF and AM exceeded the MIC(90) for penicillin-susceptible Streptococcus pneumoniae (MIC90 0.06 mg/L), penicillin-intermediate S. pneumoniae (MIC90 2 mg/L), penicillin-resistant S. pneumoniae (MIC90 4 mg/L) for 7, 7 and 4 h, respectively, and Chlamydia pneumoniae (MIC90 0.5 mg/L) for 7 h. Mean iclaprim concentrations in ELF exceeded the MIC90 for Haemophilus influenzae (MIC90 4 mg/L) and Moraxella catarrhalis (MIC90 8 mg/L) for up to 4 and 2 h, respectively; in AM the MIC90 was exceeded for up to 7 h. Furthermore, the MIC90 for methicillin-resistant Staphylococcus aureus of 0.12 mg/L was exceeded at all sites for up to 7 h. These data suggest that iclaprim reaches lung concentrations that should be effective in the treatment of community-acquired pneumonia.

  6. Influência da temperatura ambiente sobre o desempenho e os parâmetros fisiológicos de suínos machos castrados dos 30 aos 60 kg

    Directory of Open Access Journals (Sweden)

    Tavares Sandra Lúcia da Silva

    2000-01-01

    Full Text Available RESUMO - O presente trabalho foi realizado para avaliar a influência de ambientes térmicos constantes (termoneutro e calor sobre o desempenho e as variáveis fisiológicas de suínos machos castrados dos 30 aos 60 kg PV. Cem animais foram distribuídos em delineamento em blocos ao acaso, com cinco tratamentos (3100, 3250, 3400, 3550 e 3700 kcal de ED/kg de ração, cinco repetições e dois animais por unidade experimental. Ganho de peso, consumo de ração, proteína e energia, conversão alimentar e eficiência de utilização da proteína e da energia foram reduzidos no ambiente de calor. A relação peso jejum/peso vivo foi maior no ambiente de calor e a relação peso carcaça/peso jejum não foi influenciada pela temperatura ambiente. A taxa de deposição de proteína elevou e a de gordura decresceu com o aumento da temperatura no ambiente. A temperatura ambiente reduziu o peso dos órgãos internos e aumentou a freqüência respiratória, nos animais mantidos no ambiente de calor. Embora a conversão alimentar tenha piorado no ambiente de calor, os animais mantidos neste ambiente apresentaram maior taxa de deposição de proteína na carcaça.

  7. Electrolytic reduction runs of 0.6 kg scale-simulated oxide fuel in a Li{sub 2}O-LiCl molten salt using metal anode shrouds

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Eun-Young, E-mail: eychoi@kaeri.re.kr [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Lee, Jeong; Heo, Dong Hyun; Lee, Sang Kwon [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Jeon, Min Ku [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Department of Quantum Energy Chemical Engineering, University of Science and Technology, Gajeong-ro 217, Yuseong-gu, Daejeon 34113 (Korea, Republic of); Hong, Sun Seok [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Kim, Sung-Wook [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Department of Quantum Energy Chemical Engineering, University of Science and Technology, Gajeong-ro 217, Yuseong-gu, Daejeon 34113 (Korea, Republic of); Kang, Hyun Woo; Jeon, Sang-Chae; Hur, Jin-Mok [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of)

    2017-06-15

    Ten electrolytic reduction or oxide reduction (OR) runs of a 0.6 kg scale-simulated oxide fuel in a Li{sub 2}O-LiCl molten salt at 650 °C were conducted using metal anode shrouds. During this procedure, an anode shroud surrounds a platinum anode and discharges hot oxygen gas from the salt to outside of the OR apparatus, thereby preventing corrosion of the apparatus. In this study, a number of anode shrouds made of various metals were tested. Each metallic anode shroud consisted of a lower porous shroud for the salt phase and an upper nonporous shroud for the gas phase. A stainless steel (STS) wire mesh with five-ply layer was a material commonly used for the lower porous shroud for the OR runs. The metals tested for the upper nonporous shroud in the different OR runs are STS, nickel, and platinum- or silver-lined nickel. The lower porous shroud showed no significant damage during two consecutive OR runs, but exhibited signs of damage from three or more runs due to thermal stress. The upper nonporous shrouds made up of either platinum- or silver-lined nickel showed excellent corrosion resistance to hot oxygen gas while STS or nickel without any platinum or silver lining exhibited poor corrosion resistance. - Highlights: •Electrolytic reduction runs of a 0.6 kg scale-simulated oxide fuel in a Li{sub 2}O-LiCl molten salt at 650 °C were conducted using metal anode shrouds. •Each metallic anode shroud consisted of a lower porous shroud for the salt phase and an upper nonporous shroud for the gas phase. •The upper nonporous shrouds made up of noble metal-lined nickel showed excellent corrosion resistance to hot oxygen gas.

  8. Detection of Respiratory Adverse Events in Pediatric Dental Patients Sedated With 0.75mg/Kg of Midazolam and Oxygen by Continuous Pretracheal Auscultation: A Prospective Randomized Controlled Trial.

    Science.gov (United States)

    Somri, Mostafa; Matter, Ibrahim; Hadjittofi, Christopher; Hoash, Naser; Moaddi, Bian; Kharouba, Johnny; Parisinos, Constantinos A; Peretz, Benjamin

    Sedation is becoming more commonplace for pediatric patients undergoing minor procedures. Fortunately, electronic monitors have contributed to a reduction in the associated respiratory adverse events (RAEs). To test the hypothesis that adding the pretracheal stethoscope (PTS) to standard monitoring methods (SMMs) may improve RAE detection in sedated pediatric dental patients, the frequency of RAEs detected by SMMs (i.e. visual observation, capnography, and pulse oximetry) was compared to that detected by SMMs alongside continuous PTS auscultation. A prospective, randomised, controlled trial was performed with 100 pediatric patient participants of ASA≤2, who were scheduled to receive dental treatment under 0.75 mg/kg and oxygen. Patients were randomised into Groups A (n=50; SMMs) and B (n=50; SMMs+PTS). Inclusion criteria were behavioral management problems and intolerance to dental treatment despite behavioral management techniques or nitrous oxide administration. Exclusion criteria were high-risk conditions for RAEs, altered mental status, gastrointestinal disorders, parental refusal of conscious sedation and failure of previous conscious sedation. An anesthesist was present throughout the dental treatments. RAEs were detected in 10 (20%) and 22(44%) Group A and B patients respectively (p=0.01). The majority of RAEs within Group B were detected by PTS auscultation (n=19). Capnography produced 13 and 15 false-positive results in Groups A and B respectively, whereas the PTS produced 4(8%) false-positive results in Group B (p=0.009). PTS was found to be useful for detecting RAEs during pediatric dental sedation with 0.75mg/kg midazolam and oxygen, in the presence of an anesthesist.

  9. Desempenho e excreção de nitrogênio de leitões dos 9 aos 25 kg alimentados com dietas com diferentes níveis de lisina digestível e proteína bruta Performance and nitrogen excretion for pigs from 9 to 25 kg submitted to the diets with different levels of digestible lysine and crude protein

    Directory of Open Access Journals (Sweden)

    Márcio Gilberto Zangeronimo

    2007-10-01

    Full Text Available Dois experimentos foram conduzidos para avaliar níveis de PB e lisina digestível (LISD na dieta sobre o desempenho e a excreção de nitrogênio (N de leitões na fase inicial. No experimento 1, 80 suínos machos castrados e fêmeas (peso inicial de 9,1 ± 1,2 kg e final de 21,5 ± 4,8 kg, mestiços Landrace × Large White, foram distribuídos em blocos casualizados em esquema fatorial 2 × 4, composto de dois níveis de PB (16 e 18% e quatro níveis de LISD (0,7; 0,9; 1,1 e 1,3% com cinco repetições e dois animais por unidade experimental durante 35 dias. Foram avaliados o ganho de peso médio diário (GPMD, o consumo médio diário de ração (CMDR e a conversão alimentar (CA. No experimento 2, 32 suínos machos castrados (25,0 ± 1,3 kg, provenientes do experimento 1 foram alojados individualmente em gaiolas próprias para estudos de metabolismo (unidade experimental durante 11 dias para determinação dos teores de N ingerido (NI, N nas fezes e N na urina. As rações foram formuladas com milho, farelo de soja e leite em pó modificado e suplementadas com vitaminas e minerais. Os aminoácidos metionina e treonina foram corrigidos de acordo com os níveis de lisina, segundo o conceito de proteína ideal. Não houve efeito da interação LISD × PB sobre nenhuma variável estudada. Os níveis de LISD tiveram efeito quadrático sobre o GMDR e a CA, que foram melhores nos animais alimentados com as dietas com níveis de 1,04 e 1,09% de PB. Os níveis de N nas fezes sofreram efeito linear crescente dos níveis de LISD e PB, enquanto os níveis de N na urina foram afetados de forma quadrática pelos níveis de LISD, com melhor resultado no nível de 1,03% LISD na ração. O CMDR e o nível de N nas fezes não foram influenciados pelos níveis de LISD e PB. O nível de 1,05% LISD em dietas com 16 e 18% PB proporciona melhor desempenho e menor excreção de N nos dejetos de suínos.Two experiments were conducted to evaluate dietary levels of

  10. Comparative calculations and operation-to-PIE data juxtaposition of the Zaporozhye NPP, WWER-1000 FA-E0325 fuel rods after 4 years of operation up to ∼49 MWd/kgU burnup

    International Nuclear Information System (INIS)

    Passage, G.; Stefanova, S.; Scheglov, A.; Proselkov, V.

    2006-01-01

    Operational and PIE data for the Zaporozhe NPP, FA-E0325, WWER-1000 fuel rods were provided in the OECD NEA IFPE Database and were used to perform comparative calculations among several fuel performance codes. The fuel rods had been irradiated for 4 years of operation up to ∼49 MWd/kg U burnup. The fuel rod operation histories are developed for the PINw99, TRANSURANUS (V1M1J03) and TOPRA-2 codes. The initial state fuel rod parameters are analysed and calculations are carried out. The PIE data enable the comparison of experimental measurement with code-calculated values for cladding elongation (49 rods), FGR and gas pressure (35 rods). Cladding diameter creep-down and gap closure results are juxtaposed as well. The capability of the applied codes correctly to predict the WWER fuel rod performance is shown. The WWER-1000 fuel rod data include initial geometrical and design parameters of the fuel rods, as well as description of the operation regime, NPP unit loading history and PIE results at normal conditions. The data are sufficient for modelling all 312 fuel rod and for comparison of calculations with experimental results for a limited number of fuel rods. The comparison between the calculated and measured results discussed in this paper shows that the codes PINw99, TRANSURANUS and TOPRA-2, are capable of adequate predicting the thermophysical and the mechanical performance of the WWER-1000 fuel rods. The PINw99 code predicts conservative BOL FGR values and conservative gas pressure values in the region of burnups higher than 30 MWd/kg U, which can be explained by the underprediction of the cladding gas inner volume and cladding elongation. The improved version PIN2K (not applied in the present study) predicts much better FGR and gas pressure, though, it is still under development in the high burnup FGR modelling part. In the TRANSURANUS code, there are also areas, where refinements are clearly indicated. They are subjects of the ongoing research projects and

  11. The cost-effectiveness of dulaglutide versus liraglutide for the treatment of type 2 diabetes mellitus in Spain in patients with BMI ≥30 kg/m2.

    Science.gov (United States)

    Dilla, Tatiana; Alexiou, Dimitra; Chatzitheofilou, Ismini; Ayyub, Ruba; Lowin, Julia; Norrbacka, Kirsi

    2017-05-01

    Dulaglutide 1.5 mg once weekly is a novel glucagon-like peptide 1 (GLP-1) receptor agonist, for the treatment of type two diabetes mellitus (T2DM). The objective was to estimate the cost-effectiveness of dulaglutide once weekly vs liraglutide 1.8 mg once daily for the treatment of T2DM in Spain in patients with a BMI ≥30 kg/m 2 . The IMS CORE Diabetes Model (CDM) was used to estimate costs and outcomes from the perspective of Spanish National Health System, capturing relevant direct medical costs over a lifetime time horizon. Comparative safety and efficacy data were derived from direct comparison of dulaglutide 1.5 mg vs liraglutide 1.8 mg from the AWARD-6 trial in patients with a body mass index (BMI) ≥30 kg/m 2 . All patients were assumed to remain on treatment for 2 years before switching treatment to basal insulin at a daily dose of 40 IU. One-way sensitivity analyses (OWSA) and probabilistic sensitivity analyses (PSA) were conducted to explore the sensitivity of the model to plausible variations in key parameters and uncertainty of model inputs. Under base case assumptions, dulaglutide 1.5 mg was less costly and more effective vs liraglutide 1.8 mg (total lifetime costs €108,489 vs €109,653; total QALYS 10.281 vs 10.259). OWSA demonstrated that dulaglutide 1.5 mg remained dominant given plausible variations in key input parameters. Results of the PSA were consistent with base case results. Primary limitations of the analysis are common to other cost-effectiveness analyses of chronic diseases like T2DM and include the extrapolation of short-term clinical data to the lifetime time horizon and uncertainty around optimum treatment durations. The model found that dulaglutide 1.5 mg was more effective and less costly than liraglutide 1.8 mg for the treatment of T2DM in Spain. Findings were robust to plausible variations in inputs. Based on these results, dulaglutide may result in cost savings to the Spanish National Health System.

  12. Available phosphorus levels in diets for pigs with high genetic potential for lean meat deposition kept in thermoneutral environment from 15 to 30 kg Níveis de fósforo disponível em rações para suínos de alto potencial genético para deposição de carne magra mantidos em ambiente termoneutro dos 15 aos 30 kg

    Directory of Open Access Journals (Sweden)

    Leandro Alebrante

    2011-02-01

    Full Text Available It was used 72 pigs, 36 castrated males and 36 females, with initial weight of 14.97 ± 0.36 kg to evaluate levels of dietary available phosphorus (aP. The animals were distributed in a completely randomized block design, with six levels of aP (0.107; 0.214; 0.321; 0.428; 0.535 and 0.642%, six replicates and two animals (one castrated male and one female per experimental unit. Air temperature and relative humidity in the room were kept at 24.5 ± 1.2°C and 76.3 ± 8.5%, respectively. The levels of aP influenced both daily feed intake and daily weight gain, which increased in a quadratic way up to the estimated levels of 0.420% and 0.443%, respectively and feed conversion, which improved in a quadratic manner up to the estimated level of 0.461%. It was observed the effects of levels of aP on quantity of phosphorus and ash in the bone, which increased in a quadratic manner up to the estimated levels of 0.525% and 0.520%, respectively. Levels of Ap affected daily protein deposition in the carcass, which increased in a quadratic way up to the estimated level of 0.394%. There was no effect of levels of aP on daily fat carcass deposition. Levels of aP that provided the best results for daily weight gain, feed conversion and bone mineralization in swines with high genetic potential for lean meat kept in thermoneutral environment, from 15 to 30 kg are 0.443, 0.461 and 0.525%, respectively, corresponding to estimated daily intakes of 5.25, 5.45 and 6.14 g of aP.Foram utilizados 72 leitões, 36 machos castrados e 36 fêmeas, com peso inicial de 14,97 ± 0,36 kg para avaliar níveis de fósforo disponível (Pd. Os animais foram distribuídos em delineamento experimental de blocos ao acaso, com seis níveis de Pd (0,107; 0,214; 0,321; 0,428; 0,535 e 0,642%, seis repetições e dois animais (um macho castrado e uma fêmea por unidade experimental. A temperatura interna da sala foi mantida em 24,5 ± 1,2ºC e a umidade relativa do ar em 76,3 ± 8,5%. Os n

  13. Reduction of Portion Size and Eating Rate Is Associated with BMI-SDS Reduction in Overweight and Obese Children and Adolescents: Results on Eating and Nutrition Behaviour from the Observational KgAS Study.

    Science.gov (United States)

    Torbahn, Gabriel; Gellhaus, Ines; Koch, Benjamin; von Kries, Rüdiger; Obermeier, Viola; Holl, Reinhard W; Fink, Katharina; van Egmond-Fröhlich, Andreas

    2017-01-01

    Treatment of paediatric obesity focuses on changes of nutrition and eating behaviour and physical activity. The evaluation of the patient education programme by KgAS was utilised to analyse the association of changes of portion size, eating rate and dietary habits with BMI-SDS reductions. Patients (n = 297) were examined at the beginning and at the end of treatment and after 1-year follow-up at different out-patient centres. Their parents completed questionnaires including estimation of children's portion size, eating rate and frequency of food intake. Associations of 1- and 2-year changes in BMI-SDS and behaviour were calculated for patients with complete data in BMI-SDS, portion size, eating rate, frequency of green, yellow and red food intake (n = 131) by multiple linear regression models. Significant changes were found in the desired direction for BMI-SDS, portion size, eating rate and the intake of unfavourable red food items both after 1 and 2 years as well as for the consumption of favourable green food items after 1 year. Significant positive associations with BMI-SDS reduction after 1 and 2 years were detected for portion size (Cohen's f2 0.13 and 0.09) and eating rate (Cohen's f2 0.20 and 0.10), respectively. Reduced portion sizes and eating rates are associated with BMI-SDS reduction after 1 and 2 years. These findings suggest to focus on appropriate portion sizes and reduced eating rates in patient education programmes. © 2017 The Author(s) Published by S. Karger GmbH, Freiburg.

  14. Reduction of Portion Size and Eating Rate Is Associated with BMI-SDS Reduction in Overweight and Obese Children and Adolescents: Results on Eating and Nutrition Behaviour from the Observational KgAS Study

    Directory of Open Access Journals (Sweden)

    Gabriel Torbahn

    2017-10-01

    Full Text Available Objective: Treatment of paediatric obesity focuses on changes of nutrition and eating behaviour and physical activity. The evaluation of the patient education programme by KgAS was utilised to analyse the association of changes of portion size, eating rate and dietary habits with BMI-SDS reductions. Methods: Patients (n = 297 were examined at the beginning and at the end of treatment and after 1-year follow-up at different out-patient centres. Their parents completed questionnaires including estimation of children's portion size, eating rate and frequency of food intake. Associations of 1- and 2-year changes in BMI-SDS and behaviour were calculated for patients with complete data in BMI-SDS, portion size, eating rate, frequency of green, yellow and red food intake (n = 131 by multiple linear regression models. Results: Significant changes were found in the desired direction for BMI-SDS, portion size, eating rate and the intake of unfavourable red food items both after 1 and 2 years as well as for the consumption of favourable green food items after 1 year. Significant positive associations with BMI-SDS reduction after 1 and 2 years were detected for portion size (Cohen's f2 0.13 and 0.09 and eating rate (Cohen's f2 0.20 and 0.10, respectively. Conclusion: Reduced portion sizes and eating rates are associated with BMI-SDS reduction after 1 and 2 years. These findings suggest to focus on appropriate portion sizes and reduced eating rates in patient education programmes.

  15. Viscosity of aqueous Ni(NO3)2 solutions at temperatures from (297 to 475) K and at pressures up to 30 MPa and concentration between (0.050 and 2.246) mol . kg-1

    International Nuclear Information System (INIS)

    Abdulagatov, I.M.; Zeinalova, A.B.; Azizov, N.D.

    2006-01-01

    Viscosity of nine aqueous Ni(NO 3 ) 2 solutions (0.050, 0.153, 0.218, 0.288, 0.608, 0.951, 1.368, 1.824, and 2.246) mol . kg -1 was measured in the temperature range from (297 to 475) K and at pressures (0.1, 10, 20, and 30) MPa. The measurements were carried out with a capillary flow technique. The total experimental uncertainty of viscosity, pressure, temperature, and composition measurements were estimated to be less than 1.6%, 0.05%, 15 mK, and 0.02%, respectively. All experimental and derived results are compared with experimental and calculated values reported in the literature. Extrapolation of the solution viscosity measurements to zero concentration (pure water values) for the given temperature and pressure are in excellent agreement (average absolute deviation, AAD = 0.13%) with the values of pure water viscosity from IAPWS formulation [J. Kestin, J.V. Sengers, B. Kamgar-Parsi, J.M.H. Levelt Sengers, J. Phys. Chem. Ref. Data 13 (1984) 175-189]. The viscosity data for the solutions as a function of concentration have been interpreted in terms of the extended Jones-Dole equation for strong electrolytes. The values of viscosity A-, B-, and D-coefficients of the extended Jones-Dole equation for the relative viscosity (η/η ) of aqueous Ni(NO 3 ) 2 solutions as a function of temperature are studied. The derived values of the viscosity A- and B-coefficients were compared with the results predicted by Falkenhagen-Dole theory (limiting law) of electrolyte solutions and the values calculated with the ionic B-coefficient data. The measured values of viscosity for the solutions were also used to calculate the effective rigid molar volumes in the extended Einstein relation for the relative viscosity (η/η )

  16. Techniques and results of examination of fission product release from VVER fuel rods with artificial defects and a burnup of ∼60 MWd/kgU at the MIR loop facility

    International Nuclear Information System (INIS)

    Burukin, A.; Goryachev, A.; Ilyenko, S.; Izhutov, A.; Konyashov, V.; Shishin, V.; Shulimov, V.; Luzanova, L.; Miglo, V.

    2009-01-01

    Complex of equipment and several techniques for examination of radioactive fission product release from defective fuel rods were developed, prepared and tested at the PV-1 loop facility of the MIR reactor. During the first test, which was conducted at the PV-1 loop facility and aimed at testing of developed equipment and techniques, measurement of radioactive fission product release from an experimental re-fabricated fuel rod with a burnup of ∼60 MWd/kgU and an artificial defect was performed under design-basis steady-state operating conditions of the VVER-1000 reactor. PIE of all main parameters of the experimental defective fuel rod did not reveal any state peculiarities which could be caused by the artificial defect, i.e. fuel and cladding characteristics in the defect area did not differ from the initial ones (before testing) as well as their characteristics in areas distant from the defect; they are typical for fuel rods with a similar irradiation history in the VVER NPP. The gap in the experimental fuel rod was bridged due to close contact between fuel and cladding at increased fuel burnup; it can appreciable reduce release of radioactive fission products into the PV-1 primary coolant. This suggestion and quantitative characteristics of effect of gap bridging in a high-burnup fuel rod on radioactive fission product release should be investigated during the next tests performed at the PV-1 loop facility. Values of radioactive fission product release measured during the first test at the PV-1 loop facility in the MIR reactor will be used for development of an empirical engineering model in order to take into account high burnup effects and their impact on fission product release from fuel and defective fuel rods

  17. The effects of continuous and intermittent aerobic exercise on lipid profile and fasting blood sugar in women with a body mass index more than 25 kg/m2: a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Alizadeh Z

    2011-07-01

    Full Text Available "n 800x600 Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman","serif";} Background: Obesity is a major health problem all around the world. On the other hand, few people, especially women, are physically active to the levels recommended by Healthy People 2010 web site managed by the U.S. Department of Health and Human Services. The objective of this study was to compare the potential effects of intermittent and continuous exercise programs combined with concurrent calorie restriction diets on lipid profile and fasting blood sugar in overweight and obese females."n"nMethods : Forty-five women with a sedentary life style and a BMI greater than 25 kg/m2, were randomly assigned to one of the three groups (15 subjects in each group: a 40 minutes of medium-intensity intermittent exercise (64-76% of maximal heart rate, 3 bouts per day for 5 days a week, b a single bout of a 40-minute continuous exercise per day for 5 days a week, C the non-exercising control group. A self-monitored calorie restricted diet was recommended to all participants by a dietitian. The lipid profile, fasting blood sugar and blood pressure of all participants were assessed at baseline and 12 weeks after the intervention period."n"nResults : After the intervention, there were no significant differences among the groups in terms of lipid profile [cholesterol (P=0.94, triglyceride (P=0.62] fasting blood sugar (P=0.054, systolic blood pressure (P=0.84 or diastolic blood pressure (P=0.30."n"nConclusion: There seems to be no significant differences between short term continuous and intermittent aerobic

  18. The discovery of uranic rays: short step for Henri Becquerel but a giant step for science

    International Nuclear Information System (INIS)

    Genet, M.

    1998-01-01

    In March 1896, Antoine Becquerel discovered radioactivity. This success is largely due to a tradition of high-level scientific research which prevailed over three generations in the Becquerel family. The circumstances of the discovery and the controversies which followed are reviewed within the framework of their scientific and historical context. (author)

  19. The nature of the emission transition of the octahedral uranate group, ch. 5

    International Nuclear Information System (INIS)

    Hair, J.Th.W. de

    1976-01-01

    Decay times of the green luminescence of U 6+ in oxides with perovskite structure are reported. The influence of the site symmetry is found to be considerable. The temperature dependence of the decay time gives evidence for a coupling of the electronic transition with a phonon of about 200 cm -1 in the excited state. The results show the emission to originate from a parity forbidden transition, vibronically allowed by coupling with vibrations of ungerade symmetry. (Auth.)

  20. Computer assisted optimization of sensitivity of the catalytic polarography wave of uranly/nitrate system

    International Nuclear Information System (INIS)

    Betteridge, D.; Wade, A.P.; Neves, E.A.; Gutz, I.

    1982-01-01

    The utilization of 'Simplex' optimization program, writes in Basic language, used to the study of catalytic polarographic wave procedure the reaction of uranium (III) with nitrate in acidic medium at the mercury electrode/solution interface is described. This 'Simplex' optimization requires a much smaller number of experiments to reach an improved condition without increase of the number of trial and error experiments. (C.G.C.) [pt

  1. Simulation of Supersonic Base Flows: Numerical Investigations Using DNS, LES, and URANS

    Science.gov (United States)

    2006-10-01

    global instabilities were found for a two-dimensional bluff body with a blunt base by Hannemann & Oertel (1989). Oertel (1990) found that the... Hannemann , K. & Oertel, H. 1989 Numerical simulation of the absolutely and convectively unstable wake. J. Fluid Mech. 199, 55–88. Harris, P. J. 1997

  2. URANS simulations of the tip-leakage cavitating flow with verification and validation procedures

    Science.gov (United States)

    Cheng, Huai-yu; Long, Xin-ping; Liang, Yun-zhi; Long, Yun; Ji, Bin

    2018-04-01

    In the present paper, the Vortex Identified Zwart-Gerber-Belamri (VIZGB) cavitation model coupled with the SST-CC turbulence model is used to investigate the unsteady tip-leakage cavitating flow induced by a NACA0009 hydrofoil. A qualitative comparison between the numerical and experimental results is made. In order to quantitatively evaluate the reliability of the numerical data, the verification and validation (V&V) procedures are used in the present paper. Errors of numerical results are estimated with seven error estimators based on the Richardson extrapolation method. It is shown that though a strict validation cannot be achieved, a reasonable prediction of the gross characteristics of the tip-leakage cavitating flow can be obtained. Based on the numerical results, the influence of the cavitation on the tip-leakage vortex (TLV) is discussed, which indicates that the cavitation accelerates the fusion of the TLV and the tip-separation vortex (TSV). Moreover, the trajectory of the TLV, when the cavitation occurs, is close to the side wall.

  3. Thermal conductivity and thermal expansion of hot-pressed trisodium uranate (Na3UO4)

    International Nuclear Information System (INIS)

    Hofman, G.L.; Bottcher, J.H.; Buzzell, J.A.; Schwartzenberger, G.M.

    1986-01-01

    Thermal conductivity and thermal expansion of Na 3 UO 4 prepared by two different reaction processes were determined over a temperature range of 20-1000 0 C. Compositional differences in the samples resulting from the different reaction processes have a pronounced effect on thermal expansion and on thermal conductivity below 500 0 C. Above 500 0 C, these compositional differences in the thermal conductivities decrease. (orig.)

  4. Interactions of uranium (VI) with biofilms; Wechselwirkung von Uran(VI) mit Biofilmen

    Energy Technology Data Exchange (ETDEWEB)

    Brockmann, Sina; Arnold, Thuro; Bernhard, Gert

    2013-07-01

    In this study a detailed investigation was made of natural biofilms from two uranium-contaminated sites, namely the former uranium mine in Koenigstein (Saxony) and the ground surface of the former Grassenhalde tailing heap in Thuringia. A predominance of uranyl sulphate (UO{sub 2}SO{sub 4}), a highly mobile, solute uranium species, was found in the mine waters of both sites. In this study an investigation was made of the capacity of Euglena mutabilis cells for bioaccumulation of uranium in a pH range of 3 to 6 using living cells and sodium perchlorate (9 g/l) or sodium sulphate (3.48 g/l) as background media. At acidic pH values in the range from 3 to 4 it was possible to remove more than 90% of the original uranium content from the test solution regardless of the medium being used. The speciation of the uranium accumulated in the Euglena cells was investigated by laser-induced fluorescence spectroscopy (LIFS). It was found that a new uranium species of low variability forms on the cells independent of the background medium, state of life of the cells and pH value. By comparing the data from the LIFS measurements with reference values it was possible to narrow down the identity of the uranium species to one bonded to (organo) phosphate and/or carboxylic functional groups. Using time-resolved FT-IR spectroscopy it was possible to demonstrate carboxylic bonding of uranium to dead cells. However it was not possible to exclude (organo) complexation with this method. An investigation of the specific location of the uranium on or in the cells using combined CLSM/LIFS technology yielded first indications of intracellular accumulation of uranium in the living cells. Supplementary TEM/EDX measurements confirmed the intracellular uptake, showing it to occur in round to oval cell organelles which are thought to be vacuoles or vacuole-like vesicles. It was not possible to detect uranium on dead cells using these methods. This points to passive, homogeneously distributed biosorption of uranium at available binding sites on the surface of the dead cells.

  5. Depleted uranium - influence on the health and environment; Ochudobneny uran - vplyva na zdravie a zivotne prostredie

    Energy Technology Data Exchange (ETDEWEB)

    Rosskopfova, O [Katedra jadrovej chemie, Prirodovedecka fakulta, Univerzita Komenskeho, Bratislava (Slovakia)

    2002-07-01

    The uranium as radioactive element occurs in low concentrations in all components of environment. In the sample of natural uranium the isotope U-235 has the highest share (99.27 weight per cent). Chemical toxicity of uranium is comparable with toxicity of the elements like As and Pb. Depleted uranium is adjoining product in the production of enriched uranium, which is required in the production of the nuclear fuel and in the production of material used in nuclear arms. It mainly includes isotope U-238, and the content of isotopes U-235 and U-234 is sharply lowered. According to NRC depleted uranium is defined like uranium, in which percentile share of isotope U-235 is less than 0.711 weight percent. The activity of depleted uranium from viewpoint of external irradiation does not represent higher risk. Much higher risk for man represent the neurotoxic effects of uranium, which can get into human body by inhaling of dispersed particles, of contaminated dust and aerosols from atmosphere or by consumption of contaminated foodstuffs and water. Basic dangerous of irradiation by depleted uranium are mainly aerosols, which increase the probability of occurrence of lung cancer. The next dangerous is the damage of another organs like kidneys, liver and bones, where these aerosols are transported by blood like oxides from the lungs. In the environmental parts because of presence of natural uranium the depleted uranium is difficultly identifiably by standard detective methods. Thus it is necessary to use suitable radiochemical separative methods in combination with suitable detective method. (author)

  6. Uranium production, acquisition and exploration in North America. Uran in Nordamerika: Produktion - Akquisition - Exploration

    Energy Technology Data Exchange (ETDEWEB)

    Akin, H; Kuchelka, R

    1991-06-01

    Uranerz Exploration and Mining Limited (UEM or Uranerz), the Canadian subsidiary of Uranerzbergbau GmbH, Bonn, has become a significant producer of uranium concentrates in the world during the last 20 years. The first step in this development was the acquisition of a large share in the former Rabbit Lake deposit and mill in 1970. Five years later UEM discovered the famous Key Lake deposit, containing the Gaertner and Deilmann orebodies, which today form the basis of the single largest and probably most economic uranium mine and mill complex in the world. Recently, the acquisition of a share in the 'new' Rabit Lake mill together with major adjacent uranium deposits at Collins Bay and Eagle Point has been concluded. In the United States, where there is less hope for large rich uranium deposits to be found, Uranerz has concentrated on the development of in situ leaching technology which enables low cost production from relatively low grade deposits. The latest exploration success in Canada was achieved in the McArthur River Joint Ventures by drilling an underground uranium deposit, which can be compared with Key Lake in grade and size. This will further improve the reserve base and ensure that Uranerz will maintain its position in a growing uranium market even after the turn of the century. (orig.).

  7. Colorimetric determination of the fluoride ion - application to uranium metal and to uranous fluoride

    International Nuclear Information System (INIS)

    Hering, H.; Hure, J.; Legrand, S.

    1949-12-01

    In the determination described for fluoride in U metal, the U is brought into H 2 SO 4 solution by anodic oxidation, the fluo-silicic acid is distilled by entrainment in water vapor, and the F ion is determined in the distillate by using the fact that it complexes Zr and thus prevents the formation of the Zr-alizarin S lake. For F ion in UF 4 , the compound is dissolved in a Na 2 CO 3 -H 2 O 2 mixture, and F is determined in the solution by the colorimetric method described. (author)

  8. 2D URANS simulation of aerodynamic loads on a pitching airfoil: Impact of computational parameters

    NARCIS (Netherlands)

    Geng, F.; Kalkman, I.M.; Suiker, A.S.J.; Blocken, B.J.E.

    2017-01-01

    A numerical study of aerodynamic loads on pitching airfoils using Computational Fluid Dynamics (CFD) is challenging due complicated airfoil-vortex interactions and the possible occurrence of dynamic stall. In the latter case the combination of boundary layer transitions and airfoil oscillations

  9. Supercritical fluid extraction of silicone oil from uranate microspheres prepared by sol-gel process

    International Nuclear Information System (INIS)

    Kumar, R.; Venkatakrishnan, R.; Sivaraman, N.; Srinivasan, T.G.; Vasudeva Rao, P.R.

    2005-01-01

    Supercritical fluid extraction of silicone oil from urania microspheres prepared through sol-gel route was investigated. The influence of pressure, temperature, and flow rate on the extraction efficiency was studied. Experimental conditions were optimised for the complete removal of silicone oil from urania microspheres. (author)

  10. Operating manual for 200 kG pulse magnet

    International Nuclear Information System (INIS)

    Hemachalam, K.

    1976-09-01

    High field magnets have become necessary for measuring properties of superconducting materials. The generation of steady high magnetic field by conventional copper magnets or by superconducting magnets requires great cost for construction as well as operation. Transient fields, however, can be produced less expensively. For this reason, it has been customary to measure high-field properties of superconductors in pulsed magnets. The objective of the report given is two-fold: (1) to describe a pulse magnet apparatus in use at this Laboratory, and (2) to present an operating procedure to measure current-carrying behavior of superconductors as a function of magnetic field

  11. Intraoperative glucose management in children < 1 year or < 10 kg ...

    African Journals Online (AJOL)

    This study aimed to analyse the current practice of ... The brain derives 90% of its energy from glucose during times of ... Paediatric Anaesthetists, recommend the use of an isotonic ... in small infants, and glucose is monitored in critically ill children or children ... This observational study was done following institutional review.

  12. Basement configuration of KG offshore basin from magnetic anomalies

    Indian Academy of Sciences (India)

    of charnockites of neighbouring EGMB and onshore K–G basin areas indicates that EGMB geology. (charnockites ... Marine magnetic anomalies; offshore K–G basin; magnetic basement; extension of EGMB geology; continent– oceanic boundary. ..... of India; J. Australian Petroleum Exploration Association. 14 29–41.

  13. Homotopy Type of Neighborhood Complexes of Kneser Graphs, KG

    Indian Academy of Sciences (India)

    3

    2017-04-12

    Apr 12, 2017 ... Abstract. Schrijver identified a family of vertex critical subgraphs of the. Kneser graphs called the stable Kneser graphs SGn,k. Björner and de Longueville proved that the neighborhood complex of the stable. Kneser graph SGn,k is homotopy equivalent to a k−sphere. In this article, we prove that the ...

  14. Intraoperative glucose management in children < 1 year or < 10 kg ...

    African Journals Online (AJOL)

    The intraoperative management of intravenous dextrose administration and blood glucose monitoring was at the discretion of the attending anaesthetists. Data collected included patient demographics, period of starvation, dose of dextrose administered and blood glucose measurements taken. Results: Nine infants had at ...

  15. Pilot production of 325 kg of uranium carbide

    International Nuclear Information System (INIS)

    Clozet, C.; Dessus, J.; Devillard, J.; Guibert, M.; Morlot, G.

    1969-01-01

    This report describes the pilot fabrication of uranium carbide rods to be mounted in bundles and assayed in two channels of the EL 4 reactor. The fabrication process includes: - elaboration of uranium carbide granules by carbothermic reduction of uranium dioxide; - electron bombardment melting and continuous casting of the granules; - machining of the raw ingots into rods of the required dimensions; finally, the rods will be piled-up to make the fuel elements. Both qualitative and quantitative results of this pilot production chain are presented and discussed. (authors) [fr

  16. Basement configuration of KG offshore basin from magnetic anomalies

    Digital Repository Service at National Institute of Oceanography (India)

    Subrahmanyam, V.; Swamy, K.V.; Raj, N.

    to Dept. of Science & Technology, New Delhi for granting the Junior Research Fel- lowship through Inspire Programme. This is NIO (CSIR) contribution no. 7132. References Aftalion M, Bowes D R, Dash B and Dempster T J 1988 Late proterozoic charnockites... anomaly map in figure 1. Keywords. Marine magnetic anomalies; offshore K–G basin; magnetic basement; extension of EGMB geology; continent– oceanic boundary. J. Earth Syst. Sci. 125, No. 3, April 2016, pp. 663–668 c© Indian Academy of Sciences 663 664 V...

  17. Sixteen silver wires to assemble 350 kg of copper

    CERN Multimedia

    Alizée Dauvergne

    2010-01-01

    Assembly of the first radiofrequency quadrupole (RFQ) module for the future LINAC4 linear accelerator has just been completed by CERN's Assembly and Forming section (EN) using a technique called vacuum brazing which involves furnace-baking at 800°C and micron precision, leaving absolutely nothing to chance. Serge Mathot (EN/MME) and his team used the vacuum brazing technique to assemble the first RFQ module for the future LINAC4. The future LINAC4 will use four types of accelerating structures, each playing a different role in increasing the energy of the beam. The first of these are the radiofrequency quadrupole modules (RFQ, see box) which accelerate and focus the beam from the start. "The modules are complex items. Each had to be produced in 4 parts, corresponding to the 4 electrodes," explains physicist Serge Mathot, a vacuum brazing specialist in the Engineering (EN) Department. "To work properly, these modules must be aligned to a precision of a few microns. It...

  18. [Postoperative management of patients with BMI > 40 kg / m2].

    Science.gov (United States)

    Kaffarnik, M; Utzolino, S

    2009-02-01

    Bariatric surgery, especially in the morbidly obese, can be associated with serious postoperative problems. Apart from surgical complications requiring reoperation, pre-existing disease can worsen during the postoperative period. Bariatric patients require particular therapeutic approaches such as adapted fluid and pain management, management of obstructive sleep apnoea-hypopnea, early ambulation and measures for preventing pressure ulcers. Another challenging issue is the early identification and management of postoperative intraabdominal sepsis (IAS) before the onset of organ dysfunction. Early and frequent ambulation is thought to reduce risk of pressure ulcers, deep vein thrombosis, resedation, pain, pneumonia and atelectasis. To prevent spine injury of health care workers it is necessary to provide appropriate support with special beds, lifting and transfer devices.

  19. Densities and apparent molar volumes of atmospherically important electrolyte solutions. 2. The systems H(+)-HSO4(-)-SO4(2-)-H2O from 0 to 3 mol kg(-1) as a function of temperature and H(+)-NH4(+)-HSO4(-)-SO4)2-)-H2O from 0 to 6 mol kg(-1) at 25 °C using a Pitzer ion interaction model, and NH4HSO4-H2O and (NH4)3H(SO4)2-H2O over the entire concentration range.

    Science.gov (United States)

    Clegg, S L; Wexler, A S

    2011-04-21

    A Pitzer ion interaction model has been applied to the systems H(2)SO(4)-H(2)O (0-3 mol kg(-1), 0-55 °C) and H(2)SO(4)-(NH(4))(2)SO(4)-H(2)O (0-6 mol kg(-1), 25 °C) for the calculation of apparent molar volume and density. The dissociation reaction HSO(4)(-)((aq)) ↔ H(+)((aq)) + SO(4)(2-)((aq)) is treated explicitly. Apparent molar volumes of the SO(4)(2-) ion at infinite dilution were obtained from part 1 of this work, (1) and the value for the bisulfate ion was determined in this study from 0 to 55 °C. In dilute solutions of both systems, the change in the degree of dissociation of the HSO(4)(-) ion with concentration results in much larger variations of the apparent molar volumes of the solutes than for conventional strong (fully dissociated) electrolytes. Densities and apparent molar volumes are tabulated. Apparent molar volumes calculated using the model are combined with other data for the solutes NH(4)HSO(4) and (NH(4))(3)H(SO(4))(2) at 25 °C to obtain apparent molar volumes and densities over the entire concentration range (including solutions supersaturated with respect to the salts).

  20. Avaliação da tolerância e nefrotoxicidade do antimonial pentavalente administrado na dose de 40mg Sb v/kg/dia, de 12/12h, por 30 dias na forma cutaneo-mucosa de leishmaniose

    Directory of Open Access Journals (Sweden)

    Raimunda N.R. Sampaio

    1997-12-01

    Full Text Available Foi avaliada a função renal de 11 pacientes com leishmaniose cutâneo-mucosa tratados com antimonial pentavalente na dose de 40mg SbV/kg/dia aplicada de 12/12 horas, em esquema contínuo, durante trinta dias. No estudo, um paciente apresentou insuficiência renal reversível e dois desenvolveram alterações enzimáticas hepáticas e eletrocardiográficas sendo o esquema terapêutico interrompido. Nos demais pacientes observou-se efeitos nefrotóxicos tais como diminuição da taxa de filtração glomerular, diminuição da capacidade de concentração urinária, avaliada por um jejum hídrico de 16 horas e aumento na fração de excreção de sódio. No exame do sedimento urinário observou-se um aumento no número de leucócitos e cilindros. Os resultados encontrados neste estudo sugerem que o tratamento com antimonial pentavalente na dose de 40mg SbV/kg/dia foi menos tolerado em virtude de seus efeitos tóxicos, não parecendo apresentar índice de cura superior ao esquema atualmente preconizado de 20mg SbV/kg/dia.The renal function of eleven patients with mucocutaneous leishmaniasis was analyzed in a prospective study realized at the School Hospital of University of Brasília. The patients were treated with doses of 40mg/kg/day of pentavalent antimony (SbV, in a continuous scheme during thirty days. In this study three patients were excluded, one patient with reversible renal failure and two patients with hepatic and cardiac malfunctions. In the other eight patients, severe nephrotoxics effects were observed, like reduction of glomerular filtration rate, reduction of the urinary concentration capacity, evaluated by a sixteen hours hydric fasting and an increase of sodium fractional excretion. An increase in the number of leucocytes and cylinders were observed at the urinary sediment exam. Finally, the results shows that the treatment with pentavalent antimony in doses of 40mg Sb/kg/day was less tolerated on account of its renal toxics

  1. Utilização do milheto (Pennisetum glaucum (L. R. Brown grão na alimentação de suínos na fase inicial (15-30kg de peso vivo Utilization of pearl millet (Pennisetum glaucum (L. R. Brown grain on feeding of starting pigs

    Directory of Open Access Journals (Sweden)

    Alexandre Orio Bastos

    2004-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a utilização do milheto (Pennisetum glaucum, (L. R. Brown na alimentação de suínos na fase inicial (15 aos 30kg de peso vivo. Foi conduzido um experimento de desempenho, utilizando-se 48 leitões híbridos comerciais, sendo metade machos e metade fêmeas, com peso inicial de 14,9 ± 2,01kg. Utilizou-se a variedade IAPAR-IA98301 de milheto (MS: 90,61%; PB: 11,64%; Ca: 0,05%, P: 0,29% e 3.181kcal ED kg-1. Foi utilizado o delineamento de blocos casualizados, com quatro tratamentos (0, 20, 40 e 60% de inclusão de milheto, seis repetições e dois animais por unidade experimental. A inclusão do milheto em rações para suínos na fase inicial não influenciou o consumo diário de ração, o ganho diário de peso, a conversão alimentar e o custo em ração por quilograma de suíno produzido. Em uma relação onde o preço do milheto corresponde a 70% do preço do milho, o custo em ração do quilograma de suíno produzido também não foi alterado. Os resultados sugerem que o milheto IAPAR-IA98301 pode ser incluído em rações de suínos na fase inicial até o nível de 60%.The objective of this study was to evaluate the pearl millet (Pennisetum glaucum (L. R. Brown utilization on feeding of initial pigs (15-30kg of body weight. A performance trial was conducted by using 48 crossbred pigs (a half barrows and a half females with initial weight of 14.93 + 2.01kg with the use of IAPAR-IA98301 species of pearl millet (DM 90.61%; CP 11.64%; Ca 0.05%; P 0.29% and 3,182 kcal DE kg-1. A randomized blocks designwas used, with four treatments (0; 20; 40 and 60% of pearl millet inclusion, with six repetitions and two animals per experimental unit. The pearl millet inclusion on starting pigs diets did not influence on daily feed intake, average daily gain, feed:gain ratio and cost in diet per kilogram of pig produced during the initial phase. The results, suggest that the pearl millet IAPAR-IA98301 can be included in

  2. U-rans model for the prediction of the acoustic sound power generated in a whistling corrugated pipe

    NARCIS (Netherlands)

    Golliard, J.; González Díez, N.; Belfroid, S.P.C.; Nakiboǧlu, G.; Hirschberg, A.

    2013-01-01

    Corrugated pipes, as used in flexible risers for gas production or in domestic appliances, can whistle when a flow is imposed through the pipe. Nakiboglu et al [1, 2] have developed a method to compute the acoustic source term for axi-symmetric cavities. The method is based on the resolution of

  3. Phytoplankton pigments and macrobenthos in nearshore waters off an oil terminal at Uran (Maharashtra), west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    JiyalalRam, M.; Mehta, P.; Govindan, K.

    )) whereas the biomass ws comparable between the two zones. The subtidal regions had poor faunal group diversity, faunal density (av 250 m sup(-2)) and biomass (av 0.2 mg sup(-2)) associated with clayey silt bottom enriched with organic matter (3...

  4. Integral Method for the Assessment of U-RANS Effectiveness in Non-Equilibrium Flows and Heat Transfer

    Science.gov (United States)

    Pond, Ian; Edabi, Alireza; Dubief, Yves; White, Christopher

    2015-11-01

    Reynolds Average Navier Stokes (RANS) modeling has established itself as a critical design tool in many engineering applications, thanks to its superior computational efficiency. The drawbacks of RANS models are well known, but not necessarily well understood: poor prediction of transition, non equilibrium flows, mixing and heat transfer, to name the ones relevant to our study. In the present study, we use a DNS of a reciprocating channel flow driven by an oscillating pressure gradient to test several low- and high-Reynolds RANS models. Temperature is introduced as a passive scalar to study heat transfer modeling. Low-Reynolds models manage to capture the overall physics of wall shear and heat flux well, yet with some phase discrepancies, whereas high Reynolds models fail. Under the microscope of the integral method for wall shear and wall heat flux, the qualitative agreement appears more serendipitous than driven by the ability of the models to capture the correct physics. The integral method is shown to be more insightful in the benchmarking of RANS models than the typical comparisons of statistical quantities. The authors acknowledges the support of NSF and DOE under grant NSF/DOE 1258697 (VT) and 1258702 (NH).

  5. LES And URANS simulations of the swirling flow in a dynamic model of a uniflow-scavenged cylinder

    DEFF Research Database (Denmark)

    Hemmingsen, Casper Schytte; Ingvorsen, Kristian Mark; Mayer, Stefan

    2016-01-01

    The turbulent swirling flow in a uniflow-scavenged two-stroke engine cylinder is investigated using computational fluid dynamics. The investigation is based on the flow in a scale model with a moving piston. Two numerical approaches are tested; a large eddy simulation (LES) approach with the wall...

  6. The discovery of uranic rays: a short step for Henri Becquerel but a giant step for science

    International Nuclear Information System (INIS)

    Genet, M.

    1995-01-01

    In March 1896, Antoine Henri Becquerel discovered radioactivity. This success is largely due to a tradition of high-level scientific research which prevailed over three generations in the Becquerel family. The circumstances of the discovery and the controversies which followed are reviewed within the framework of their scientific and historical context. (orig.)

  7. Níveis de lisina para leitoas selecionadas geneticamente para deposição de carne magra, dos 30 aos 60 kg, mantendo constante a relação entre lisina e metionina+cistina, treonina, triptofano, isoleucina e valina

    Directory of Open Access Journals (Sweden)

    Fontes Dalton de Oliveira

    2000-01-01

    Full Text Available Foram utilizadas 40 leitoas mestiças (Hampshire, Landrace Belga, Pietran com peso inicial médio de 30,1±1,25 kg e alto potencial genético para deposição de carne magra na carcaça, para avaliar diferentes níveis de lisina. Foi usado delineamento de blocos ao acaso com quatro tratamentos, cinco repetições e dois animais por unidade experimental. Os tratamentos corresponderam a uma ração basal com 17,5% de proteína bruta, suplementada com quatro níveis de L-lisina HCl, resultando em rações com 1,00; 1,10; 1,20; e 1,30% de lisina. As rações foram suplementadas com níveis crescentes de treonina, metionina, isoleucina, valina e triptofano, resultando em rações nas quais a relação entre estes aminoácidos e a lisina se manteve constante em 67, 62, 60, 68 e 19%, respectivamente, com base na digestibilidade verdadeira. Não se observou efeito dos tratamentos sobre consumo de ração, ganho de peso diário e concentração de uréia no soro sangüíneo dos animais, entretanto, os animais pareceram ter atingido o potencial genético máximo para ganho de peso no nível de lisina de 1,10% (0,329%/Mcal de ED, correspondente a um consumo de lisina de 22 g/dia. Observou-se efeito linear sobre o consumo de lisina diário, que aumentou, e a conversão alimentar, que reduziu com o aumento do nível de lisina da ração. O nível de 1,30% (0,389%/Mcal de ED ou 1,19% (0,356%/Mcal de ED, correspondente a um consumo de lisina total e digestível, respectivamente, de 24 e 22,1 g/dia, proporcionou os melhores resultados de conversão alimentar de leitoas dos 30 aos 60 kg, quando se utilizou o conceito de proteína ideal na formulação das rações experimentais.

  8. Middle infrared (wavelength range: 8 μm-14 μm) 2-dimensional spectroscopy (total weight with electrical controller: 1.7 kg, total cost: less than 10,000 USD) so-called hyperspectral camera for unmanned air vehicles like drones

    Science.gov (United States)

    Yamamoto, Naoyuki; Saito, Tsubasa; Ogawa, Satoru; Ishimaru, Ichiro

    2016-05-01

    We developed the palm size (optical unit: 73[mm]×102[mm]×66[mm]) and light weight (total weight with electrical controller: 1.7[kg]) middle infrared (wavelength range: 8[μm]-14[μm]) 2-dimensional spectroscopy for UAV (Unmanned Air Vehicle) like drone. And we successfully demonstrated the flights with the developed hyperspectral camera mounted on the multi-copter so-called drone in 15/Sep./2015 at Kagawa prefecture in Japan. We had proposed 2 dimensional imaging type Fourier spectroscopy that was the near-common path temporal phase-shift interferometer. We install the variable phase shifter onto optical Fourier transform plane of infinity corrected imaging optical systems. The variable phase shifter was configured with a movable mirror and a fixed mirror. The movable mirror was actuated by the impact drive piezo-electric device (stroke: 4.5[mm], resolution: 0.01[μm], maker: Technohands Co.,Ltd., type:XDT50-45, price: around 1,000USD). We realized the wavefront division type and near common path interferometry that has strong robustness against mechanical vibrations. Without anti-mechanical vibration systems, the palm-size Fourier spectroscopy was realized. And we were able to utilize the small and low-cost middle infrared camera that was the micro borometer array (un-cooled VOxMicroborometer, pixel array: 336×256, pixel pitch: 17[μm], frame rate 60[Hz], maker: FLIR, type: Quark 336, price: around 5,000USD). And this apparatus was able to be operated by single board computer (Raspberry Pi.). Thus, total cost was less than 10,000 USD. We joined with KAMOME-PJ (Kanagawa Advanced MOdule for Material Evaluation Project) with DRONE FACTORY Corp., KUUSATSU Corp., Fuji Imvac Inc. And we successfully obtained the middle infrared spectroscopic imaging with multi-copter drone.

  9. Thermodynamics of proton dissociations from aqueous glycine at temperatures from 278.15 to 393.15 K, molalities from 0 to 1.0 mol . kg-1, and at the pressure 0.35 MPa: Apparent molar heat capacities and apparent molar volumes of glycine, glycinium chloride, and sodium glycinate

    International Nuclear Information System (INIS)

    Ziemer, S.P.; Niederhauser, T.L.; Merkley, E.D.; Price, J.L.; Sorenson, E.C.; McRae, B.R.; Patterson, B.A.; Origlia-Luster, M.L.; Woolley, E.M.

    2006-01-01

    We have measured the densities of aqueous solutions of glycine, glycine plus equimolal HCl, and glycine plus equimolal NaOH at temperatures 278.15 ≤ T/K ≤ 368.15, molalities 0.01 ≤ m/mol . kg -1 ≤ 1.0, and at p = 0.35 MPa, using a vibrating tube densimeter. We have also measured the heat capacities of these solutions at 278.15 ≤ T/K ≤ 393.15 and at the same m and p using a fixed-cell differential scanning calorimeter. We used the densities to calculate apparent molar volumes V φ and the heat capacities to calculate apparent molar heat capacities C p,φ for these solutions. We used our results and values of V φ (T, m) and C p,φ (T, m) for HCl(aq), NaOH(aq), NaCl(aq) from the literature to calculate parameters for Δ r C p,m (T, m) for the first and second proton dissociations from protonated aqueous cationic glycine. We then integrated this value of Δ r C p,m (T, m) in an iterative algorithm, using Young's Rule to account for the effects of speciation and chemical relaxation on the observed V φ and C p,φ of the solutions. This procedure yielded parameters for V φ (T, m) and C p,φ (T, m) for glycinium chloride {H 2 Gly + Cl - (aq)} and sodium glycinate {Na + Gly - (aq)} which successfully modeled our observed results. We have then calculated values of Δ r C p,m , Δ r H m , Δ r V m , and pQ a for the first and second proton dissociations from protonated aqueous glycine as functions of T and m

  10. Fallstudie Brose Fahrzeugtechnik GmbH & Co. KG - Verbesserung des Anfrageprozesses im Einkauf der Brose Fahrzeugtechnik GmbH & Co. KG

    OpenAIRE

    Senger, Enrico; Österle, Hubert

    2003-01-01

    Die Brose Fahrzeugtechnik liefert Fensterheber, Türschlösser, Türsysteme und Sitzverstel-lungen an die Automobilindustrie. Sie realisierte einen kooperativen Anfrageprozess mit ihren externen Zulieferern und ihren drei internen in die Beschaffung involvierten Bereiche (Zentraleinkauf, Kundenteameinkäufer und Werkseinkauf). Die Anfragen gehen von den internen Bereichen elektronisch an die potentiellen Lieferanten. Im Gegensatz zu früher besitzen alle internen Bereiche vollständige Transparenz ...

  11. 77 FR 56756 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2012-09-14

    ... booster rotors and rework or replacement of them as terminating action to the repetitive inspections. We... persons on the ground. To address this condition, RRD has developed an inspection program and a rework for... and if any crack is found, replacement with a serviceable part. This AD also requires rework of all...

  12. Administering ketoconazole (25mg/Kg) For 14 Days in male wistar ...

    African Journals Online (AJOL)

    studies conducted on the effects of stress on immune responses) ... effect) and anxiety at elevated plus-maze test. [15]. ... with 0.4 megapixel digital camera built into the microscope .... thymus at any age can be reversed, and the thymus can ...

  13. Opto-chemical response of Makrofol-KG to swift heavy ion irradiation

    Indian Academy of Sciences (India)

    transform infrared spectroscopy; atomic force spectroscopy. PACS Nos ... [8–10], electron beam [11], neutrons [12] and heavy ions [13]. The present .... Makrofol detector with proton and Xe ions, respectively and reported that at higher doses.

  14. 78 FR 2195 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbofan Engines

    Science.gov (United States)

    2013-01-10

    ... of silver chloride-induced stress corrosion cracking of the HP compressor stages 1 to 6 rotor disc...: Silver chloride-induced stress corrosion cracking was identified during overhaul of a BR700-715 engine... send any written relevant data, views, or arguments about this AD. Send your comments to an address...

  15. Proton absorbed dose distribution in human eye simulated by SRNA-2KG code

    International Nuclear Information System (INIS)

    Ilic, R. D.; Pavlovic, R.

    2004-01-01

    The model of Monte Carlo SRNA code is described together with some numerical experiments to show feasibility of this code to be used in proton therapy, especially for tree dimensional proton absorption dose calculation in human eye. (author) [sr

  16. Distribution of absorbed dose in human eye simulated by SRNA-2KG computer code

    International Nuclear Information System (INIS)

    Ilic, R.; Pesic, M.; Pavlovic, R.; Mostacci, D.

    2003-01-01

    Rapidly increasing performances of personal computers and development of codes for proton transport based on Monte Carlo methods will allow, very soon, the introduction of the computer planning proton therapy as a normal activity in regular hospital procedures. A description of SRNA code used for such applications and results of calculated distributions of proton-absorbed dose in human eye are given in this paper. (author)

  17. 78 FR 48795 - Airworthiness Directives; BRP-Powertrain GmbH & Co KG Rotax Reciprocating Engines

    Science.gov (United States)

    2013-08-12

    ... AD to prevent excessive oil consumption, which could result in an in-flight engine shutdown, forced... consumption, which could result in an in-flight engine shutdown, forced landing, and damage to the airplane... average labor rate is $85 per hour. Based on these figures, we estimate the cost of this AD on U.S...

  18. 78 FR 59291 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co. KG Turbofan Engines

    Science.gov (United States)

    2013-09-26

    ... received by the closing date and may amend this proposed AD based on those comments. We will post all.... Based on these figures, we estimate the cost of the proposed AD on U.S. operators to be $598,520... Deutschland GmbH, formerly Rolls-Royce plc): Docket No. FAA-2013- 0342; Directorate Identifier 2013-NE-14-AD...

  19. Preliminary results on a contact between 4kg of molten UO2 and liquid sodium

    International Nuclear Information System (INIS)

    Amblard, M.

    1976-01-01

    The CORECT II Experiment consists in simulating the penetration of sodium into an assembly when the fuel is molten. It is a shock-tube type experiment with dimensions representative of a full scale assembly. Six tests were performed which have always resulted in fine fragmentation without any violent interaction. Grain size measurements were carried out. The following assumptions were made: the grains are formed in a very short time; the grains are formed from the liquid state; the grains are intimately blended with the sodium whose mass is one of the parameters. But computations from grain size data using these assumptions give results that have no bearing on the effects actually observed [fr

  20. 78 FR 17082 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbojet Engines

    Science.gov (United States)

    2013-03-20

    ... flight. (5) If you find any broken bolt in the HPT shaft air seal sleeve, visually inspect the HPT stage... assembly, high pressure turbine (HPT) bearing support assembly and HPT air seal sleeve bolts identified... turbine (HPT) bearing support assembly, and HPT air seal sleeve within 100 engine cycles-in-service. (2...

  1. 77 FR 66769 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG Turbojet Engines

    Science.gov (United States)

    2012-11-07

    .... (5) If any bolt is found broken in the HPT shaft air seal sleeve, inspect the HPT stage 1 disc for...) bearing support assembly and HPT air seal sleeve bolts identified that, before installation, those bolts... assembly, high-pressure turbine (HPT) bearing support assembly, and HPT air seal sleeve. (2) If engine...

  2. Reasons for service failure of an ÉKG-20 power shovel bogie wheel

    Science.gov (United States)

    Yakovleva, S. P.; Milokhin, S. E.

    1985-10-01

    Early failure of a bogie wheel is caused by the occurrence after heat treatment of a working surface structure with insufficient resistance to plastic deformation, which under the specific conditions of contact loading causes flattening of it with the formation of accumulations of material on the side surfaces. This leads to the occurrence of significant stresses on the faces of the wheel which intensify the nonuniformity of the structure obtained after machining of the side surface.

  3. 77 FR 51462 - Airworthiness Directives; BRP-Powertrain GmbH & Co KG Rotax Reciprocating Engines

    Science.gov (United States)

    2012-08-24

    ... to Mail address above between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. Fax... holidays. The AD docket contains this AD, the regulatory evaluation, any comments received, and other...

  4. Requirement of standardized ileal digestible valine to lysine ratio for 8- to 14-kg pigs

    DEFF Research Database (Denmark)

    Assadi Soumeh, Elham; van Milgen, Jaap; Sloth, Niels Morten

    2015-01-01

    The objective was to define the Val requirement for weaned piglets in the context of reducing the dietary protein content. A dose–response experiment was conducted to estimate the standardized ileal digestible (SID) Val to Lys ratio required to support the optimum growth of post-weaned piglets. I...

  5. Manufacturing recombinant proteins in kg-ton quantities using animal cells in bioreactors.

    Science.gov (United States)

    De Jesus, Maria; Wurm, Florian M

    2011-06-01

    Mammalian cells in bioreactors as production host are the focus of this review. We wish to briefly describe today's technical status and to highlight emerging trends in the manufacture of recombinant therapeutic proteins, focusing on Chinese hamster ovary (CHO) cells. CHO cells are the manufacturing host system of choice for more than 70% of protein pharmaceuticals on the market [21]. The current global capacity to grow mammalian cells in bioreactors stands at about 0.5 million liters, whereby the largest vessels can have a working volume of about 20,000l. We are focusing in this article on the upstream part of protein manufacturing. Over the past 25 years, volumetric yields for recombinant cell lines have increased about 20-fold mainly as the result of improvements in media and bioprocess design. Future yield increases are expected to come from improved gene delivery methods, from improved, possibly genetically modified host systems, and from further improved bioprocesses in bioreactors. Other emerging trends in protein manufacturing that are discussed include the use of disposal bioreactors and transient gene expression. We specifically highlight here current research in our own laboratories. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. ECON-KG: A Code for Computation of Electrical Conductivity Using Density Functional Theory

    Science.gov (United States)

    2017-10-01

    searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection information. Send comments...eV) Conductivity(S/m) σxx(S/m) σxx(S/m) σzz(S/m) Sum_Rule where column 1 is the frequency, column 2 is the trace of the conductivity tensor ...Siemens/meter), and columns 3, 4, and 5 are the diagonal components of the conductivity tensor that contribute to the trace. The last column

  7. Modelling and construction of a compact 500 kg HTS magnetic bearing

    International Nuclear Information System (INIS)

    Werfel, F N; Floegel-Delor, U; Rothfeld, R; Goebel, B; Wippich, D; Riedel, T

    2005-01-01

    The progress of heavy-load HTS bearings depends on improvements in design, material quality and reliable cooling. We have constructed, manufactured and tested a 200 mm HTS journal bearing with a thermally encapsulated YBCO ring. For maximum force the larger gap due to the bearing cryostat (>4 mm) requires adjustment of the magnetic excitation pole distance and the Fe collector shim thickness. HTS material progress is obtained by top-seeded single- or multiple-grain growth which increases the averaged trapped magnetic flux density. Successful YBCO ring growth with radial c axis distribution by seeding the inner ring surface has been performed. The encapsulation ensures a substantially reduced cryogenic effort and stabilizes bearing operation at 78-79 K

  8. 422 KG Satyanarayana, A G Kulkarni and P K Rohatgi the

    Indian Academy of Sciences (India)

    However, the deformation mechanism leading to the observed mechanical properties has not been discussed. X-ray studies have thrown light on the crystallinity and preferred orientation of the cellulosic matter in coir (Thompson & Hewitt 1935; Banerji 1947; Heyn 1948; Harris. 1954; Venkateswarlu & Govindan Kutty 1968; ...

  9. Patent Ductus Arteriosus closure in preterms less than 2kg: Surgery versus transcatheter.

    Science.gov (United States)

    Pamukcu, Ozge; Tuncay, Aydin; Narin, Nazmi; Baykan, Ali; Korkmaz, Levent; Argun, Mustafa; Ozyurt, Abdullah; Sunkak, Suleyman; Uzum, Kazim

    2018-01-01

    As new devices come into the market, percutaneous techniques improve and interventionalists become more experienced; percutaneous closure gets more common in preterms. In this study we aimed to compare efficacy and safety of Patent Ductus Arteriosus closure surgically versus transcatheter method in preterms Patent Ductus Arteriosus closure in preterms. Between the dates July 1997 to October 2014 in our center Patent Ductus Arteriosus of 26 patients Patent Ductus Arteriosus closure group was significantly more than the surgery group. Mean gestational age of the patients in Group A was 30±1.8weeks, in group B was 28.6±3.5weeks. In group A; all cases were closed successfully except 4 cases: device embolization in 2, cardiac tamponade and iatrogenic aortic coarctation were seen. Pneumomediastinum and chylothorax were the major complications of the surgery group. There was no statistically significance between complication and success rates between two groups. Percutaneous Patent Ductus Arteriosus closure is the candidate for taking the place of surgery in preterms. However, it is not applied routinely; can only be done in fully equipped large centers by experienced interventionalists. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Les besoins en isoleucine, valine et leucine chez le porcelet entre 7 et 15 kg

    DEFF Research Database (Denmark)

    Assadi Soumeh, Elham; van Milgen, Jaap; Sloth, Niels Morten

    2015-01-01

    croissance s’ils sont fournis en deçà du besoin. Des études de métaanalyse révèlent que peu de données de type dose‐réponse sont disponibles chez le porcelet pour l’Ile, notamment avec des aliments exempts de cellules de sang, et la Val (van Milgen et al., 2012, 2013). Par ailleurs, une revue de la...

  11. Investigation of environmental samples from Fukushima with respect to uranium and plutonium by AMS; Untersuchung von Umweltproben aus Fukushima in Bezug auf Plutonium und Uran mittels AMS

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Stephanie

    2017-02-01

    In March 2011, the nuclear power plant Fukushima Dai-ichi was seriously damaged by a tsunami caused by an earthquake. During the accident large quantities of radionuclides, mainly of the volatile elements cesium and iodine, were released to the environment. In small amounts refractory elements such as plutonium and uranium have also been released. Plutonium and the uraniumisotope {sup 236}U have primarily been delivered by human activities in the environment. Large amounts were released during the atmospheric nuclear weapons tests. Additional sources are accidents in nuclear facilities, like Chernobyl. Every source has its own characteristic isotopic composition. It is therefore possible to determine the origin of the contamination by measuring the isotopic ratios of {sup 240}Pu/{sup 239}Pu and {sup 236}U/{sup 238}U. These ratios can be determined by using accelerator mass spectrometry. Due to its high sensitivity, it is possible to measure even small amounts of plutonium and especially of {sup 236}U. These measurements were performed using the compact 500 kV facility ''TANDY'' of ETH Zurich. In 2013 and 2015 vegetation, litter and soil drill core samples were taken in the contaminated area in Fukushima prefecture. In 2015 samples were taken as close to the sampling locations of the 2013 campaign as possible. After isolation of plutonium and uranium by chemical extraction, separate targets were prepared for the measurement. The {sup 240}Pu/{sup 239}Pu ratios indicate global fallout as the plutonium source for most samples. The plutonium of the reactors of Fukushima Dai-ichi is located in the upper layers like in vegetation or litter. From the uranium ratios alone the reactors could not unambigously be identified as the source of {sup 236}U. However, this is plausible in the cases were reactor plutonium was detected. None of the samples contained higher plutonium activity concentrations than in the rest of Japan, caused by global fallout. This holds even for the samples where the reactors were identified as the source from the isotope ratios. This and the strong localization, even for neighboring sampling sites, indicate that the overall small quantities of plutonium were most likely released as particulate matter.

  12. Calorimeter measurements of absorbed doses at the heavy water enriched uranium reactor; Kalorimetrijska merenja apsorbovanih doza u reaktoru na tesku vodu i obogaceni uran

    Energy Technology Data Exchange (ETDEWEB)

    Markovic, V [Institute of Nuclear Sciences Boris Kidric, Odeljenje za radijacionu hemiju, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    Application of calorimetry measurements of absorbed doses was imposed by the need of good knowledge of the absorbed dose values in the reactor experimental channels. Other methods are considered less reliable. The work was done in two phases: calorimetry measurements at lower reactor power (13-80 kW) by isothermal calorimeter, and differential calorimeter constructions for measurements at higher power levels (up to 1 MW). This report includes the following four annexes, papers: Isothermal calorimeter for reactor radiation monitoring, to be published; Calorimeter dosimetry of reactor radiation, presented at the Symposium about nuclear fuel held in april 1961; Radiation dosimetry of the reactor RA at Vinca, published in the Bull. Inst. Nucl. Sci. 1961; Differential calorimeter for reactor radiation dosimetry.

  13. Monte Carlo calculations on transmutation of trans-uranic nuclear waste isotopes using spallation neutrons difference of lead and graphite moderators

    CERN Document Server

    Hashemi-Nezhad, S R; Brandt, R; Krivopustov, M I; Kulakov, B A; Odoj, R; Sosnin, A N; Wan, J S; Westmeier, W

    2002-01-01

    Transmutation rates of sup 2 sup 3 sup 9 Pu and some minor actinides ( sup 2 sup 3 sup 7 Np, sup 2 sup 4 sup 1 Am, sup 2 sup 4 sup 5 Cm and sup 2 sup 4 sup 6 Cm), in two accelerator-driven systems (ADS) with lead or graphite moderating environments, were calculated using the LAHET code system. The ADS that were used had a large volume (approx 32 m sup 3) and contained no fissile material, except for a small amount of fissionable waste nuclei that existed in some cases. Calculations were performed at an incident proton energy of 1.5 GeV and the spallation target was lead. Also breeding rates of sup 2 sup 3 sup 9 Pu and sup 2 sup 3 sup 3 U as well as the transmutation rates of two long-lived fission products sup 9 sup 9 Tc and sup 1 sup 2 sup 9 I were calculated at different locations in the moderator. It is shown that an ADS with graphite moderator is a much more effective transmuter than that with lead moderator.

  14. Uranium from German nuclear projects of the 1940ies. A nuclear forensic study; Uran aus deutschen Nuklearprojekten der 1940er Jahre. Eine nuklearforensische Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Mayer, Klaus; Wallenius, Maria; Luetzenkirchen, Klaus [European Comission, Joint Research Centre (JRC), Karlsruhe (Germany). Inst. for Transuranium Elements (ITU); and others

    2015-11-02

    In the 1940ies in Germany studies using uranium in different geometries were started. Using the isotope ration Th-230/U-234 it was possible to determine the materials used in 1949-1943.The geographic origin was determined from trace amounts of rare earths. The uranium used in German research projects came from Czech uranium mines. Traces of U-236 and Pu-236 were found corresponding to the normal occurrence. This fact indicates that no significant neutron irradiation has occurred.

  15. On the uptake and binding of uranium (VI) by the green alga Chlorella Vulgaris; Zur Aufnahme und Bindung von Uran(VI) durch die Gruenalge Chlorella Vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Manja

    2011-07-01

    Uranium could be released into the environment from geogenic deposits and from former mining and milling areas by weathering and anthropogenic activities. The elucidation of uranium behavior in geo- and biosphere is necessary for a reliable risk assessment of radionuclide migration in the environment. Algae are widespread in nature and the most important group of organisms in the aquatic habitat. Because of their ubiquitous occurrence in nature the influence of algae on the migration process of uranium in the environment is of fundamental interest e.g. for the development of effective and economical remediation strategies for contaminated waters. Besides, algae are standing at the beginning of the food chain and play an economically relevant role as food and food additive. Therefore the transfer of algae-bound uranium along the food chain could arise to a serious threat to human health. Aim of this work was the quantitative and structural characterization of the interaction between U(VI) and the green alga Chlorella vulgaris in environmental relevant concentration and pH range with special emphasis on metabolic activity. Therefore a defined medium was created which assures the survival/growth of the algae as well as the possibility to predict the uranium speciation. The speciation of uranium in the mineral medium was calculated and experimentally verified by time-resolved laser-induced fluorescence spectroscopy (TRLFS). The results of the sorption experiments showed that both metabolic active and inactive algal cells bind uranium in significant amounts of around 14 mg U/g dry biomass and 28 mg U/g dry biomass, respectively. Another interesting observation was made during the growth of Chlorella cells in mineral medium at the environmental relevant uranium concentration of 5 {mu}M. Under these conditions and during ongoing cultivation a mobilization of the algae-bound uranium occurred. At higher uranium concentrations this effect was not observed due to the die off of the algae cells during the sorption experiment and a behavior analogue to initially heat killed cells. Differences in the contribution of functional groups to the uranium binding depending on the metabolic activity of the algal biomass were also shown by the difference spectra of the ATR-FTIR measurements calculated between uranium contaminated and untreated biomass. All together the spectroscopic investigations showed in case of Chlorella vulgaris a mixture of functional groups is responsible for the coordination of U(VI). The metabolic activity of the cells influences the binding of uranium under the given experimental conditions. Models of the structure of the formed U(VI)-algae complexes in dependence of the metabolic activity were created. For living algal cells, mainly carboxylic and organic phosphate groups are involved in the binding of uranium, whereas in dead algal biomass additionally inorganic phosphates are involved to some extend in the interaction of uranium with algal cells. The transferability of the obtained findings concerning the experiments in mineral medium to natural occurring mining related waters was verified exemplary with the surface water of ''Gessenwiese'' (former ''Gessenhalde'' at Ronneburg). The obtained results of this study contribute to the prediction of the migration behavior of uranium under environmental conditions, the radiological risk assessment of geogenic and anthropogenic appearing uranium and a reliable estimation of the accumulation of uranium in the food chain.

  16. On the interaction of uranium with the bioligands citric acid and glucose; Zur Wechselwirkung von Uran mit den Bioliganden Citronensaeure und Glucose

    Energy Technology Data Exchange (ETDEWEB)

    Steudtner, Robin

    2011-10-26

    For a better understanding of the actinide behaviour in human (in term of metabolism, retention, excretion) and in geological and biological systems, it is of prime importance to have a good knowledge of the relevant speciation. In model systems the chemical behaviour of uranium regarding complex formation and redox reaction were investigated. On this basis determinates thermodynamics constants and redox behaviour are used to prognoses a safety assessment for the respective system. The pentavalent uranium(V) is a metastable intermediate in natural redox system between uranium(IV) and uranium(VI). In this study the uranium(V) fluorescence was detected by laser spectroscopic methods ({lambda}{sub ex} = 255 nm) for the first time. The peak maxima ({lambda}{sub ex} = 255 nm) of luminescence spectrum of the photo reduced U(V) in aqueous perchlorate/2-propanol solution was detected at 440 nm and a fluorescence lifetime of 1.1 {+-} 0.02 {mu}s was calculated. The stable aqueous uranyl(V)-tricarbonate complex was characterized by fluorescence spectroscopy ({lambda}{sub ex} = 255 nm and 408 nm). The known quench effects of carbonate could be minimized by coupling the laser fluorescence system with the low temperature technique. The resulting U(V) fluorescence emission bands were detected between 375 nm and 445 nm. The peak maxima were identified at 401.5 nm ({lambda}{sub ex} = 255 nm) and 413.0 nm ({lambda}{sub ex} = 408 nm). The fluorescence lifetime of the uranyl(V)-carbonate species was determined at 153 K as 120 {+-} 0.1 {mu}s ({lambda}{sub ex} = 255 nm). In addition the fluorescence of uranium(V) was verifies by confocal laser scanning microscopy. The oxidation process from uranium(IV) to uranium(VI) was investigated on solid uraninite (UO{sub 2}) and uranium(IV) tetra chloride (UCl{sub 4}) and a 1 x 10{sup -2} M uranium(IV) sulphate (U{sup IV}SO{sub 4}) solution. By continuous oxygen transfer the uranium(IV) was oxidized slowly to uranium(VI). The temporal process was studied by the confocal laser scanning microscopy using an excitation wavelength of 408 nm. The respective peak maxima of the uranium(V) fluorescence were detected at 445.5 for UO{sub 2}, at 445.5 nm for UCl{sub 4} and at 440.0 nm for U{sup IV}SO{sub 4}. To use the cryogenic technique for the determination of thermodynamic constants the influence of the temperature on the fluorescence behaviour of the free uranyl(VI)-ion was studied first. With increase of the temperature the fluorescence lifetime of 1.88 {mu}s at 298 K decreases significantly. An increase of the temperature of about 1 K decreases the fluorescence intensity about 2.3 % between 273 K and 313 K. In contrast to measurement at room temperature the fluorescence lifetime increases to 257.9 {mu}s at low temperature (153 K). Further decrease of the sample temperature has non influence on the fluorescence lifetime of the uranyl(VI)-ion. The emission band position of the free uranyl(VI)-ion are temperature independent. At room temperature and also at low temperature the main emission band were detected at 488.0 nm, 509.4 nm, 532.4 nm, 558.0 nm and 586.0 nm. The time resolved laser induced fluorescence spectroscopy at low temperature was verifies for determination of thermodynamic constant by investigation of the uranium(VI) citrate system. In contrast to measurement at room temperature the forming uranium(VI) citrate complexes showed a typical uranyl (VI) fluorescence spectrum at 153 K. The fluorescence signal was not quenched at the low temperature measurements. SPECFIT was used as calculation program for thermodynamic constants from spectroscopic data. The complex formation constant of log {beta}{sub 101} = 7.24 {+-} 0.16 for the [UO{sub 2}(Cit)]{sup -}-complex and of log {beta}{sub 202} = 18.90 {+-} 0.26 for the [(UO{sub 2}){sub 2}(Cit){sub 2}]{sup 2-}-complex are corresponding exact with the data from the literature. The detected uranyl(VI) citrate complexes were characterized by five emission bands at 475.3 nm, 591.8 nm, 513.5 nm, 537.0 nm and 561.9 nm for the 1:0:1-complex and at 483.6 nm, 502.7 nm, 524.5 nm, 548.1 and 574.0 nm for the 2:0:2-complex. The respective fluorescence lifetimes determined at 153 K were 79 {+-} 15 {mu}s (1:0:1) and 10 {+-} 3 {mu}s (2:0:2). In this work not only the model complexation of the hexavalent uranium but also the complex behaviour of the tetravalent uranium in presence of citric acid were studied. In all samples the uranium citrate complexes were detected as dissolved species. In addition to the spectroscopy detection of the new forming uranium citrate species the complex formation could be analyzed the complex formation constant and the single component spectrum for all complexes. Complex formation constant for the citrate species of the hexavalent uranium of log {beta}{sub 203} = 22.67 {+-} 0.34 ([(UO{sub 2}){sub 2}(Cit){sub 3}]{sup 5-}) and of log {beta}{sub 103} = 12.35 {+-} 0.22 ([UO{sub 2}(Cit){sub 3}]{sup 7-}) and for the complexes of the tetravalent uranium of log {beta}{sub 1-21} = -9.74 {+-} 0.23 ([U(OH){sub 2}Cit]{sup -}) und log {beta}{sub 1-31} = -20.36 {+-} 0.22 ([U(OH){sub 3}Cit]{sup 2-}) were calculated for the first time. Also to the complex behaviour and the redox behaviour of uranium in presence of citric acid were investigated. The photochemical reduction of uranium(VI) by citric acid at aerobic and anaerobic conditions was detected by UV-Vis spectroscopy. The reaction at aerobic conditions showed which unknown influence organic ligands can have on the chemical behaviour of uranium. The highest reduction rate could be determinate between pH 3.5 and 4 with 52 % at aerobic conditions and 66 % at anaerobic conditions. With increase of the pH the amount of reduced uranium(VI) decreases. In the oxygen system a reduction above pH 7 wasn't detectable. These results are in a very good correspondence with model calculation of the uranium(VI) speciation in urine.

  17. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  18. The effects of small water surfaces on turbulent flow in the atmospheric boundary layer : URANS approach implemented in OpenFOAM

    NARCIS (Netherlands)

    Abbasi, A.; Annor, F.O.; van de Giesen, N.C.

    2018-01-01

    A 3-D numerical method is developed to investigate the spatial distribution of surface fluxes over heterogeneous surfaces in (semi-)arid regions. Quantifying the effects of changes in the momentum, thermal and moisture roughness lengths on the airflow and fluxes in the ABL is important for water

  19. Investigations on uranium sorption on bentonite and montmorillonite, respectively, and uranium in environmental samples; Untersuchungen zur Uransorption an Bentonit bzw. Montmorillonit sowie von Uran in Umweltproben

    Energy Technology Data Exchange (ETDEWEB)

    Azeroual, Mohamed

    2010-09-22

    The geotechnical barrier is an important component of a geological repository and consists of compacted bentonite surrounding radioactive waste containers. Its most important functions are, to retard the radionuclide migration into the biosphere and to prevent groundwater contact with containers. lt is therefore of central importance to investigate the bentonite material on its capacity to sorb radionuclides under near-natural chemical and physical conditions. The purpose of this work was to study the adsorption of uranium(VI) on bentonit and on montmorillonite-standards at high uranium concentrations. Thereby, a special account was given to the calcium-uranyl-carbonate complexation, which leads to the formation of very stable and mobile uncharged Ca{sub 2}UO{sub 2}(CO{sub 3}){sub 3} complex. Results of batch experiments showed that the dicalcium-uranyl-tricarbonate complexation lowers the uranium(VI) sorption on natural clay (bentonite) by a factor of up to 3. After 21 days of contact time, about 40 % and 20 % of the initial uranium(VI)concentration were sorbed on Na-bentonite and ea-bentonite, respectively, from a solution with Ca{sub 2}UO{sub 2}(CO{sub 3}){sub 3} dominating the uranium(VI) speciation. On the contrary, about 55 % of the initial uranium(VI)-concentration were sorbed on thes clays from the solution, in which (UO{sub 2}){sub 2}CO{sub 3}(OH){sub 3}{sup -} complex dominated the uranium(VI) speciation. Thus uranium(VI) sorption is more strongly influenced by the solution composition than by bentonite type. Na-bentonite should be used instead of ea-bentonite as a geotechnical barrier, since calcium-uranyl-carbonate complexation may be a realistic scenario. Further SEM-EDX and HREM-EDX studies showed that uranium(VI) sorption occurred predominantly on montmorillonite, which is the main component of bentonite. Uranium(VI) sorption on bentonite's accessory Minerals (pyrite, calcite, mica, and feldspar) was not observed. Investigation of uranium(VI) sorption on four montmorillonite-standard, which are distinguished by the cationic composition of the octahedral sheet, provided further evidence on the mechanism of uranium(VI) sorption on montmorillonit. The uranium(VI) sorption was found to be controlled by the cationic composition of the octahedral sheet and by the dissolution rate of montmorillonite. Higher Mg contents in the octahedral sheet enhance the dissolution kinetics of Montmorillonite and thus lower uranium(VI) sorption with time and vice versa. In addition to Al and Fe octahedron, Mg octahedron contributes to the sorption of uranium(VI) (here 20 up to 50 % depending on Mg content in Montmorillonite). These observations allowed to propose a model for the mechanism of uranium(VI) sorption on the edge surface of montmorillonite. At lower octahedral Mg contents (here SWy- and STx-montmorillonites), at which the distance between Mg octahedra becomes larger, uranium(VI) binds monodentately to AlAl-OH, AlFe-OH, AlMg-OH, FeFe-OH, and FeMg-OH pairs and the Mg octahedra contribute up to approximately 20 % to the sorption of uranium(VI). At high Mg contents in the octahedral sheet, where the distance between Mg octahedra becomes small and MgMg-OH pairs can occur, uranium(VI) forms monodentate surface complexes with AlAl-OH, AlFe-OH, AlMg-OH, FeFe-OH, FeMg-OH, and MgMg-OH pairs and the Mg octahedra can even stronger contribute to uranium(VI) sorption (up to about 50 %). The second focus of this work concerned the environmental analytics of uranium. In this regard, extensive investigations of environmental samples from tailings disposal sites near Mailuu-Suu city (Kyrgyzstan) were carried out. Previous radiological examinations in Mailuu-Suu showed that uranium can migrate from tailings as a result of rain events to the ground water and river water and eventually to the foods [Vandenhove et al., 2006]. Therefore, it was very important to investigate, uranium speciation in water samples and the processes which controlling uranium releases from tailings into the aquatic system. The results showed that uranium(VI) speciation in water samples is controlled by pH as well as bicarbonate and calcium concentrations and is dominated by the very stable aquatic complexes Ca{sub 2}UO{sub 2}(CO{sub 3}){sub 3}, (UO{sub 2}){sub 2}CO{sub 3}(OH){sub 3}{sup -} and UO{sub 2}(CO{sub 3}){sub 3}{sup 4-}. Influences of humic substances or phosphate ligands on uranium(VI) complexation were not detected. Uranium association with aquatic colloids in the studied samples as found to be negligible. With the help of a combination of the AREM-EDX method and batch experiments, uraninite (UO{sub 2}) and brannerite (UTi{sub 2}O{sub 6}) could be identified with an occurrence frequency of about 67 % and 33 %, respectively. This combination allowed the conclusion that uranium release from tailing materials is controlled by the dissolution of uraninite, which itself is governed by the dissolution of calcite. Furthermore, a mobilisation of uraninite colloids smaller than 200 nm from tailing material into the used model solutions was observed.

  20. nduced hyperlipidemic rats. Methods: Column chromatographic fractionation of butanol fraction of total methanol extract of leaves of Bauhinia variegata (Linn. yields four sub-fractions (sub-fraction A-D. All sub-fractions tested for their anti-hyperlipidemic activity. Sub-fractions administered at a dose of 65 mg/kg (oral to the Triton WR-1339 induced hyperlipidemic rats and total cholesterol, triglycerides, HDL, LDL and VLDL

    Directory of Open Access Journals (Sweden)

    Deepak Kumar

    2012-10-01

    Full Text Available Objective: To investigate the effect and evaluation of Anti-hyperlipidemic activity guided subfraction isolated from total methanolic extract of Bauhinia variegata (Linn. leaves on Triton WR-1339 induced hyperlipidemic rats. Methods: Column chromatographic fractionation of butanol fraction of total methanol extract of leaves of Bauhinia variegata (Linn. yields four subfractions (sub-fraction A-D. All sub-fractions tested for their anti-hyperlipidemic activity. Subfractions administered at a dose of 65 mg/kg (oral to the Triton WR-1339 induced hyperlipidemic rats and total cholesterol, triglycerides, HDL, LDL and VLDL level in the blood were checked. Results: Sub-fraction D showed significant reduction (P<0.05 among four sub-fraction in comparison with standard drug fenofibrate. Conclusions: From the above study it could be concluded that butanol sub-fraction D of Bauhinia variegata (Linn. not only have resulted in significant reduction in cholesterol, triglyceride, LDL, VLDL level but also increases the HDL level at a reduced dose level.

  1. The behavior of uranium in the soil/plant system with special consideration of the uranium input by mineral phosphorus fertilizer; Untersuchungen zum Verhalten von Uran im System Boden/Pflanze unter besonderer Beruecksichtigung des Uran-Eintrags durch mineralische Phosphorduenger

    Energy Technology Data Exchange (ETDEWEB)

    Setzer, Sascha

    2014-03-28

    The fate of uranium in the environment and, consequently, its hazard potential for human beings is still discussed controversially in the scientific literature. Mineral phosphorous fertilizer can contain uranium as impurity, so that their application can cause an additional input of uranium into agricultural environments. It is still unclear whether and to what extent fertilizer-derived uranium can enter the human food chain by the consumption of contaminated waters or vegetable crop products. The mobility and availability of uranium in the agricultural ecosystem is mainly determined by its behavior in the pedosphere. Due to interactions with organic and inorganic components, the pedosphere is an effective storage and filter system for pollutants and thus plays an important role for the fate of uranium in the environment. In order to improve the assessment of the hazard potential, the present study investigates the behavior of uranium in the soil/plant-system with a focus on the uranium input by mineral phosphorous fertilizer. The specific objectives were (A) to investigate the general distribution of uranium in soils, (B) to determine the effect of CaCO{sub 3} on the sorption behavior of uranium and to quantify the effects of (C - D) varying substrate properties and (E) the application of phosphorus fertilizers on the uranium uptake by ryegrass. The results of these experiments imply that the use of mineral phosphorous fertilizers does not pose an acute risk within the meaning of consumer protection. The studied soils predominantly had a high to very high sorption capability for uranium. At the same time, a small soil-to-plant-transfer of uranium was determined, where the majority of uranium accumulated in/to the plant roots. The availability of uranium in soils and its uptake by plants can thus be classified as generally low. Furthermore, some soil parameters were identified which seem to favor a higher uranium-availability. This study found that very high and very low pH values as well as high CaCO{sub 3} content in the soil cause a higher uranium-availability. However, neither the application of CaCO{sub 3} nor of phosphorous fertilizer caused a significant increased of the soil-to-plant transfer. Against this background it remains to be tested whether the demonstrated uranium-mobilization potential by CaCO{sub 3} under laboratory conditions is similarly pronounced under field conditions and hence the use of lime in agriculture promotes the leaching of uranium.

  2. Dissolution experiments of commercial PWR (52 MWd/kgU) and BWR (53 MWd/kgU) spent nuclear fuel cladded segments in bicarbonate water under oxidizing conditions. Experimental determination of matrix and instant release fraction

    OpenAIRE

    Gonzalez Robles, E.; Serrano Purroy, D.; Sureda, R.; Casas Pons, Ignasi; Pablo Ribas, Joan de

    2015-01-01

    The denominated instant release fraction (IRF) is considered in performance assessment (PA) exercises to govern the dose that could arise from the repository. A conservative definition of IRF comprises the total inventory of radionuclides located in the gap, fractures, and the grain boundaries and, if present, in the high burn-up structure (HBS). The values calculated from this theoretical approach correspond to an upper limit that likely does not correspond to what it will be expected to be ...

  3. First 10 kg of naked Germanium detectors in liquid nitrogen installed in the GENIUS-Test-Facility

    International Nuclear Information System (INIS)

    Klapdor-Kleingrothaus, H.V.; Chkvorets, O.; Krivosheina, I.V.; Strecker, H.; Tomei, C.

    2003-01-01

    The first four naked high-purity Germanium detectors were installed successfully in liquid nitrogen in the GENIUS-Test-Facility in the GRAN SASSO Underground Laboratory on May 5, 2003. This is the first time ever that this novel technique aiming at extreme background reduction in search for rare decays is going to be tested underground. First operational parameters are presented

  4. 78 FR 69316 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG (Formerly Rolls-Royce Deutschland...

    Science.gov (United States)

    2013-11-19

    ... INFORMATION: Comments Invited We invite you to send any written relevant data, views, or arguments about this...-26-14 resulted from a report of silver chloride-induced stress corrosion cracking of the HP... chloride-induced stress corrosion cracking of the HP compressor stages 1 to 6 rotor disc assembly. We are...

  5. Meat quality of Swallow-Belly Mangulica pigs reared under intensive production system and slaughtered at 100 kg live weight

    Directory of Open Access Journals (Sweden)

    Tomović Vladimir M.

    2016-01-01

    Full Text Available Quality parameters including sensory and physical characteristics and proximate and mineral composition in M. psoas major, M. semimembranosus, M. longissimus thoracis et lumborum and M. triceps brachii of Swallow-Belly Mangulica pigs were determined. Type of muscles had no significant effect (P>0.05 on water-holding capacity, protein, total fat, K, P and Ca content. The M. psoas major was the highest in pH24h, water-holding capacity, CIEa* and CIEb* values, moisture, K, P aQuality parameters including sensory and physical characteristics and proximate and mineral composition in M. psoas major, M. semimembranosus, M. longissimus thoracis et lumborum and M. triceps brachii of Swallow-Belly Mangulica pigs were determined. Type of muscles had no significant effect (P>0.05 on water-holding capacity, protein, total fat, K, P and Ca content. The M. psoas major was the highest in pH24h, water-holding capacity, CIEa* and CIEb* values, moisture, K, P and Cu content, and the lowest in visual marbling score and total fat content. The M. semimembranosus was the highest in Mg and Ca content, and the lowest in CIEL* value (darkest muscle and K content. The lightest colour (CIEL* value, the highest content of protein, total fat and total ash, and the lowest visual colour score, pH24h, CIEa* and CIEb* values, content of moisture, Na, Ca, Zn, Fe and Cu were found in M. longissimus thoracis et lumborum. The highest visual colour and marbling score, the highest content of Na, Zn and Fe, and the lowest water-holding capacity, content of protein, total ash, P and Mg were found in M. triceps brachii.

  6. Interactions between crush conditions and fire resistance for type B(U) packages less than 500 kg

    International Nuclear Information System (INIS)

    Huebner, H.W.; Masslowski, J.P.

    1983-01-01

    In the continuation of the research work by BAM and the Commissariat a l'Energie Atomique (CEA), France, a study was made of the increased risk in regard to low-probability accidents, involving small, type B packages. An evaluation was made of the increased risk when small, type B packages are involved with a low-probability accident - one that involves both crush forces and exposure to a hydrocarbon fire. 3 references, 3 figures

  7. The Design of the Annular Linear Induction EM Pump with a Sodium Flowrate of 35 kg/sec

    International Nuclear Information System (INIS)

    Kim, Hee Reyoung; Lee, Tae Ho; Lee, Yong Bum

    2010-01-01

    Generally, an electromagnetic (EM) pump has been employed to circulate liquid metal with a high electrical conductivity by the electromagnetic force (Lorentz force) which is the cross product of the magnetic field and its perpendicular current. Therefore, an EM pump has its advantages over a mechanical pump such as no noise, no rotating parts, and its simplicity. Actually, it can be used for the Sodium Fast Reactor (SFR) which uses liquid sodium with a high electrical conductivity as a coolant. In the present study, the annular linear induction EM pump with a flowrate of 2,265 L/min and a head of 4 bar is designed by using an electrical equivalent circuit method which is applied to linear induction machines. The designed pump will be used for the verification of the elements, which are IHX, AHX and DHX, in the component performance test sodium loop for the sodium thermo-hydraulic experimental facility. The pump is manufactured and fabricated to meet the requirements of the material and a functioning in high temperature-sodium environments. The P-Q characteristic is theoretically calculated on the designed pump according to the input currents and voltage

  8. 75 FR 30280 - Airworthiness Directives; Stemme GmbH & Co. KG Model S10-VT Powered Sailplanes

    Science.gov (United States)

    2010-06-01

    ... Management Facility, U.S. Department of Transportation, Docket Operations, M-30, West Building Ground Floor... zinc metal connector is an unsafe part. We have coordinated Mr. Rode's concerns with the German... person at the Docket Management Facility between 9 a.m. and 5 p.m., Monday through Friday, except Federal...

  9. Analysis of rig test data for an axial/centrifugal compressor in the 12 kg/sec

    Science.gov (United States)

    Owen, A. K.

    1994-01-01

    Extensive testing was done on a T55-L-712 turboshaft engine compressor in a compressor test rig at TEXTRON/Lycoming. These rig tests will be followed by a series of engine tests to occur at the NASA Lewis Research Center beginning in the last quarter of 1993. The goals of the rig testing were: (1) map the steady state compressor operation from 20 percent to 100 percent design speed, (2) quantify the effects of compressor bleed on the operation of the compressor, and (3) explore and measure the operation of the compressor in the flow ranges 'beyond' the normal compressor stall line. Instrumentation consisted of 497 steady state pressure sensors, 153 temperature sensors and 34 high response transducers for transient analysis in the pre- and post-stall operating regime. These measurements allow for generation of detailed stage characteristics as well as overall mapping. Transient data is being analyzed for the existence of modal disturbances at the front face of the compression system ('stall precursors'). This paper presents some preliminary results of the ongoing analysis and a description of the current and future program plans. It will primarily address the unsteady events at the front face of the compression system that occur as the system transitions from steady state to unsteady (stall/surge) operation.

  10. Colorimetric determination of the fluoride ion - application to uranium metal and to uranous fluoride; Dosage colorimetrique de l'ion fluor - application a l'uranium metal et au fluorure uraneux

    Energy Technology Data Exchange (ETDEWEB)

    Hering, H; Hure, J; Legrand, S [Commissariat a l' Energie Atomique (France)

    1949-12-01

    In the determination described for fluoride in U metal, the U is brought into H{sub 2}SO{sub 4} solution by anodic oxidation, the fluo-silicic acid is distilled by entrainment in water vapor, and the F ion is determined in the distillate by using the fact that it complexes Zr and thus prevents the formation of the Zr-alizarin S lake. For F ion in UF{sub 4}, the compound is dissolved in a Na{sub 2}CO{sub 3}-H{sub 2}O{sub 2} mixture, and F is determined in the solution by the colorimetric method described. (author)

  11. Formation of colloids of the tetravalent uranium under influence of silicate in neutral and low alkaline aqueous systems; Bildung von Kolloiden des tetravalenten Urans unter Einfluss von Silikat in neutralen und schwachalkalischen waessrigen Systemen

    Energy Technology Data Exchange (ETDEWEB)

    Ulbricht, Isabell

    2016-03-30

    This work includes the preparation and characterization of new uranium(IV) colloids which are formed and stabilized in the near neutral pH range and under environmentally relevant conditions. Conclusions on stability behavior and particle size distributions were drawn based on results obtained by dynamic light scattering, zeta potential measurements, as well as ultrafiltration and ultracentrifugation in combination with element analyzes. Spectroscopic methodes confirmed the tetravalent state of uranium in the experiments. Unlike empirical data, it is possible to generate long-term stable uranium(IV) colloids at higher concentrations. By addition of geochemical components such as carbonate and silicate, they are stable and resistant in the near neutral pH range over a long period. It was found that dissolved silica plays an essential role in the preparation of colloids. Colloid-borne uranium(IV) up to a concentration of 10{sup -3} mol/L, corresponding to 0,238 g/L, is stabilized in solutions. This concentration is about three orders of magnitude higher than so far known silicate-free aqueous uranium(IV) colloids. Through the use of different analytical methods (invasive and non-invasive) it could be shown that the resulting uranium(IV) colloids are in the nanoscalar range. A high mobility can be assumed in aquatic systems. Evidence is provided by photon correlation spectroscopy, ultrafiltration, and ultracentrifugation that uranium(IV) can form silicate-containing colloids of a size lower than 20 nm. The particles are generated in near neutral to slightly alkaline solutions containing geochemical relevant components (carbonate, silicate, sodium ions). They remain stable in aqueous suspension over years. Electrostatic repulsion due to a negative zeta potential in the near-neutral to alkaline pH range caused by the silicate stabilizes the uranium(IV) colloids. The isoelectric point of the nanoparticles is shifted towards lower pH values by the silicate. The higher the silicate to uranium(IV) content ratio and the higher the pH of the solution are, the smaller and more stable (in terms of pH-changes) are the particles. It should be noted that no colloids were formed in absence of uranium(IV). The mechanism of the colloidal stabilization can be regarded as ''sequestration'' by silicate, a phenomenon well known from heavy metal ions of high ion potential such as iron(III) or manganese(III,IV), but never reported for uranium(IV) so far. Extended X-ray absorption fine structure (EXAFS) spectroscopy showed that U-O-Si bonds, which increasingly replace the U-O-U bonds of the amorphous uranium(IV) oxyhydroxide with increasing silicate concentration, make up the internal structure of the colloids. The next-neighbor coordination of uranium(IV) in the uranium(IV)-silica colloids is comparable with that of coffinite, USiO{sub 4}. The assessment of uranium behavior in the aquatic environment should take the possible existence of uranium(IV)-silica colloids into consideration. Their occurrence might influence uranium migration in anoxic waters. The silicate-stabilized colloids have been generated in laboratory experiments under controlled conditions; i.e., it is not known yet whether these phases can occur in natural water. The qualitative composition of the matrix of the experimental solutions (H{sup +}, OH{sup -}, Na{sup +}, HCO{sub 3}{sup -}/CO{sub 3}{sup 2-}, silicate) was chosen similar to the geochemical nature of groundwater. Thereby, it can be assumed that such colloids are present in natural waters. The existence of such particles would provide an ex-planation for the occurrence of uranium(IV) colloids in anoxic pore waters or groundwaters. However, it should be noted that these results were observed by the reduction of uranium(VI) carbonate and dilution in the presence of silicate. Studies on the mobility and stability of these colloids in aquatic systems were not subject of this work and an environmental assessment of these novel uranium(IV) colloids with respect to the entry in the biosphere cannot be taken into account. But the possibilities of mobilization and stabilization can be applied to surrogate actinides and heavy metals, and point to the need for more intensive research in this area.

  12. Determination of uranium transfer factors from soils contaminated with natural uranium along the Vereinigten Mulde in Zwickau; Bestimmung von Transferfaktoren von Uran aus natuerlich belasteten Boeden entlang der Zwickauer und Vereinigten Mulde

    Energy Technology Data Exchange (ETDEWEB)

    Brand, Andreas

    2011-07-01

    According to IAEA the food chain soil-plants-human is the predominant radionuclide ingestion path. The consumption of contaminated vegetarian food causes a continuous radiation exposure. In this context the problem of contaminated meadows in the Zwickauer and Vereinigten Mulde that is used for agriculture is of predominant interest. In this area intensive uranium mining has caused severe environmental contamination. The agricultural crop land and the grass land were studied with respect to the radionuclides U-238 and U-234. Following the radiochemical separation using ion chromatography the samples were analyzed by alpha-spectrometry. Compared to non-contaminated areas significant specific activities were measured. The transfer factors of the radionuclides U-238 and U-234 were determined for different plant parts. The transfer factors decrease with increasing radioactive contamination of the soils.

  13. On the chemical identification and visualization of uranium species in biofilms and Euglena mutabilis cells; Zur chemischen Identifizierung und Visualisierung von Uran-Spezies in Biofilmen und Euglena mutabilis Zellen

    Energy Technology Data Exchange (ETDEWEB)

    Brockmann, Sina

    2013-11-14

    For risk assessment of anthropogenic uranium contaminations in the environment a detailed knowledge of the migration and immobilization behavior is required to prevent health hazards for humans and animals caused by an uncontrolled discharge of uranium. Hence, comprehensive studies on the interactions of uranium with the environment are required. Besides the influences of the geological materials, there is a huge effect of the biosphere, especially the interactions with microorganisms and biofilms, on the properties of uranium in the environment. The aim of this study was to investigate and to describe naturally occurring biofilms from real uranium contaminated areas and their influence on the uranium migration. The investigations in this study on the localization and the speciation of the uranium in the biosystems were primarily done with a coupled system of laser scanning microscopy (CLSM) and laser induced fluorescence spectroscopy (LIFS). Natural biofilms collected from two uranium contaminated acid mine drainage (AMD) environments, the former uranium mine in Koenigstein (Saxony, Germany) and the former Gessenheap near Ronneburg (Thuringia,Germany), were investigated in this study. The chosen samples represent typical biofilm communities living in AMD water and are exemplary for potentially occurring scenarios of contaminated mining water both in the underground and on the surface. The investigation on the interactions between uranium and Euglena mutabilis, which is a typical unicellular microorganism that can be found in acidic, uranium and other heavy metal containing waters, was another important part of this study. Bioaccumulation experiments of uranium on living Euglena mutabilis cells depending on the pH (pH 3 - 6) and on the background media in sodium perchlorate (9 g/l) or sodium sulfate (3.48 g/l) solution containing 0.01 mM uranium show an effective immobilization of uranium. At the acidic pH-values (pH 3 - 4) over 90 % of the added uranium was removed from the solutions by the cells without any detectable influence of the background media. Regarding the using of these cells for possible treatment procedures of real contaminated acid mine water the high immobilization rate of uranium at acidic conditions is very attractive. Living, metabolically active Euglena cells are able to accumulate more uranium than dead biomass as the results in this study show. The results of this study contribute to obtain a profound knowledge on the processes regarding the interactions of uranium with biofilms and in particular with Euglena mutabilis cells. The obtained findings help to improve the estimation of risks arising from contaminated environments and to optimize the prediction of the migration behavior of uranium.

  14. Determination by neutron activation of the uranium-235 concentration in uranium oxides; Determination par activation neutronique de la concentration d'uranium-235 dans des oxydes d'urane

    Energy Technology Data Exchange (ETDEWEB)

    May, S; Leveque, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    Classical methods of measuring isotopic abundance have the disadvantage of being long and of requiring chemical separation. A non-destructive method of measuring the uranium-235 content is described. It is based on an overall measurement of the short lived fission product activity formed during a 15 s neutron irradiation. The precision is of the order {+-} 1.5 per cent for 20 per cent enriched samples. The error due to the contribution from fast fission is discussed in detail. (author) [French] Les methodes classiques de mesure de l'abondance isotopique presentent le gros inconvenient d'etre longues et de necessiter des separations chimiques. Nous exposons une methode non destructive de mesure de la concentration d'uranium-235. Elle est basee sur la mesure globale de l'activite des produits de fission de courte periode formes par une irradiation neutronique de 15 s de l'echantillon. La precision est de l'ordre de {+-} 1,5 pour cent pour des echantillons enrichis jusqu'a 20 pour cent. L'erreur a la contribution de la fission rapide est discutee en detail. (auteur)

  15. Colorimetric determination of the fluoride ion - application to uranium metal and to uranous fluoride; Dosage colorimetrique de l'ion fluor - application a l'uranium metal et au fluorure uraneux

    Energy Technology Data Exchange (ETDEWEB)

    Hering, H.; Hure, J.; Legrand, S. [Commissariat a l' Energie Atomique (France)

    1949-12-01

    In the determination described for fluoride in U metal, the U is brought into H{sub 2}SO{sub 4} solution by anodic oxidation, the fluo-silicic acid is distilled by entrainment in water vapor, and the F ion is determined in the distillate by using the fact that it complexes Zr and thus prevents the formation of the Zr-alizarin S lake. For F ion in UF{sub 4}, the compound is dissolved in a Na{sub 2}CO{sub 3}-H{sub 2}O{sub 2} mixture, and F is determined in the solution by the colorimetric method described. (author)

  16. Process for plutonium rextraction in aqueous solution from an organic solvent, especially for uranium plutonium partition

    International Nuclear Information System (INIS)

    Germain, M.; Gillet, B.; Pasquiou, J.Y.

    1989-01-01

    The organic solvent containing plutonium is contacted with an aqueous solution of a uranous salt, for instance uranous nitrate, and a hydroxylamine salt, for instance the nitrate. In these conditions uranous nitrate is a reducing agent of Pu III and hydroxylamine nitrate stabilizes Pu III and U IV in the aqueous phase. Performances are similar to these of the U IV-hydrazine nitrate without interference of hydrazine nitrate degradation products [fr

  17. Uranium mobility during interaction of rhyolitic obsidian, perlite and felsite with alkaline carbonate solution: T = 120° C, P = 210 kg/cm2

    Science.gov (United States)

    Zielinski, Robert A.

    1979-01-01

    Well-characterized samples of rhyolitic obsidian, perlite and felsite from a single lava flow are leached of U by alkaline oxidizing solutions under open-system conditions. Pressure, temperature, flow rate and solution composition are held constant in order to evaluate the relative importance of differences in surface area and crystallinity. Under the experimental conditions U removal from crushed glassy samples proceeds by a mechanism of glass dissolution in which U and silica are dissolved in approximately equal weight fractions. The rate of U removal from crushed glassy samples increases with decreasing average grain size (surface area). Initial rapid loss of a small component (≈ 2.5%) of the total U from crushed felsite. followed by much slower U loss, reflects variable rates of attack of numerous uranium sites. The fractions of U removed during the experiment ranged from 3.2% (felsite) to 27% (perlite). An empirical method for evaluating the relative rate of U loss from contemporaneous volcanic rocks is presented which incorporates leaching results and rock permeability data.

  18. Vitamin D deficiency in population with BMI greater than 25 kg/m2 and its association with demographic and anthropometric indices

    Directory of Open Access Journals (Sweden)

    Zahra Alizadeh

    2015-09-01

    Conclusion: The prevalence of vitamin D deficiency was high in obese and overweight population especially among individuals younger than 50 years. It seems that, it is necessary to add prevention and management of this deficiency to obesity treatment protocols especially in the young adults.

  19. 40 CFR 265.201 - Special requirements for generators of between 100 and 1,000 kg/mo that accumulate hazardous...

    Science.gov (United States)

    2010-07-01

    ... following special requirements for ignitable or reactive waste: (1) Ignitable or reactive waste must not be... following special requirements for incompatible wastes: (1) Incompatible wastes, or incompatible wastes and... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for generators of...

  20. Development of advanced Czochralski growth process to produce low cost 150 kg silicon ingots from a single crucible for technology readiness. [crystal growth

    Science.gov (United States)

    Lane, R. L.

    1981-01-01

    Six growth runs used the Kayex-Hameo Automatic Games Logic (AGILE) computer based system for growth from larger melts in the Mod CG2000. The implementation of the melt pyrometer sensor allowed for dip temperature monitoring and usage by the operator/AGILE system. Use of AGILE during recharge operations was successfully evaluated. The tendency of crystals to lose cylindrical shape (spiraling) continued to be a problem. The hygrometer was added to the Furnace Gas Analysis System and used on several growth runs. The gas chromatograph, including the integrator, was also used for more accurate carbon monoxide concentration measurements. Efforts continued for completing the automation of the total Gas Analysis System. An economic analysis, based on revised achievable straight growth rate, is presented.

  1. 75 FR 14379 - Airworthiness Directives; Rolls-Royce Deutschland Ltd & Co KG (RRD) Models Tay 620-15, Tay 650-15...

    Science.gov (United States)

    2010-03-25

    ...: Following a review of operational data of the Tay 651-54 engine, it has been found that the actual stress... any written relevant data, views, or arguments about this proposed AD. Send your comments to an... found that the actual stress levels in the Tay 651-54 engine High Pressure Compressor (HPC) stages 1, 3...

  2. Exportación de nibs de cacao nativo de fino aroma con niveles de cadmio <= 0.5 mg/kg

    OpenAIRE

    Santa Cruz Muñoz, Iris Magaly

    2016-01-01

    La tesis expone un plan de negocios que surge a raíz de la demanda creciente internacional del cacao debido a una demanda de un chocolate con mayor contenido de cacao, la cual debe satisfacer normas sociales, saludables, ecológicas y éticas del cual el Perú es reconocido como país productor de Cacao de Fino Aroma. Asimismo, existe la amenaza que tienen los productores latinoamericanos de cacao por haberse encontrado altos niveles de cadmio en granos de cacao, siendo este perjudicial para la s...

  3. Processing Pa-Lua Uranium ore by Mixing and Curing with Sulfuric Acid on a Scale of 500 kg/Batch to Recover Yellowcake

    International Nuclear Information System (INIS)

    Le Quang Thai; Cao Hung Thai; Le Thi Kim Dung; Phung Vu Phong; Tran Van Son

    2007-01-01

    Uranium ore in Pa-Lua area is sandstone with different levels of weathering. This kind of ore contains calcium and clay that may cause clogs during heap leaching. In this study, a technique of mixing and curing with strong acids is used and followed by washing to recover uranium. This study also focuses on study of ore processing issues such as crushing, regenerating particles in fine ores, mixing, curing and washing. The leach solution is treated by ion-exchange and precipitation of products by NH 4 OH. The experiment results show that regenerating a portion of fine ores, mixing and curing help washing residues in the column more effectively. Flow rate of the input solution can be controllable and stable. Columns do not clog even when washing takes place in the ore column of 5 meters high. Efficiency of uranium recovery can reach to 85-90%. Products of technical uranium are obtained with high quality. (author)

  4. Edaravone with and without .6 Mg/Kg Alteplase within 4.5 Hours after Ischemic Stroke: A Prospective Cohort Study (PROTECT4.5).

    Science.gov (United States)

    Yamaguchi, Takenori; Awano, Hideto; Matsuda, Hiroaki; Tanahashi, Norio

    2017-04-01

    Edaravone is widely used to treat acute ischemic stroke (AIS) within 24 hours of onset. We aimed to evaluate current edaravone treatment practices and the efficacy and safety of edaravone used with recombinant tissue plasminogen activator (tPA) in AIS patients within 4.5 hours of onset. The results were compared with those of the Safe Implementation of Treatments in Stroke-International Stroke Thrombolysis Registry (SITS-ISTR) study. PROTECT4.5 was a prospective observational study conducted from April 2010 to March 2013 in Japan. The primary end points were favorable outcomes (modified Rankin Scale score [mRS] 0-1) at 3 months after onset and incidence of symptomatic intracranial hemorrhage (sICH) within 36 hours of treatment. For comparison with SITS-ISTR, patients were categorized based on the time from onset to treatment (within 3 hours of and 3-4.5 hours after onset) and baseline National Institutes of Health Stroke Scale score (NIHSS). Among the 11,384 registered patients, 11,126 and 8274 patients were included in the safety and efficacy analysis populations, respectively. The proportions of patients with mRS 0-1 receiving edaravone alone and edaravone + tPA were 51.3% (95% confidence interval, 49.7%-52.8%) and 39.0% (37.6%-40.5%), respectively. The incidence of sICH within 36 hours after tPA treatment (edaravone + tPA group) was 1.6% (1.3%-2.0%). When compared with the SITS-ISTR results, those treated with edaravone + tPA appeared to show better outcomes in patients with NIHSS score ≥16. The efficacy and safety of edaravone combined with tPA and administered within 4.5 hours of AIS onset were demonstrated with numerically lower incidence of sICH and better outcomes. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  5. Cost analysis on a continuously operated fine chemicals production plant at 10 kg/day using a combination of microprocessing and microwave heating

    NARCIS (Netherlands)

    Benaskar, F.; Ben-Abdelmoumen, A.; Patil, N.G.; Rebrov, E.; Meuldijk, J.; Hessel, V.; Hulshof, L.A.; Krtschil, U.; Schouten, J.C.

    2011-01-01

    An extended cost study consisting of 14 process scenarios was carried out to envisage the cost impact of microprocessing and microwaves separately or in combination for two liquid-phase model reactions in fine-chemicals synthesis: (1) Ullmann C–O cross-coupling reaction and (2) the aspirin

  6. Reversal of rocuronium-induced (1.2 mg/kg) profound neuromuscular block by sugammadex: a multicenter, dose-finding and safety study.

    NARCIS (Netherlands)

    Boer, H.D. de; Driessen, J.J.; Marcus, M.A.; Kerkkamp, H.E.M.; Heeringa, M.; Klimek, M.

    2007-01-01

    BACKGROUND: Reversal of rocuronium-induced neuromuscular blockade can be accomplished by chemical encapsulation of rocuronium by sugammadex, a modified gamma-cyclodextrin derivative. This study investigated the efficacy and safety of sugammadex in reversing rocuronium-induced profound neuromuscular

  7. 76 FR 1342 - Airworthiness Directives; GROB-WERKE GMBH & CO KG Models G102 ASTIR CS, G102 CLUB ASTIR III, G102...

    Science.gov (United States)

    2011-01-10

    ... safety of the airframe. The spar spigot assembly is based on a safe-life design philosophy. A safe-life... inadequate to sustain the structure for the operational service life of the aircraft. Consequently, we issued... original design of the wing spar spigot assembly is inadequate to meet the airframe life limits and can not...

  8. 76 FR 59950 - Airworthiness Directives; BRP-Powertrain GMBH & CO KG 914 F2, 914 F3, and 914 F4 Reciprocating...

    Science.gov (United States)

    2011-09-28

    ...: Deliver to Mail address above between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays... Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory evaluation, any... 100246 inclusive. 100248 through 100280 inclusive. 100282 through 100293 inclusive. 100295 through 100314...

  9. Diseño y construcción de una despulpadora de frutas horizontal con una capacidad de producción de 250 Kg/h

    OpenAIRE

    Defaz Pallasco, Edison Marcelo; Tuza Cuzco, Fernando Patricio

    2011-01-01

    En la actualidad el Ecuador es un país productor de gran variedad de fruta, es así que parte de las fincas productoras de frutas únicamente se dedican al cultivo y cosecha, para luego venderlos en los mercados nacionales, cuyo valor final es pequeño comparado con el valor de los productos derivados de la fruta. La no existencia de procedimientos que mejoren las condiciones de producción de los procesadores de pulpa, calidad del producto, e incremento en la capacidad competitiva de las unid...

  10. The satisfaction level of indigenous people towards planned housing development. Case study: Orang Asli Kg. Sejagong, Sri Medan, Yong Peng Johor

    Science.gov (United States)

    Kamaruddin, S. M.; Zaini, N. S.; Misni, A.; Ahmad, P.

    2018-02-01

    Orang Asli possesses a unique relationship with their traditional land. Indigenous people have their thoughts on development, life values, visions, needs, and priorities. The government through Department of Orang Asli Development or Jabatan Kebajikan Orang Asli (JAKOA) implemented various development programs such as structured settlement program, physical improvements such as Regrouping Plan (RPS), Village Restructuring project (PSK), New Village Plan (RKB) and Orang Asli settlement customary Land Survey (village) / Land Acquisition. Orang Asli Community. However, their sense of satisfaction towards the development implemented is rarely evaluated. This paper aims to highlight Orang Asli’s thoughts and level of satisfaction towards the planned housing development of their settlement. A mixed methodology was employed using survey and interview to record their thoughts. The findings suggest that the Orang Asli Community’s sense of satisfaction towards housing development has improved. However, their needs to adhere to their social traditions and norms such as living adjacent to relatives, surrounded by nature within a low-density environment must be respected.

  11. Prime Contract Awards Alphabetically by Contractor, by State or Country, and Place. Part 19. (Tube Manufacturing Co., Inc.-Voith-Turbo GMBH & Co. KG)

    Science.gov (United States)

    1989-01-01

    R RT PForm Approved OMB No. 0704-0188 PuOlic reporting ourden for this collection of information is estimated to average I hour per response... collection of information. Sena comments regarding this burden estimate or any other aspect of this collection of information, including suggestions...00 0 00Oc0 oc00000000c ODK IS1 aK N K L In K 01.0 11 K -e O 1 in0 qqI 4444444444444444444444444 * 0-4C’~i ) 0-4 C’) 0II II -4C Wr MI 00 00 00 00 0

  12. Diseño y construcción de un prototipo para el envejecimiento de arroz con capacidad de 40 Kg/dia

    OpenAIRE

    Quingatuña Gallardo, Jaime René; Sigcha Cunalata, Kleber Renato

    2013-01-01

    The present titillation project embraces the design and construction of a prototype of aging rice. The recently harvested, given rice its high percentage of humidity, doesn't possess the appropriate qualities for the feeding and for it he/she knows it to him as "new rice" and its price is low. This rice should be dried under certain conditions that at the same time that it reduces its humidity, their molecular chains that improve its pleasure notably when being ingested transforms. The ...

  13. Comparison of ropivacaine (0.2%) with or without clonidine 1 μg/kg for epidural labor analgesia: A randomized controlled study

    OpenAIRE

    Indira Kumari; Kapil Sharma; Vikram Bedi; Madhan Mohan; Hemraj Tungaria; Manish Kumar Modi

    2018-01-01

    Background and Aims: The aim is to determine the effect of addition of clonidine to ropivacaine for epidural labor analgesia with regard to onset of analgesia, duration of analgesia, neonatal outcome, and quality of analgesia. Material and Methods: A total of 60 term parturients of the American Society of Anesthesiologists Grade I and II with uncomplicated pregnancy, vertex presentation, posted for on-demand epidural labor analgesia after informed consent were divided in two groups. Group ...

  14. Effect of Phytase on Apparent Total Tract Digestibility of Phosphorus in Corn-Soybean Meal Diets Fed to 100 kg Pigs

    Science.gov (United States)

    Five experiments were conducted to investigate the ability of different sources of phytase supplemented to the diet at graded levels to improve apparent P digestibility in finishing pigs. A corn-soybean meal basal diet containing 0.50% Ca and 0.32% P (0.06% available P) was used in all experiments a...

  15. Discussing simply waste water treatment in building green mine

    International Nuclear Information System (INIS)

    Zhou Yousheng

    2010-01-01

    Analysis simplfy it is important and necessary that uran ore enterprise build the green mine .According to focusing on waste water treatment in building green mine of some uran ore enterprise,analysis the problem in treating mine water, technics waste water, tailings water before remoulding the system of waster water treatment, evaluate the advanced technics, satisfy ability, steady effect, reach the mark of discharge. According to the experimental unit of building the green mine,some uran ore enterprise make the waster water reaching the mark of discharge after remoulding the system of waster water treatment.It provides valuable experienceto uran ore enterprise in building green mine. (authors)

  16. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available urans R1] ... Length = 128 ... Query: 6 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPME...ALLGALATCTAYDVVEIMKKRRT 65 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPMEALLGALATCTAYDVVEIMKKRRT Sbjct: ...1 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPMEALLGALATCTAYDVVEIMKKRRT 60 ... Query: 126 EIVVEAEL 133 ... EIVVEAEL Sbjct: 121 EIVVEAEL 128

  17. Contribution to the study of corrosion of zirconium and zircaloy-2 in superheated steam at 400 deg C (105 kg /cm{sup 2}); Contribution a l'etude de la corrosion du zirconium et du zircaloy-2 dans la vapeur d'eau surchauffee a 400 deg C (105 kg /cm{sup 2})

    Energy Technology Data Exchange (ETDEWEB)

    Coriou, H; Gauduchau, J; Grall, L; Hure, J; Pelras, M [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    The corrosion kinetics of zircaloy-2 in water and steam at temperatures between 300 deg. C and 400 deg. C are represented by a curve sharply divided into two stages separated by a so-called transition point. After a first period of decreasing corrosion rate there follows a second period with much faster kinetics in which the speed is constant. After carrying out a methodical study of the corrosion of 'zircaloy-2 in the form of sheets and tubes. We have demonstrated, at 400 deg. C in steam, a systematic anomaly which appears at the transition point. The curve presents three quite distinct points; after the first period a fast corrosion is observed, followed by a third period at a slower speed. This leads us to believe that there may be not a single point but a transition zone, separating two types of kinetic behaviour and corresponding to modifications in the properties of the oxide layer. After this readjustment period a new corrosion law is established, lasting a considerable time, the corrosion speed being slower than that indicated so far. A study of the morphology of the oxide films which develop under these conditions has demonstrated the special part played by mechanical, physical and metallurgical factors in the case of zirconium. Deep penetration of oxide can thus show up on the inner wall of hammer-hardened tubes. Simultaneously a very considerable hydride formation occurs in the metal. (author) [French] La cinetique de corrosion du zircaloy-2 dans l'eau et la vapeur a des temperatures comprises entre 300 et 400 deg. C est representee par une courbe a deux periodes separees par un point singulier appele point de transition. A une premiere periode a vitesse de corrosion decroissante, succede une deuxieme periode a cinetique beaucoup plus rapide dont la vitesse est constante. Apres une etude systematique de la corrosion du zircaloy-2 sous forme de toles et de tubes, nous avons mis en evidence a 400 deg. C, dans la vapeur, une anomalie systematique qui se produit au point de transition. La courbe presente trois parties bien distinctes a la fin de la premiere periode, on observe une corrosion a vitesse importante, suivie par une troisieme periode a vitesse plus faible. Nous serions donc amenes a penser qu'il peut y avoir non un point, mais une zone de transition separant deux cinetiques et correspondant a des modifications de proprietes de la couche d'oxyde. Apres cette periode de rearrangement, on obtient une nouvelle loi de corrosion qui se poursuit jusqu'a des durees importantes, la vitesse de corrosion etant plus faible que celle qui a ete indiquee jusqu'ici. Une etude de la morphologie des films d'oxyde developpes dans ces conditions a permis de mettre en evidence le role particulier que peuvent jouer dans le cas du zirconium les facteurs mecaniques, physiques et metallurgiques. Des penetrations profondes de l'oxyde peuvent ainsi se manifester sur la paroi interne de tubes ecrouis. Simultanement, il se produit une hydruration tres importante du metal. (auteur)

  18. Deploiment of the national research and educational network “URAN” in the frame of the state program “information and connunication technology in education and science” for 2006-2010.

    Directory of Open Access Journals (Sweden)

    V.G. Galagan

    2009-11-01

    Full Text Available It is shown results of connection of universities and scientific institutions to URAN network including optic fibers deployment in Ukrainian cities and URAN-GEANT 10 Gbps. It is discussed also means of providing of uninterruptable service to metropolitan area network users and implementation of network applied services.

  19. Investigating the structural changes of uranium dioxide dependent on additives, Phase I - Uranium-oxide system from structural-phase aspect; Ispitivanje strukturnih promena kod urandioksida u zavisnosti od aditiva, I faza - Sistem Uran-kiseonik sa strukturno-faznog aspekta

    Energy Technology Data Exchange (ETDEWEB)

    Manojlovic, Lj [Institute of Nuclear Sciences Boris Kidric, Laboratorija za reaktorske materijale, Vinca, Beograd (Serbia and Montenegro)

    1962-12-15

    Having in mind the complex structure of the system uranium-oxygen, and that experimental studies of this system lead to controversial conclusions, an extensive review and analysis of the papers published on this subject were needed. This review wold be very useful for interpreting the expected structural changes of the uranium dioxide dependent on the additives.

  20. Changes in UO2 powder properties during processing via BNFL's binderless route

    International Nuclear Information System (INIS)

    Bromely, A.P.; Logsdon, R.; Roberts, V.A.

    1997-01-01

    The Short Binderless Route (SBR) has been developed for Mixed Oxide fuel production in BNFL's MOX Demonstration Facility (MDF) and the Sellafield MOX Plant (SMP). It is a compact process which enables good homogenisation of the Pu/U mixture and production of free flowing press feed materials. The equipment used to achieve this consists of an attritor mill to provide homogenization and a spheroidiser to provide press feed granules. As for other powder processes, the physical properties of the UO 2 powder can affect the different process stages and consequently a study of some of these effects has been carried out. The aim of the work were to gain a better understanding of the process, to consequently optimize press feed material quality and to also maintain powder hold-up levels in the equipment at a minimum. The paper considers the effects of milling processes on powder morphology and powder surface effects, on the granulation process and also on powder and granule bulk properties such as pour, tap and compaction densities. Results are discussed in terms of powder properties such as powder cohesivity, morphology and particle size. UO 2 powder derived from both the Integrated Dry Route (IDR) and the Ammonium Di-Uranate (ADU) Route are considered. Small (1 kg) scale work has been carried out which has been confirmed by larger (25 kg) scale trials. The work shows that IDR powder with differing morphologies and ADU powder can be successfully processed via the SBR route. (author). 4 figs, 4 tabs

  1. Method for the recovery of uranium values from uranium tetrafluoride

    International Nuclear Information System (INIS)

    Kreuzmann, A.B.

    1984-01-01

    The invention comprises reacting particulate uranium tetrafluoride and alkaline earth metal oxide (e.g. CaO, MgO) in the presence of gaseous oxygen to effect formation of the corresponding alkaline earth metal uranate and alkaline earth metal fluoride. The product uranate is highly soluble in various acidic solutions whereas the product fluoride is virtually insoluble therein. The product mixture of uranate and alkaline earth metal fluoride is contacted with a suitable acid to provide a uranium-containing solution, from which the uranium is recovered. (author)

  2. Dimensionado de una bodega de elaboración de vino tinto con capacidad para la entrada de 100 000Kg de uva,Sección clarificación a embotellado

    OpenAIRE

    Martín Ballesteros, Mónica

    2012-01-01

    Se ha dimensionado una Bodega de elaboración de vino tinto con capacidad para producir 91.866 botellas de vino, de las cuales 45.833 (50%) se destinarán como vino joven, 28.551 (31%) como crianza, 1.586 (2%) como Reserva, 1.586 (2%) como Gran Reserva y 14.309 (15,6%) como vino Mesa; el proyecto ha abarcado la sección desde la Clarificación al Embotellado. La Bodega se ha situado en la localidad de Serrada, dentro de la Denominación de Origen de Rueda (D.O.R), en la provincia de Vallado...

  3. Efecto del Manano Oligosacárido (MOS) a dosis de 1g/Kg en un alimento balanceado en el crecimiento y mortalidad en cobayos (Cavia porcellus) hembras

    OpenAIRE

    Siguencia Fernandez, Jessica Noemi

    2017-01-01

    This research evaluates the effect of mannan-oligosaccharide (MOS) on weight gain, feed conversion and mortality in female guinea pigs, three treatments were carried out: (a) Control, (b) MOS and (c) Growth Promoter Antibiotic for 10 consecutive weeks; no significant effects of the treatments on the variables evaluated were detected. Esta investigación evalúa el efecto del manano-oligosacárido (MOS) sobre el incremento de peso, conversión alimenticia y mortalidad en cobayos hembras, se rea...

  4. Evaluación de la inclusión del manano oligosacarido a dosis de 1.5 g/kg en el crecimiento y mortalidad en cobayos (Cavia porcellus) machos

    OpenAIRE

    Bermeo Sacta, Jessica Alexandra

    2018-01-01

    El trabajo experimental fue realizado en la Granja Experimental Paute en la provincia del Azuay, cantón Paute, en el cual se evaluó la inclusión del prebiótico manano oligosacárido (MOS) en el balanceado de los cobayos machos durante diez semanas, con el fin de evaluar los caracteres de crecimiento y mortalidad, como resultado no se obtuvo efectos significativos. The experimental work was carried out in the experimental farm in the province of Azuay Paute. In inclusion of the oligosacchari...

  5. The certification of the surface density (kg/m sub 2 ) of BCR CRM 038 ('fly ash from pulverised coal') comprised in methyl cellulose films simulating dust charged filters. BCR 128

    Energy Technology Data Exchange (ETDEWEB)

    Griepink, B; Marchandise, H; Colinet, E; Dams, R

    1988-01-01

    BCR CRM 38 ('Fly Ash') has been embedded in a stable methylcellulose foil of about 10{mu}m thickness. This has been done by making a slurry of fly ash and methylcellulose in water and spiking it with {sup 42}K as a radioactive tracer. The slurry was spread over glass plates and allowed to dry. 'Filters' of uniform size were punched out of the foil. The surface density (e.g. {mu}g/cm{sup 2}) of the fly ash was calculated for each individual 'filter' by comparing the {sup 42}K-activity of the filter with that of the initial suspension. The uncertainties in the so obtained surface density of random and of systematic origin have been estimated. The total relative uncertainty in the surface density of every element certified in BCR 38 is 4-6%. Studies of stability and homogeneity have revealed that this material is well suited for the verification of the results of non-destructive analytical techniques for dust components.

  6. Diseño y construcción de un equipo para ensayo de deflexión en vigas de aluminio, en voladizo. Capacidad de carga de 10 kg.

    OpenAIRE

    Oña Caiza, Luis Alberto; Reinoso Sacancela, Armando Rodrigo

    2010-01-01

    En la actualidad con el avance de la tecnología y con la implementación de nuevos equipos para ensayos de deflexión en los materiales conlleva a la necesidad de elaborar un equipo de ensayo de deflexión para vigas en voladizo (viga rectangular y perfil U), en material de aluminio para la utilización en el laboratorio de resistencia de materiales de la Universidad Politécnica Salesiana. Para la selección de la alternativa más adecuada se realizó un estudio del costo real de la máquina en e...

  7. Manuel J. Peláez (dir., Diccionario de Canonistas y Eclesiasticistas Europeos y Americanos (Tomo I, AV Akademikerverlag GmbH & Co. KG, EAE, Saarbrücken, 2012, 547 págs.

    Directory of Open Access Journals (Sweden)

    Purificación Alcaide-Pulido

    2013-03-01

    Full Text Available ¿Por qué se otorga escasa atención a los canonistas y eclesiasticistas dentro del Derecho canónico y del Derecho eclesiástico? Esta es la cuestión que surge y el motivo de la aparición de la obra Diccionario de canonistas y eclesiasticistas europeos y americanos. Dicha obra aparece como una necesidad científica emanada de la escasa atención que en el ámbito citado se presta a canonistas y a eclesiasticistas, a través de una recopilación de los pensadores más influyentes en las diversas áreas que comprenden el Derecho Canónico y Eclesiástico, a lo largo del último milenio y, por ende, también de interés para iushistoricistas.

  8. Narasin effects on energy, nutrient, and fiber digestibility in corn-soybean meal or corn-soybean meal-dried distillers grains with soluble diets fed to 16-, 92-, and 141-kg pigs

    Science.gov (United States)

    Three experiments were conducted determine the effect of narasin on growth performance, and on GE and nutrient digestibility in nursery, grower, and finishing pigs fed either a corn-soybean (CSBM) diet or a CSBM diet supplemented with distillers dried grains with solubles (DDGS), in combination with...

  9. Evaluation of the effect of intra-operative intravenous fluid on post-operative pain and pulmonary function: a randomized trial comparing 10 and 30 ml kg(-1) of crystalloid.

    LENUS (Irish Health Repository)

    Straub, B D

    2013-12-10

    Existing evidence suggests that administration of intravenous fluids has been shown to improve outcomes including pain in gynecological laparoscopic surgery but the optimum fluid dose has not been determined.

  10. Laparoscopic jejunoileal side-to-side anastomosis for the treatment of type 2 diabetes mellitus in Chinese patients with a body mass index of 24–32 kg/m2

    Directory of Open Access Journals (Sweden)

    Jin Li

    2016-01-01

    Conclusion: LJISSA seems to be a promising procedure for the control of T2DM. A multicenter study with a larger number of patients and a longer follow-up period is needed to substantiate our preliminary findings.

  11. Data Accuracy of the Bubble Sheet Ambulatory Data System and the KG-Ambulatory Data System in the Internal Medicine Clinic, Bayne-Jones Army Community Hospital, Fort Polk, Louisiana

    National Research Council Canada - National Science Library

    MacLaren, Lisa

    2000-01-01

    ...) and Ambulatory Patient Group (APG) outpatient prospective payment system (OPPS). Three data sets were examined at different points in time based on type of ADS used and implementation of data quality management efforts...

  12. Diseño de un transportador aéreo capacidad 500 kg altura 300 metros, para la Central Hidroeléctrica Ing. Carlos Mora Carrión de la Provincia de Zamora Chinchipe

    OpenAIRE

    Vicente Macas, Oswaldo David

    2009-01-01

    El transporte por cable es considerado como un medio de transporte independiente, diferente de los medios convencionales como lo son carretera, ferrocarril, aéreo, marítimo, y tubería. Es evidente que su importancia dentro del campo global de transporte es limitada, tanto en lo relativo a su importancia económica como en lo que se refiere a la capacidad de carga y distancias de recorrido. A pesar de todo lo mencionado es un sistema que se encuentra en un proceso de renovación y evolución t...

  13. Depletion of florfenicol amine in tilapia (Oreochromis sp.) maintained in a recirculating aquaculture system following Aquaflor(R)-medicated feed therapy (20 mg/kg BW/d for 10 days)

    Science.gov (United States)

    Gaikowski, Mark P.; Whitsel, Melissa K.; Charles, Shawn; Schleis, Susan M.; Crouch, Louis S.; Endris, Richard G.

    2013-01-01

    Aquaflor® [50% w w−1 florfenicol (FFC)], is approved for use in freshwater-reared warmwater finfish which include tilapia Oreochromis spp. in the United States to control mortality from Streptococcus iniae. The depletion of florfenicol amine (FFA), the marker residue of FFC, was evaluated after feeding FFC-medicated feed to deliver a nominal 20 mg FFC kg−1 BW d−1 dose (1.33× the label use of 15 mg FFC kg−1 BW d−1) to Nile tilapia O. niloticus and hybrid tilapia O. niloticus × O. aureus held in a recirculating aquaculture system (RAS) at production-scale holding densities. Florfenicol amine concentrations were determined in fillets taken from 10 fish before dosing and from 20 fish at nine time points after dosing (from 1 to 240 h post-dosing). Water samples were assayed for FFC before, during and after the dosing period. Parameters monitored included daily feed consumption and biofilter function (levels of ammonia, nitrite and nitrate). Mean fillet FFA concentration decreased from 13.77 μg g−1 at 1-h post dosing to 0.39 μg g−1 at 240-h post dosing. Water FFC concentration decreased from a maximum of 1400 ng mL−1 at 1 day post-dosing to 847 ng mL−1 at 240 h post-dosing. There were no adverse effects noted on fish, feed consumption or biofilter function associated with FFC-medicated feed administration to tilapia.

  14. Single-molecule magnetism in a single-ion triamidoamine uranium(V) terminal mono-oxo complex

    Energy Technology Data Exchange (ETDEWEB)

    King, David M.; McMaster, Jonathan; Lewis, William; Blake, Alexander J.; Liddle, Stephen T. [Nottingham Univ. (United Kingdom). School of Chemistry; Tuna, Floriana; McInnes, Eric J.L. [Manchester Univ. (United Kingdom). School of Chemistry

    2013-04-26

    Straightforward oxidation of a triamidoamine uranium(III) complex with trimethyl-N-oxide affords a uranium(V) terminal mono-oxo complex which is the first clear-cut example of a uranium(V) single-molecule magnet (SMM). This monometallic complex unambiguously shows that a strongly axially ligated and thus anisotropic ligand field can be used to overcome the limited magnetic anisotropy of uranium(V). [German] Die direkte Oxidation eines Triamidoamin-Uran(III)-Komplexes mit Trimethyl-N-oxid liefert einen terminalen Uran(V)-Mono(oxo)komplex, der das erste gesicherte Beispiel eines Uran(V)-Einzelmolekuelmagnets ist. Dieser monometallische Komplex zeigt eindeutig, dass ein starkes axiales und somit anisotropes Ligandenfeld die begrenzte magnetische Anisotropie von Uran(V) beseitigen kann.

  15. Thermogravimetric control of intermediate compounds in uranium metallurgy

    International Nuclear Information System (INIS)

    Gasco Sanchez, L.; Fernandez Cellini, R.

    1959-01-01

    The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs

  16. Thermogravimetric control of intermediate compounds in uranium metallurgy; Control termogravimetrico de productos intermedios de la metalurgia del uranio

    Energy Technology Data Exchange (ETDEWEB)

    Gasco Sanchez, L; Fernandez Cellini, R

    1959-07-01

    The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs.

  17. Processing of Madagascar's concentrates; Traitement des concentres de Madagascar

    Energy Technology Data Exchange (ETDEWEB)

    Mouret, P; Madinier, A

    1949-06-01

    This report describes the equipment (tanks, filters..) of the ore processing workshop of Le Bouchet used for the processing of the uranium ore from Madagascar (autunite). Then it describes the processing scheme: treatment with sodium carbonate, de-complexing of uranyl carbonate with soda, filtering, washing, drying and calcination of sodium uranate. The volume of reagents used, the production rate and the purity of the uranate obtained are given in conclusion. (J.S.)

  18. Thermogravimetric control of intermediate compounds in uranium metallurgy; Control termogravimetrico de productos intermedios de la metalurgia del uranio

    Energy Technology Data Exchange (ETDEWEB)

    Gasco Sanchez, L.; Fernandez Cellini, R.

    1959-07-01

    The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs.

  19. Role of contaminants in the fluorination of β-UO3 to UF4 by freon-12

    International Nuclear Information System (INIS)

    Girgis, B.S.; Rofail, N.H.

    1992-01-01

    Ammonium uranate was precipitated from uranyl nitrate or sulphate by NH 3 gas or urea, and decomposed to β-UO 3 by calcination at 623 or 773 K. Oxides contaminated by high contents of nitrates (non-washed uranate) displayed higher conversion to UF 4 in comparison to the respective pre-washed uranate. Products of thermal treatment at 623 K were also more reactive towards fluorination, which was ascribed to the highly-disordered, loosely bound, high surface area products. The presence of residual nitrate, and probably ammonium, ions help in the partial reduction to lower oxides and in preventing recrystallization of the reaction solids. Ammonium uranate precipitated from uranyl sulphate and decomposed at 623 K is more easily fluorinated than the product decomposed at 773 K; it is also better product for fluorination than the uranate precipitated from uranyl nitrate. The complete conversion to UF 4 i attained after 45 min with the uranate precipitated from uranyl sulphate and treated at 623 K, but it needs 120 min with the product formed from uranyl nitrate and decomposed at the same temperature. (orig.)

  20. Salt separation of uranium deposits generated from electrorefining in pyro process

    International Nuclear Information System (INIS)

    Kwon, S. W.; Park, K. M.; Jeong, J. H.; Lee, H. S.; Kim, J. G.

    2012-01-01

    Electrorefining is a key step in a pyro processing. Electrorefining process is generally composed of two recovery steps- deposit of uranium onto a solid cathode(electrorefining) and then the recovery of the remaining uranium and TRU(TransUranic) elements simultaneously by a liquid cadmium cathode(electrowinning). The uranium ingot is prepared from the deposits after the salt separation. In this study, the sequential operation of the liquid salt separation? distillation of the residual salt was attempted for the achievement of high throughput performance in the salt separation. The effects of deposit size and packing density were also investigated with steel chips, steel chips, and uranium dendrites. The apparent evaporation rate decreased with the increasing packing density or the increasing size of deposits due to the hindrance of the vapor transport by the deposits. It was found that the packing density and the geometry of deposit crucible are important design parameters for the salt separation system. Base on the results of the study, an engineering scale salt distiller was developed and installed in the argon cell. The salt distiller is a batch-type, and the process capacity to about 50 kg U-deposits/day. The design of the salt distiller is based on the remote operation by Master Slave Manipulator (MSM) and a hoist. The salt distiller is composed of two large blocks of the distillation tower and the crucible loading system for the transportation to maintenance room via the Large Transfer Lock (LTL)

  1. Pilot plant studies on the treatment of El Atshan Uranium Ores, Eastern Desert, Egypt.

    Energy Technology Data Exchange (ETDEWEB)

    Abd Elghany, M S; Mahdy, M A [Nuclear materials authority, El-Maadi, Cairo, (Egypt); Abd El-Monem, A M; El-Hazek, A T [Faculty of engineering, Cairo university, Cairo, (Egypt)

    1995-10-01

    The present work deals with studying the different processes leading to the preparation of commercial uranium concentrate (yellow cake) from El Atshan granitic ore material (0.077%U) after acid leading of the latter, the two common extraction techniques of uranium from the obtained sulphate leach liquor; namely, anion exchange rein and solvent extraction have been studied. The studied leaching and extraction conditions-realized on the lab scale-were applied to inches pilot plant unit (capacity 150 kg ore). An average leaching leaching efficiency exceeding 88% has been achieved. Using anion exchange resin, it has been possible to prepare a uranium peroxide concentrate assaying a uranium content of about 67% U{sub 3} O{sub 8}. Only trace amount of Ca, Fe, Po{sub 4}, Cr and Pb have been detected. On the other hand, sodium uranate, as a uranium precipitate was prepared from the strip solution of the loaded solvent (di-2-ethyl) phosphoric acid concerned with the evaluation of a new optimized technique for the principle of chloramine-T method used for insulin iodination for the modified procedure can be carried out under normal condition of room temperature, employed longer reaction times and omitted the addition of inorganic reducing salts maintaining efficient iodination and avoiding denaturation to obtain labels of exceedingly high specific activity and small quantities of insulin for in vitro usage in the investigation of human erythrocytes 125 I-inulin binding capacity in normal and in some disease status. 9 figs., 2 tabs.

  2. Pilot plant studies on the treatment of El Atshan Uranium Ores, Eastern Desert, Egypt

    International Nuclear Information System (INIS)

    Abd Elghany, M.S.; Mahdy, M.A.; Abd El-Monem, A.M.; El-Hazek, A.T.

    1995-01-01

    The present work deals with studying the different processes leading to the preparation of commercial uranium concentrate (yellow cake) from El Atshan granitic ore material (0.077%U) after acid leading of the latter, the two common extraction techniques of uranium from the obtained sulphate leach liquor; namely, anion exchange rein and solvent extraction have been studied. The studied leaching and extraction conditions-realized on the lab scale-were applied to inches pilot plant unit (capacity 150 kg ore). An average leaching leaching efficiency exceeding 88% has been achieved. Using anion exchange resin, it has been possible to prepare a uranium peroxide concentrate assaying a uranium content of about 67% U 3 O 8 . Only trace amount of Ca, Fe, Po 4 , Cr and Pb have been detected. On the other hand, sodium uranate, as a uranium precipitate was prepared from the strip solution of the loaded solvent (di-2-ethyl phosphoric acid concerned with the evaluation of a new optimized technique for the principle of chloramine-T method used for insulin iodination for the modified procedure can be carried out under normal condition of room temperature, employed longer reaction times and omitted the addition of inorganic reducing salts maintaining efficient iodination and avoiding denaturation to obtain labels of exceedingly high specific activity and small quantities of insulin for in vitro usage in the investigation of human erythrocytes 125 I-inulin binding capacity in normal and in some disease status. 9 figs., 2 tabs

  3. Salt separation of uranium deposits generated from electrorefining in pyro process

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, S. W.; Park, K. M.; Jeong, J. H.; Lee, H. S.; Kim, J. G. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2012-03-15

    Electrorefining is a key step in a pyro processing. Electrorefining process is generally composed of two recovery steps- deposit of uranium onto a solid cathode(electrorefining) and then the recovery of the remaining uranium and TRU(TransUranic) elements simultaneously by a liquid cadmium cathode(electrowinning). The uranium ingot is prepared from the deposits after the salt separation. In this study, the sequential operation of the liquid salt separation? distillation of the residual salt was attempted for the achievement of high throughput performance in the salt separation. The effects of deposit size and packing density were also investigated with steel chips, steel chips, and uranium dendrites. The apparent evaporation rate decreased with the increasing packing density or the increasing size of deposits due to the hindrance of the vapor transport by the deposits. It was found that the packing density and the geometry of deposit crucible are important design parameters for the salt separation system. Base on the results of the study, an engineering scale salt distiller was developed and installed in the argon cell. The salt distiller is a batch-type, and the process capacity to about 50 kg U-deposits/day. The design of the salt distiller is based on the remote operation by Master Slave Manipulator (MSM) and a hoist. The salt distiller is composed of two large blocks of the distillation tower and the crucible loading system for the transportation to maintenance room via the Large Transfer Lock (LTL)

  4. Human health risk assessment of uranium in drinking water sampled from drilled wells located in rural areas of the Lower Silesian region (Poland / Ocena ryzyka zdrowotnego związanego z obecnością uranu w wodzie przeznaczonej do spożycia pobieranej z wierconych studni zlokalizowanych na obszarach wiejskich Dolnego Śląska (Polska

    Directory of Open Access Journals (Sweden)

    Garboś Sławomir

    2015-06-01

    Full Text Available Stężenia uranu w wodach gruntowych pobieranych z prywatnych studni wierconych nie były dotąd badane w Polsce. W związku z tym, brak jest jakichkolwiek danych pozwalających na określenie narażenia ludzi na uran, związanego z konsumpcją wody przeznaczonej do spożycia, w szczególności na obszarach wiejskich, na terenach których prowadzono działalność górniczą. Głównym celem niniejszej pracy była ocena ryzyka zdrowotnego związanego z konsumpcją wód studziennych zawierających uran, pobieranych z wytypowanych obszarów wiejskich Dolnego Śląska (Polska. Do pobierania próbek wód studziennych z trzech obszarów badań kontrolnych (CSA: Mniszków (CSA-A, Stara Kamienica/M. Kamienica/Kopaniec (CSA-B i Kletno (CSA-C, została zastosowana metoda RDT (ang.: Random DayTime. Analizy próbek RDT przeprowadzono za pomocą zwalidowanej metody opartej na spektrometrii mas z jonizacją w plazmie indukcyjnie sprzężonej (ICP-MS. Zakresy stężeń uranu w wodach studziennych i wyznaczone średnie geometryczne stężenia U w przypadkach poszczególnych obszarów wynosiły: 0,005-1,03 μg/L i 0,052 μg/L (CSA-A, 0,027-10,6 μg/L i 0,40 μg/L (CSA-B oraz 0,006-27,1 μg/L i 0,38 μg/L (CSA-C. Średnie i indywidualne chroniczne dzienne pobrania (CDI, ang. Chronic Daily Intake uranu związane z konsumpcją wody przeznaczonej do spożycia (dorośli/dzieci zawarte były odpowiednio w zakresach: 0,0017-0,013/0,0052-0,040 μg · kg-1 · dzień-1 i 0,0002-0,90/0,0005-2,71 μg · kg-1 · dzień-1. Wyznaczone średnie i zakresy indywidualnych procentowych udziałów wartości CDI w tolerowanym dziennym pobraniu (TDI=1 μg · kg-1 · dzień-1, ang. Tolerable Daily Intake (dorośli/dzieci wynosiły: 0,17%/0,52% i 0,02-3,4%/0,05-10,3% (CSA-A, 1,3%/4,0% i 0,09-35%/0,27-106% (CSA-B oraz 1,3%/3,8% i 0,02-90%/0,06-271% (CSA-C. Wyznaczone średnie wartości CDI uranu są znacząco niższe od ustalonej wartości TDI, podczas gdy w przypadkach indywidualnych

  5. Luminescence and energy transfer

    Energy Technology Data Exchange (ETDEWEB)

    Blasse, G; Bleijenberg, K C; Powell, R C

    1980-01-01

    This paper deals with the luminescence of uranate centres in solids. The luminescence properties are influenced by the coordination number of the hexavalent uranium ion and by the crystallographic surroundings of the uranate centre. Transitions playing a role in the luminescence processes within the octahedral UO/sub 6//sup 6 -/ group are discussed using the results from both theoretical and experimental studies on another octahedral uranium complex: UF/sub 6/. The luminescence of the octahedral uranate group in oxidic compounds is discussed. Attention is paid to the vibrational structure, which is observed in the luminescence spectra at low temperatures and to the temperature quenching of the luminescence. The temperature quenching of the uranate luminescence in uranium-doped tungstates with ordered perovskite structure can be described in terms of a three state single configurational coordinate diagram. The complicated luminescence spectra of uranium-activated sodium fluoride (NaF-U) crystals have been unraveled using chemical variation of the crystal compositions and using site selective laser excitation techniques. Four different luminescent uranate centres have been observed in NaF-U. A model for the configurations of the luminescent centres has been deduced using the results from ionic conductivity experiments.

  6. Unsteady Reynolds Averaged Navier-Stokes and Large Eddy Simulations of Flows across Staggered Tube Bundle for a VHTR Lower Plenum Design

    International Nuclear Information System (INIS)

    Choi, Hyeon Kyeong; Park, Jong Woon

    2013-01-01

    In this work, behavior of unsteady and oscillating flow through a typical tube bundle array are analyzed by unsteady computations: 2D unsteady Reynolds averaged Navier-Stokes (URANS) and 3D Large Eddy Simulation (LES) and the results are compared with existing experimental data. In order to confirm appropriateness and limitations of CFD applications in the Korean VHTR design, two types of unsteady computations are performed such as 2D unsteady Reynolds averaged Navier-Stokes (URANS) and 3D Large Eddy Simulation (LES) for the existing tube bundle array. The velocity component profiles are compared with the experimental data and it is concluded that the URANS with the standard k-ω model is reasonably appropriate for cost-effective VHTR lower plenum analysis. Nevertheless, if more accurate results are needed, the LES-Smagorinsky computation is recommended considering limitations in the time averaged RANS in capturing small eddies

  7. A thermal analysis - mass spectrometric study of the reactions in the binary nitrate system UO2(NO3)2.6H2O-Ba(NO3)2

    International Nuclear Information System (INIS)

    Kalekar, B.B.; Rajagopalan, K.V.; Ravindran, P.V.

    2008-01-01

    Solid state reaction between uranyl nitrate hexahydrate and barium nitrate at elevated temperatures has been studied. Barium nitrate does not react directly with uranyl nitrate hexahydrate (UNH). The decomposition product of the latter, UO 3 , however, reacts with molten barium nitrate to form nitrato complexes which decompose to form barium uranates. The decomposition of the nitrato complex is often attended by a change of oxidation state of uranium. Uranyl-nitrate-rich compositions form uranates with uranium in oxidation state V, whereas barium-nitrate-rich compositions form uranates with uranium in oxidation state VI. The tendency for hydrolysis of uranyl nitrate hexahydrate at elevated temperatures is lowered in presence of barium nitrate and, unlike in the case of dehydration of pure UNH, uranyl nitrate dihydrate is formed as dehydration intermediate. (author)

  8. Stoichiometry of the U3O8 phase formed during calcination of some uranium compounds

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Farah, M.Y.; Rofail, N.H.

    1981-01-01

    Although recent work has shown U 3 O 8 phase to be the decomposition product obtained after calcining uranyl nitrate, sulphate or ammonium uranate, neither the necessary conditions for obtaining stoichiometric U 3 O 8 nor the details of the reaction have been established. Presence of sulphate or nitrate ions during preparation greatly affects the O/U of the obtained oxides and the physico-chemical properties of uranium tetrafluoride prepared afterwards from it (1-3). The aim of the present investigation was to study the effect of calcination regimes on the stoichiometry of the U 3 O 8 phase produced by the thermal decomposition of uranyl nitrate, sulphate, and ammonium uranate, which was prepared by precipitation from nuclear-pure uranyl sulphate. Stoichiometry of the U 3 O 8 phase formed during calcination of ammonium uranate precipitated from nuclear pure uranyl nitrate solution was reported before (1)

  9. Atomic energy, fundamental project, 1990, Japan

    International Nuclear Information System (INIS)

    1990-01-01

    The project is composed of the following items: 1. Synthetic strengthening countermeasure for guanrantee of safety. (1) Completion of administration for regulation, (2) promotion of research, (3) disaster prevention. 2. Promotion of nuclear power generation. 3. Establishment of nuclear fuel cycle. (1) Secure the uran-resources, (2) domestic uran-concentration, (3) reprocessing of spent fuel and utilization of recovered uran, (4) radioactive waste disposal. 4. Development of new type power reactors and utilization of plutonium (1) FBR, (2) ATR, (3) plutonium fuel processing technology. 5. Promotion of leading projects. (1) Research of nuclear fusion, (2) radiation utilization, (3) R and D of nuclear ship, (4) high temperature technology testing research. 6. Promotion of fundamental technology development, etc. 7. Subjective and active international contribution. 8. Understanding and cooperation of the nation. (M.T.)

  10. A study on the equilibrium relationships in the system Ni-U-O in air and in oxygen

    International Nuclear Information System (INIS)

    Elmasry, M.A.A.; Younis, S.S.

    1996-01-01

    The phase relationships for the ternary system Ni-U-O were established in air and in oxygen. Mixtures of Ni O and U 3 O 8 were found to oxidize to Ni U O 4 that was identical to that previously published for Ni U 3 O 1 0. The nickel uranate dissociates to Ni O, U 3 O 8 and oxygen at a temperature higher than that of the oxidation. The dissociation products go back to the uranate when they are cooled because of the difficulty of oxygen diffusion and uranate nucleation. Accordingly dissociation temperature. 966 degree C was taken to represent equilibrium and was used to calculate roughly H and S for the dissociation reaction. In presence of Ni O, U 3 O 8 melts partially at 1470 degree C and does not dissociate to the lower oxide. 4 figs

  11. Equilibrium relationships in the system Ni-U-O

    International Nuclear Information System (INIS)

    Mansour, N.A.L.

    1980-01-01

    Phase relationships were established in air and in oxygen. Mixtures of NiO and U 3 O 8 oxidize to NiUO 4 . The results of analysis of NiUO 4 were identical to those previously published for NiU 3 O 10 . The uranate dissociates to NiO and U 3 O 8 at a temperature higher than that of their oxidation back to the uranate on cooling because of the difficulty of oxygen diffusion and uranate nucleation. Accordingly, dissociation temperature was taken to represent equilibrium and was used to calculate roughly ΔH and ΔS for the reaction of dissociation. In presence of NiO, U 3 O 8 melts partially and does not dissociate to the lower oxide. (orig.) [de

  12. Study of the External Neutron Source Effect on TRU Burning in a Sub-critical Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zafar, Zafar Iqbal; Kim, Myung Hyun [Kyung Hee University, Yongin (Korea, Republic of)

    2015-05-15

    One of the drawback points of nuclear power is the production of highly radioactive and long lasting waste isotopes during power production. Therefore, most important design requirement of future nuclear option should have a potential to burn selectively long-lived fission products (LLFP) and long-lived minor actinides (LLMA). However, there is no way to burn them selectively in the reactor core. Practical method of waste transmutation should rely on selective separation of them from spent nuclear fuel of power plants. Under the proliferation concern, direct separation of trans-uranic isotopes (TRU) from pyro-reprocessing plant became a feasible option in our country. Even though social political agreement is not matured as well as technical feasibility, current study is done based on basic assumptions; TRU and LLFP is separated from spent fuel of nuclear power plants. The remaining neutrons (among the external 3%) very few in number (less than 1% in any case) being very energetic (above three MeV or so) do cause much more fissions per neutron than their counterparts but, because of their overall low population they do not have any significant and decisive influence in the overall reactor performance. Currently, entire study is limited to the source neutron energy of 20 MeV only. In future, it is expected to get reasonably plausible fixed source dependent difference in the TRU burning by using tabulated data for the neutrons of higher energy (up to 250 MeV at least). Secondly, a clearer picture is expected if the TRU loading was increased from the current value of 133 kg to few metric tons, as is the case in most of the existing reactors.

  13. Measurement of total dissolved solids using electrical conductivity

    International Nuclear Information System (INIS)

    Ray, Vinod K.; Jat, J.R.; Reddy, G.B.; Balaji Rao, Y.; Phani Babu, C.; Kalyanakrishnan, G.

    2017-01-01

    Total dissolved solids (TDS) is an important parameter for the disposal of effluents generated during processing of different raw materials like Magnesium Di-uranate (MDU), Heat Treated Uranium Peroxide (HTUP), Sodium Di-uranate (SDU) in Uranium Extraction plant and Washed and Dried Frit (WDF) in Zirconium Extraction Plant. The present paper describes the use of electrical conductivity for determination of TDS. As electrical conductivity is matrix dependent property, matrix matched standards were prepared for determination of TDS in ammonium nitrate solution (AN) and mixture of ammonium nitrate and ammonium sulphate (AN/AS) and results were found to be in good agreement when compared with evaporation method. (author)

  14. Occurrence, behavior and distribution of high levels of uranium in shallow groundwater at Datong basin, northern China

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Ya; Wang, Yanxin, E-mail: yx.wang@cug.edu.cn; Xie, Xianjun

    2014-02-01

    Geochemical investigations of uranium (U) occurrence in the environments were conducted at Datong basin of northern China. The results suggest that U contents were generally < 1 mg/kg for the igneous and metamorphic rocks, typically 2–5 mg/kg for the Carboniferous and Permian sedimentary rocks and around 3 mg/kg for sediments and topsoil, respectively. U in the Quaternary aquifer sediments may be primarily associated with carnotite from the Carboniferous and Permian coal-bearing clastic rocks around the basin. Shallow groundwater had U concentrations of < 0.02–288 μg/L (average 24 μg/L), with 24% of the investigated boreholes above the WHO provisional guideline of 30 μg/L for U in drinking water. Average U concentration for surface water was 5.8 μg/L. In oxidizing waters, uranyl (UO{sub 2}{sup 2+}) species is dominant and strongly adsorbed onto iron (hydro)xides, while it would be preferentially complexed with carbonate in the alkaline groundwater, forming highly soluble uranyl-carbonate complexes at Datong. Under reducing conditions, uranous (U(IV)) species is ready to precipitate or bind to organic matter, therefore having a low mobility. At the study area, high U groundwater (> 30 μg/L) occurs at the alluvial plains due to intermediate redox and enhanced alkaline conditions. The abnormally high levels of U in groundwater (> 100 μg/L) are locally found at the west alluvial plains. By contrast, U co-precipitation with secondary carbonate minerals like Ca{sub 2}UO{sub 2}(CO{sub 3}){sub 3} in the dominant Ca–Mg–Na–HCO{sub 3} type groundwater may prevail at the east alluvial plains. Besides, bedrocks such as Carboniferous and Permian sedimentary rocks, especially the coal-bearing strata which have higher U contents at the west mountain areas may also account for the abnormally high levels of U in groundwater. - Highlights: • High U groundwater occurs at the alluvial plains of Datong basin. • Redox state, complexation and adsorption are responsible

  15. Accumulation of transuranic elements in the aquatic biota of the Belarusian sector of contaminated area near the Chernobyl nuclear power plant - Accumulation of transuranic elements in aquatic biota of Belarusian sector of contaminated area of Chernobyl nuclear power plant

    Energy Technology Data Exchange (ETDEWEB)

    Golubev, Alexander; Mironov, Vladislav [International Sakharov Environmental University. Box 220070, 23 Dolgobrodskaya Street, Minsk, 220070 (Belarus)

    2014-07-01

    The evolution of nuclear contamination of Belarus territory after Chernobyl accident includes the four stages: 1. Iodine-neptunium stage, caused mainly by short-lived radionuclides {sup 131}I, {sup 239}Np and others with a half-life period of several weeks; II. Intermediate stage, caused by radionuclides with a half-life period of a year ({sup 144}Ce, {sup 106}Ru, {sup 134}Cs, etc.); III. Strontium-cesium stage, caused by {sup 90}Sr and {sup 137}Cs with a half-life period of about 30 years; IV. Plutonium-americium, caused by long-lived α-emitting radionuclides {sup 241}Am (period of half-life of 432 years) and {sup 239+240}Pu, having high radio and chemo-toxicity. According to forecasts, activity of {sup 241}Am to 2050 year will increase by 2.5 times and it will be the most important dose-related factor for the aquatic biota within the Chernobyl accident zone. In 2002 - 2008 years we have studied the accumulation of trans-uranic elements (TUE, {sup 241}Am, {sup 239+240}Pu) in basic components of water body ecosystems within the Chernobyl zone - non-flowing Perstok Lake, weak-flowing Borschevka flooding and small Braginka River. Among investigated components are water, bottom sediments, submerged macrophytes (Ceratophyllum submersum, Hydrocharis morsus-ranae, Lemna minor, Nuphar lutea, Stratiotes aloides), emergent macrophytes (Typha spp.), shellfish and fish. In the soil cover in the vicinity of the Perstok Lake activity of {sup 241}Am at present is equivalent to 300 - 600 Bq.kg{sup -1}, that is the basic source of its income to the lake. Radionuclides mobility in the water environment is higher than in the soil, that facilitates the rapid incorporation of {sup 241}Am to the trophic nets of water bodies and its removal by near-water animals in the terrestrial biotopes, including outside Chernobyl zone. Thus, the activity of {sup 241}Am in bottom sediments in the Perstok Lake and Borschevka flooding in 2008 year reach respectively 324 and 131 Bq.kg{sup -1}, and the

  16. César Augusto Restrepo Valencia, Consuelo Vélez Álvarez Abstract Objective. To evaluate the effectiveness of calcineurin ciclosporin and tacrolimus inhibitors to induce remission in patients with refractory lupus nephritis. Patients, materials and methods. Patients with lupus nephritis class IV-G who despite receiving therapy with high doses of steroid and with a cytostatic (cyclophosphamide or mycophenolate for 3 months had not been able to induce some kind of remission.The exclusion criteria were creatinine levels greater than 3 mg / dl, pregnancy, previous history of exposure to calcineurin inhibitors, cancer, active infections, uncontrolled hypertension, and negligence with medication intake. The recommended dose of cyclosporine was 3 mg / kg / day and tacrolimus 0.1 mg / kg / day, in joint with prednisone 0.3 mg / kg / day, cyclophosphamide 1 mg / kg / day or mycophenolate mofetil 1 gram every 12 hours. The cyclophosphamide was administered only during 6 months, after which it was changed to azathioprine at doses of 1 mg / kg / day. Still, mycophenolate was continued at the same dose. All patients completed a minimum period of 12 months follow-up, it was considered that patients achieved partial remission when proteinuria decreased by 50% of the baseline value or its value decreased to less than 1 gram in 24 hours, decrease of leukocytes count and red blood cells in urine of 50%, and creatinine values were stable. A complete remission was considered when there was a reduction in proteinuria in a value less than 300 mg per 24 hours, urinary sediment with less than 3 red blood cells, less than 5 leukocyte for each high power microscopic field, and a creatinine value reduction by 50% or reaching a normal value. Results. Twelve patients met the inclusion criteria and initiated the calcineurin inhibitor protocol. Two presented accelerated deterioration in their function and required chronic dialysis therapy. Ten patients with active treatment completed 12 months

    Directory of Open Access Journals (Sweden)

    César Augusto Restrepo Valencia

    2014-10-01

    Full Text Available Objective: To evaluate the effectiveness of calcineurin ciclosporin and tacrolimus inhibitors to induce remission in patients with refractory lupus nephritis. Patients, materials and methods: Patients with lupus nephritis class IV-G who despite receiving the rapy with high doses of steroid and with a cytostatic (cyclophosphamide or mycophenolate for 3 months had not been able to induce some kind of remission.The exclusion criteria were creatinine levels greater than 3 mg / dl, pregnancy, previous history of exposure to calcineurin inhibitors, cancer, active infections, uncontrolled hypertension, and negligence with medication intake. The recommended dose of cyclosporine was 3 mg / kg / day and tacrolimus 0.1 mg / kg / day, in joint with prednisone 0.3 mg / kg / day, cyclophosphamide 1 mg / kg / day or mycophenolate mofetil 1 gram every 12 hours. The cyclophosphamide was administered only during 6 months, after which it was changed to azathioprine at doses of 1 mg / kg / day. Still, mycophenolate was continued at the same dose. All patients completed a minimum period of 12 months follow-up, it was considered that patients achieved partial remission when proteinuria decreased by 50% of the baseline value or its value decreased to less than 1 gram in 24 hours, decrease of leukocytes count and red blood cells in urine of 50%, and creatinine values were stable. A complete remission was considered when there was a reduction in proteinuria in a value less than 300 mg per 24 hours, urinary sediment with less than 3 red blood cells, less than 5 leukocyte for each high power microscopic field, and a creatinine value reduction by 50% or reaching a normal value. Results: Twelve patients met the inclusion criteria and initiated the calcineurin inhibitor protocol. Two presented accelerated deterioration in their function and required chronic dialysis therapy. Ten patients with active treatment completed 12 months of followup, of which 4 (40% had partial

  17. Leong, K.M. (Ed.). The Petroleum Geology and Resources of Malaysia ISBN 983-9738-10-0 . Petronas (Petroliam Nasional Berhad), Kualar Lumpur 2000, A4 size, 665 pages (U.S. $100 + postage (2.5 kg)), hyperlinkhttp://www.petronas.com.my

    Science.gov (United States)

    Murphy, Richard W.; Hutchison, Charles S.

    2001-08-01

    This 27-chapter volume is a comprehensive review of the petroleum geology of a significant Southeast Asian oil-producing country. The authors are predominantly from Petronas (20) with contributions by Shell (2) and the University of Malaya (1). The whole manuscript was reviewed by Dick Selley and coordinated by Leong Khee Meng. Foremost among the authors is Dr Mazlan Hj. Madon, whose byline is found on 14 chapters and whose guiding hand can be recognised throughout the book. In addition to in-house reports, Petronas has drawn on oil company work, resulting both from exploration activities on PSCs and from regional assessments, based on public domain and proprietary data. The companies involved include Esso, Shell, Mobil, Sun, Texaco, Conoco, Oxy, Triton, OPIC, Idemitsu, Nippon Oil, Elf, Hall-Houston and Western Mining. The volume is a remarkable tribute to the progress made by the Malaysian National Oil Company in the 25 years since the granting of its initial charter in 1974.

  18. Gudrun Stenglein, Condición femenina y delincuencia: Estudio comparado hispano-alemán y una propuesta sistémica europea, AV Akademikerverlag GmbH & Co. KG, EAE, Saarbrücken, 2012, 252 págs.

    Directory of Open Access Journals (Sweden)

    Manuel J. Peláez

    2013-03-01

    Full Text Available Wenn über Kriminalität gesprochen wird, scheint es sich um ein reines Männerthema zu handeln. Sind die Frauen wirklich weniger straffällig als die Männer? Die Frau als Straftäterin wird in der Literatur vernachlässigt. In der modernen Kriminologie erscheint die Frau fast nur in der Opferrolle. Die angeführte Studie befaßt sich mit den Fragen, die sich aus dieser Problematik ergeben. Die Straffälligkeit der Frauen wird einer multidisziplinären Analyse unterzogen, traditionelle und moderne Erklärungsansätze werden systematisiert und in Verbindung zueinander gebracht. Anhand von Statistiken werden sowohl die Anzahl der Straftäterinnen als auch die Delikte, die scheinbar frauentypisch sind, untersucht und zwischen den Modellen der mediterranen und nordeuropäischen Länder verglichen. Es überrascht, dass es so gut wie keine internationalen oder nationalen Programme zur Verbrechensvorbeugung bezüglich der Frauenkrimialität gibt. Scheint es doch so, dass der Staat als einzige Antwort auf dieses Phänomen die Strafverfolgung kennt (traditionelles Strafrecht. Untersuchungen in Strafanstalten zeigen aber, dass die Frauen in den meisten Fällen aufgrund ihres sozialen Umfelds und ihrer geringeren Chancen auf Ausbildung und Ausübung eines Berufes zur Straftäterin werden. Eine effiziente Kriminalpolitik müsste mit der Ungleichbehandlung der Frauen aufräumen und eine adäquate Sozialisierung für die Frauen schaffen, die oft auf sich gestellt und mit der Versorgung ihrer Familie überfordert sind. Es stellt sich heraus, dass, wenn über ein vereintes Europa gesprochen wird, die Wirklichkeit einer gemeinsamen europäischen Kriminalpolitik noch weit entfernt ist. Außerdem wird die Ernsthaftigkeit dieses Vorhabens bezweifelt, da zuviele Unterschiede, Differenzen und Vorbehalte unter den europäischen Mitgliedsstaaten bestehen. Es handelt sich eher um ein fadenscheiniges Agieren der Politiker.

  19. Author Details

    African Journals Online (AJOL)

    The Sheppard Oxygen Mask : efficient oxygen enrichment in the PACU : registrar communication. Abstract PDF · Vol 16, No 4 (2010) - Articles Entropy of the electroencephalogram as applied in the M-Entropy S/5TM Module (GE Healthcare) during increases in nitrous oxide and constant sevofl urane concentrations

  20. Southern African Journal of Anaesthesia and Analgesia - Vol 16, No ...

    African Journals Online (AJOL)

    Entropy of the electroencephalogram as applied in the M-Entropy S/5TM Module (GE Healthcare) during increases in nitrous oxide and constant sevofl urane concentrations · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. F.J Smith, S Spijkerman, P.J Becker, ...

  1. Prediction and Analysis of the Nonsteady Transition and Separation Processes on an Oscillating Wind Turbine Airfoil using the \\gamma-Re_\\theta Transition Model.

    Energy Technology Data Exchange (ETDEWEB)

    Nandi, Taraj; Brasseur, James; Vijayakumar, Ganesh

    2016-01-04

    This study is aimed at gaining insight into the nonsteady transitional boundary layer dynamics of wind turbine blades and the predictive capabilities of URANS based transition and turbulence models for similar physics through the analysis of a controlled flow with similar nonsteady parameters.

  2. Determination of carbon in uranium and its compounds

    International Nuclear Information System (INIS)

    Perez-Garcia, M. M.

    1972-01-01

    This paper collects the analytical methods used our laboratories for the determination of carbon in uranium metal, uranate salts and the oxides, fluorides and carbides of uranium. The carbon is usually burned off in a induction or resistance oven under oxygen flow. The CO 2 is collected in barite solution. Where it is backtitrated with potassium biphthalate. (Author)

  3. Chemical treatment proceed of poor uranium content ores; Un procede de traitement chimique des minerais pauvres d'uranium

    Energy Technology Data Exchange (ETDEWEB)

    Mouret, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Pagny, P [Societe Potasse et Engrais Chimiques (France)

    1955-07-01

    The needs in uranium constantly increased inciting to develop new chemical processes for the treatment of uranium ores. we searched processes that permit to get this element from ores poor in uranium, to a reasonable cost price. We used a sulphuric attack and a precipitation of uranium as phosphate uranate or pyrophosphate uranate to separate its from the different impurities. The process permitted to process ores contents of about 0,05% of uranium and to get an end product of sodium carbonate uranate containing 60 to 65% of uranium, with an acceptable cost price and an extraction yield situated between 90 and 95%. (M.B.) [French] Les besoins sans cesse accrus en uranium ont incite de developper de nouveaux procedes chimiques pour le traitement de minerais uranifere. nous avons recherche des procedes qui permettent d'obtenir cet element a partir de minerais pauvres en uranium, a un prix de revient raisonnable. Nous nous sommes orientes vers une attaque sulfurique et une precipitation de l'uranium sous forme de phosphate uraneux ou de pyrophosphate uraneux pour le separer des differentes impuretes. Le procede a permis de descendre a des teneurs en uranium de l'ordre de 0,05 % et d'obtenir un produit final a l'etat d'uranate de soude contenant 60 e 65 % d'uranium, avec un prix de revient acceptable et avec un rendement global d'extraction situe entre 90 et 95 %. (M.B.)

  4. Vibrational spectroscopy of hydrated potassium hexauranate for the phase study of the UO3-KCl-H2O system

    International Nuclear Information System (INIS)

    Dothee, Daniel.

    1980-02-01

    In the study of the UO 3 -KCl-H 2 O system, a phase, called C phase, was isolated; it has a radiocrystallogram very close to the hexauranate K 2 U 6 O 19 ,11H 2 O, but K + and Cl - are found in its composition. Links between these two phases are studied and especially structure relationships. Hydrated potassium hexauranate structure was determined previously with a natural crystal. Position of potassium and uranium atoms only are known. As monocrystal preparation is impossible a direct structural study is impossible too. Vibrational spectroscopic analysis was selected for this study. Hexauranate structure is determined and results are extended for the study of the C phase. The hydrate UO 3 .0.8 H 2 O a stable and well defined compound is chosen for the hydrothermal synthesis of the different phases. Four main phases are evidenced: the chloro-uranate Ksub(x)UO 3 Clsub(x) (already known), a hydrated potassium uranate and two phases (one is the C phase) containing chloride ions are intermediaries between the chloro-uranate and the uranate [fr

  5. The oxidative conversion of toluene to benzene

    NARCIS (Netherlands)

    Jong, de J.G.; Batist, P.A.

    1971-01-01

    An oxidative reaction is described in which toluene is converted into benzene. The reaction is catalyzed by bismuth uranate. Selectivities up to 70% are obtained if toluene vapor reacts with the catalyst without O (g) being present; the catalyst becomes partially reduced, but is easily reoxidized

  6. Determination of U by the Mallinckrodt method

    International Nuclear Information System (INIS)

    Chaussabel, L.

    The Mallinckrodt method enables to determine U concentrations within 0.2% relative accuracy in various products: uranyl nitrates, magnesium uranates, sintered oxides, and uranium concentrates. The method was improved by the automatic spectrophotometric detection of the titration. The device used is a Sarjent apparatus equipped with a 525 nm filter. The method is described in details [fr

  7. Determination of carbon in uranium and its compounds; Determinacion de carbono en uranio metal y sus compuestos

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Garcia, M M

    1972-07-01

    This paper collects the analytical methods used our laboratories for the determination of carbon in uranium metal, uranate salts and the oxides, fluorides and carbides of uranium. The carbon is usually burned off in a induction or resistance oven under oxygen flow. The CO{sub 2} is collected in barite solution. Where it is backtitrated with potassium biphthalate. (Author)

  8. The Shock and Vibration Bulletin. Part 4. Impact, Packaging and Shipping, Blast and Impulsive Loading

    Science.gov (United States)

    1975-06-01

    CONTROL TECHNIQUES FOR DIGITAL CONTROL OF RANDOM VOIRATION TESTS J. D. Tebba and D. 0. Smallwood , Sandia Laboratories, Albuquerque. New Mexico VIBRATION...for dynamic end quasi-static loading conditions. (14] Norman . Jaons, T. 0. Uran and S. A. Tekin. SM1210=1 "The Dynamic riastic Behavior of Fully

  9. A Modified Version of the RNG k–ε Turbulence Model for the Scale-Resolving Simulation of Internal Combustion Engines

    Directory of Open Access Journals (Sweden)

    Vesselin Krassimirov Krastev

    2017-12-01

    Full Text Available The unsteady and random character of turbulent flow motion is a key aspect of the multidimensional modeling of internal combustion engines (ICEs. A typical example can be found in the prediction of the cycle-to-cycle variability (CCV in modern, highly downsized gasoline direct injection (GDI engines, which strongly depends on the accurate simulation of turbulent in-cylinder flow structures. The current standard for turbulence modeling in ICEs is still represented by the unsteady form of Reynold-averaged Navier Stokes equations (URANS, which allows the simulation of full engine cycles at relatively low computational costs. URANS-based methods, however, are only able to return a statistical description of turbulence, as the effects of all scales of motion are entirely modeled. Therefore, during the last decade, scale-resolving methods such as large eddy simulation (LES or hybrid URANS/LES approaches are gaining increasing attention among the engine-modeling community. In the present paper, we propose a scale-resolving capable modification of the popular RNG k– ε URANS model. The modification is based on a detached-eddy simulation (DES framework and allows one to explicitly set the behavior (URANS, DES or LES of the model in different zones of the computational domain. The resulting zonal formulation has been tested on two reference test cases, comparing the numerical predictions with the available experimental data sets and with previous computational studies. Overall, the scale-resolved part of the computed flow has been found to be consistent with the expected flow physics, thus confirming the validity of the proposed simulation methodology.

  10. Uranium recovery from wet process phosphoric acid

    International Nuclear Information System (INIS)

    1980-01-01

    In the field of metallurgy, specifically processes for recovering uranium from wet process phosphoric acid solution derived from the acidulation of uraniferous phosphate ores, problems of imbalance of ion exchange agents, contamination of recycled phosphoric acid with process organics and oxidizing agents, and loss and contamination of uranium product, are solved by removing organics from the raffinate after ion exchange conversion of uranium to uranous form and recovery thereof by ion exchange, and returning organics to the circuit to balance mono and disubstituted ester ion exchange agents; then oxidatively stripping uranium from the agent using hydrogen peroxide; then after ion exchange recovery of uranyl and scrubbing, stripping with sodium carbonate and acidifying the strip solution and using some of it for the scrubbing; regenerating the sodium loaded agent and recycling it to the uranous recovery step. Economic recovery of uranium as a by-product of phosphate fertilizer production is effected. (author)

  11. Uranium dioxide pellets

    International Nuclear Information System (INIS)

    Zawidzki, T.W.

    1982-01-01

    A process for the preparation of a sintered, high density, large crystal grain size uranium dioxide pellet is described which involves: (i) reacting a uranyl nitrate of formula UO 2 (NO 3 ) 2 .6H 2 O with a sulphur source, at a temperature of from about 300 deg. C to provide a sulphur-containing uranium trioxide; (ii) reacting the thus-obtained modified uranium trioxide with ammonium nitrate to form an insoluble sulphur-containing ammonium uranate; (iii) neutralizing the thus-formed slurry with ammonium hydroxide to precipitate out as an insoluble ammonium uranate the remaining dissolved uranium; (iv) recovering the thus-formed precipitates in a dry state; (v) reducing the dry precipitate to UO 2 , and forming it into 'green' pellets; and (vi) sintering the pellets in a hydrogen atmosphere at an elevated temperature

  12. A gravimetric method for the determination of oxygen in uranium oxides and ternary uranium oxides by addition of alkaline earth compounds

    International Nuclear Information System (INIS)

    Fujino, Takeo; Tagawa, Hiroaki; Adachi, Takeo; Hashitani, Hiroshi

    1978-01-01

    A simple gravimetric determination of oxygen in uranium oxides and ternary uranium oxides is described. In alkaline earth uranates which are formed by heating in air at 800-1100 0 C, uranium is in the hexavalent state over certain continuous ranges of alkaline earth-to-uranium ratios. Thus, if an alkaline earth uranate or a compound containing an alkaline earth element, e.g. MgO, is mixed with the oxide sample and heated in air under suitable conditions, oxygen can be determined from the weight change before and after the reaction. The standard deviation of the O:U ratio for a UOsub(2+x) test sample is +-0.0008-0.001, if a correction is applied for atmospheric moisture absorbed during mixing. (Auth.)

  13. Siloxides as supporting ligands in uranium(III)-mediated small-molecule activation

    Energy Technology Data Exchange (ETDEWEB)

    Mougel, Victor; Camp, Clement; Pecaut, Jacques; Mazzanti, Marinella [CEA-Grenoble (France). Lab. de Reconnaissance Ionique et Chimie de Coordination; Coperet, Christophe [ETH Zuerich (Switzerland). Lab. of Inorganic Chemistry; Maron, Laurent; Kefalidis, Christos E. [Toulouse Univ. (France). LPCNO, CNRS et INSA, UPS

    2012-12-03

    Siloxides support the reduction of small molecules with uranium complexes. The treatment of [U{N(SiMe_3)_2}{sub 3}] with HOSi(OtBu){sub 3} (3 equiv.) yielded a novel homoleptic uranium(III) siloxide complex 1, which acted as a two-electron reducing agent toward CS{sub 2} and CO{sub 2}. Uranium(III) siloxide complex 1 also reduced toluene to afford a diuranium inverted-sandwich complex. [German] Siloxide unterstuetzen die Reduktion kleiner Molekuele durch Uran-Komplexe. Die Behandlung von [U{N(SiMe_3)_2}{sub 3}] mit HOSi(OtBu){sub 3} (3 Aequiv.) liefert den neuartigen homoleptischen Uran(III)-Siloxid-Komplex 1, der als Zwei-Elektronen-Reduktionsmittel fuer CS{sub 2} und CO{sub 2} (siehe Schema) wirkt. Komplex 1 reduziert ausserdem Toluol und bildet einen invertierten Diuran-Sandwichkomplex.

  14. Resolving an old environmental burden (landfill site of neutralization sludge Chvatalka)

    International Nuclear Information System (INIS)

    Zahornadska, J.

    2003-01-01

    In this issue the practical procedure of redevelopment works of old ecological load of stockpile of neutralisation sludge Chvatalka in individual phases of redevelopment intervention. It means the preparatory works in the locality of stockpile before initiation of remove, waste mining, manipulation with wastes, separation and transport of wastes to the utilisation to GEAM Dolni Rozinka, o.z., actual transplantation sampling and analytical control of neutralisation sludge and of waste material and of underground water, realisation of compacted cover of originated hole in the ground by inert material and realisation of technical and following biological reclamation of the locality. Redevelopment works were realised by the company Bystricko, a.s. (Bystrice pod Perstejnem). Mined waste were used in uranous technology by GEAM Dolni Rozinka, o.z. Mined contaminated material from contaminated bottom and dams was used in detoxication unit like secondary material in the reclamation process of uranous sludges. (author)

  15. Contribution to the Chemical and Technological Study of Ammonium Diuranate Precipitation

    International Nuclear Information System (INIS)

    Vuillemey, R.

    1962-01-01

    The present work is designed to study the relationship between the conditions for precipitation by ammonia and the properties of ammonium diuranate obtained either from uranyl nitrate solution or from gaseous uranium hexafluoride. In each case the optimum processes are defined leading on the one hand to uranate which can afterwards be treated in a reduction- fluorination oven to give uranium tetrafluoride, and on the other hand to a uranate suitable for the production of a sinterable uranium oxide. In particular it is shown that the treatment of uranyl nitrate solutions by stoichiometric quantities of ammonia leads to the complete precipitation of the uranium leaving less than 1 mg/litre of uranium in the solution, whereas the treatment of uranium hexafluoride necessitates the use of at least 8 times the stoichiometric quantity. (author) [fr

  16. Preparation of the pur uranium-metal

    International Nuclear Information System (INIS)

    Goldschmidt, B.; Vertes, P.

    1955-01-01

    A detailed description of the chemical processes used to prepare in the factory of Bouchet of the CEA (Seine-Et-Oise) pur metal uranium with either relatively rich ores, or extracts coming of physical or chemical treatment of poor ores. The nitric treatment of ores succeeds to the production of uranate of impure sodium carbonate. This last last product is dissolved in nitric acid and the uranyl nitrate is extracted by tributyl-phosphate diluted in an inert solvent. The uranyl nitrate pure is re-extracted and successively transformed in uranium peroxide, in orange oxide then in brown oxide which is transformed in fluoride by the anhydrous hydrofluoric acid. Uranate fluoride is then reduced in metal by the pure calcium with an yield superior to 99%. (authors) [fr

  17. Application of ion exchange to isotope separation. 2. Isotope separation of uranium

    Energy Technology Data Exchange (ETDEWEB)

    Okamoto, Makoto; Fujii, Yasuhiko; Aida, Masao; Nomura, Masao; Aoyama, Taku

    1985-10-01

    Research work on the uranium isotope separation by ion exchange chromatography done by the ahthors was reviewed and summarized in the present paper. Specifically described are the determination of separation coefficients of uranium isotopes in various chemical systems involving uranium ions and complexes. The chemical systems are classifield into three main categories; (1) uranyl, U (VI), complex formation system, (2) uranous, U (IV), complex formation system and (3) U (IV) - U (VI) redox system. The redox system showed the largest separation coefficient of approx. 7 x 10/sup -4/, while the uranyl and uranous complex systems showed the separation coefficients of -- 2 x 10/sup -4/ and approx. 6 x 10/sup -5/, respectively.

  18. Sulphate removal from uraniferous liquors

    International Nuclear Information System (INIS)

    Berger, B.

    1983-01-01

    A process for the recovery of uranium from liquor resulting from the attack of sulphur containing uraniferous ores by an alkaline solution of sodium carbonate and/or sodium bicarbonate is claimed. An ion exchange resin is used to separate the uranium from the solution of sodium carbonate and/or bicarbonate and sodium sulphate. The ion exchange resin is then eluted with a solution of ammonium carbonate and/or bicarbonate to provide an eluate containing ammonium uranyl tricarbonate, ammonium carbonate and/or bicarbonate and ammonium sulphate. The eluate is heated to boiling to convert the ammonium uranyl tricarbonate to ammonium uranate and/or diuranate. Ammonia, carbon dioxide and water vapor are released. The precipitated ammonium uranate and/or diuranate is separated from the remaining liquor and calcined to give uranium trioxide

  19. Nitrous oxide and methane fluxes in south Brazilian gleysol as affected by nitrogen fertilizers Fluxos de óxido nitroso e de metano em gleissolo influenciados pela aplicação de fertilizantes nitrogenados no sul do Brasil

    Directory of Open Access Journals (Sweden)

    Josiléia Acordi Zanatta

    2010-10-01

    Full Text Available Nitrogen fertilizers increase the nitrous oxide (N2O emission and can reduce the methane (CH4 oxidation from agricultural soils. However, the magnitude of this effect is unknown in Southern Brazilian edaphoclimatic conditions, as well as the potential of different sources of mineral N fertilizers in such an effect. The aim of this study was to investigate the effects of different mineral N sources (urea, ammonium sulphate, calcium nitrate, ammonium nitrate, Uran, controlled- release N fertilizer, and urea with urease inhibitor on N2O and CH4 fluxes from Gleysol in the South of Brazil (Porto Alegre, RS, in comparison to a control treatment without a N application. The experiment was arranged in a randomized block with three replications, and the N fertilizer was applied to corn at the V5 growth stage. Air samples were collected from a static chambers for 15 days after the N application and the N2O and CH4 concentration were determined by gas chromatography. The topmost emissions occurred three days after the N fertilizer application and ranged from 187.8 to 8587.4 µg m-2 h-1 N. The greatest emissions were observed for N-nitric based fertilizers, while N sources with a urease inhibitor and controlled release N presented the smallest values and the N-ammonium and amidic were intermediate. This peak of N2O emissions was related to soil NO3--N (R² = 0.56, p Fertilizantes nitrogenados incrementam os fluxos de óxido nitroso (N2O e podem deprimir a oxidação de metano (CH4 em solos agrícolas. Entretanto, não existem resultados da magnitude desses efeitos nas condições edafoclimáticas do Sul do Brasil, tampouco do potencial de algumas fontes de N em mitigar esses efeitos. O presente estudo objetivou avaliar o impacto da aplicação de fertilizantes nitrogenados (ureia, sulfato de amônio, nitrato de cálcio, nitrato de amônio, Uran, N de liberação lenta e ureia com inibidor de urease nos fluxos de N2O e CH4 em um Gleissolo no Sul do Brasil

  20. The discovery of radium 100 years ago and the impact on the early history of nuclear science

    Energy Technology Data Exchange (ETDEWEB)

    Adloff, J.P. [University Louis Pasteur, 63 Rue Saint Urbain 67100 Strasbourg (France)

    1999-09-01

    One hundred years ago, Pierre and Marie Curie reawakened the topic of uranic rays and discovered two radioelements, polonium in July 1898 and radium in December. The circumstances of these events which announced the beginning of radiochemistry are reviewed at the light of the laboratory notebooks and the publications of the authors. The role of radium in the early history of radioactivity and nuclear sciences is emphasized. (author)

  1. The discovery of radium 100 years ago and the impact on the early history of nuclear science

    International Nuclear Information System (INIS)

    Adloff, J.P.

    1999-01-01

    One hundred years ago, Pierre and Marie Curie reawakened the topic of uranic rays and discovered two radioelements, polonium in July 1898 and radium in December. The circumstances of these events which announced the beginning of radiochemistry are reviewed at the light of the laboratory notebooks and the publications of the authors. The role of radium in the early history of radioactivity and nuclear sciences is emphasized. (author)

  2. Solid state speciation of uranium and its local structure in Sr2CeO4 using photoluminescence spectroscopy

    Science.gov (United States)

    Sahu, M.; Gupta, Santosh K.; Jain, D.; Saxena, M. K.; Kadam, R. M.

    2018-04-01

    An effort was taken to carry our speciation study of uranium ion in technologically important cerate host Sr2CeO4 using time resolved photoluminescence spectroscopy. Such studies are not relevant only to nuclear industry but can give rich insight into fundamentals of 5f electron chemistry in solid state systems. In this work both undoped and varied amount of uranium doped Sr2CeO4 compound is synthesized using complex polymerization method and is characterized systematically using X-ray diffraction (XRD), Raman spectroscopy, photoluminescence spectroscopy and scanning electron microscopy (SEM). Both XRD and Raman spectroscopy confirmed the formation of pure Sr2CeO4 which has tendency to decompose peritectically to SrCeO3 and SrO at higher temperature. Uranium doping is confirmed by XRD. Uranium exhibits a rich chemistry owing to its variable oxidation state from +3 to +6. Each of them exhibits distinct luminescence properties either due to f-f transitions or ligand to metal charge transfer (LMCT). We have taken Sr2CeO4 as a model host lattice to understand the photophysical characteristics of uranium ion in it. Emission spectroscopy revealed the stabilization of uranium as U (VI) in the form of UO66- (octahedral uranate) in Sr2CeO4. Emission kinetics study reflects that uranate ions are not homogeneously distributed in Sr2CeO4 and it has two different environments due to its stabilization at both Sr2+ as well as Ce4+ site. The lifetime population analysis interestingly pinpointed that majority of uranate ion resided at Ce4+ site. The critical energy-transfer distance between the uranate ion was determined based on which the concentration quenching mechanism was attributed to electric multipolar interaction. These studies are very important in designing Sr2CeO4 based optoelectronic material as well exploring it for actinides studies.

  3. Wastes from former mining and milling activities in Tajikistan

    International Nuclear Information System (INIS)

    Mirsaidov, U.M.

    2012-01-01

    This article is devoted to wastes from former mining and milling activities in Tajikistan. Currently, the serious radiological and ecological problems in Tajikistan are uranium mining and milling activities consequences overcoming which intensively developed during the soviet period. After the collapse of USSR, the uranic ores extraction in Tajikistan stopped due to deposit's output completion on the territory of the republic. Remediation of mining and milling activities' sites became the most urgent once all mines were closed.

  4. AFRL’s ALREST Physics-Based Combustion Stability Program

    Science.gov (United States)

    2012-11-08

    enduring challenge because of the inherent complexities in the physics of multiphase turbulent flames. The present paper provides the Air Force...Combustor F i d e l i t y URANS LES Steady RANS HLES Current SOA Capability with 2000 cores Capability at Program End in 2015 (2,000 cores+GPUs) Capability...Unlimited ALREST Validation Cases “Final Exam ” Hydrogen Stable Single Element (PSU) Stable Single Element Methane (Singla) Supercritical Non

  5. Investigation of integral normal emmissivity of materials in the high temperature range with the aid of reflection furnace

    International Nuclear Information System (INIS)

    Shpil'rain, Eh.Eh.; Peletskij, V.Eh.; Kostanovskij, A.V.

    1976-01-01

    A special experimental procedure for investigating integral radiation capacity of a wide class of solids with the aid of a reverberatory furnace ''URAN-1'' has been developed. The description of the set-up is presented. For the range of 1300-2100 K, data are provided on the integral normal radiation capacity of niobium. The investigation results are compared with the data published in the literature

  6. Effect of silica fume on reaction products of uranium (VI) with portland cement

    International Nuclear Information System (INIS)

    Tan Hongbin; Shaanxi Univ. of Technology, Hanzhong; Li Yuxiang

    2005-01-01

    Simulation of radioactive waste of U(VI) by uranyl nitrate and the effects of different additive quantities (12%, 20%, 30%, 35%, 40%) of silica fume on the products of U(VI) with Portland cement were studied at a hydrothermal condition of 180 degree C for a duration of one week. The X-ray powder diffraction examination results showed that the calcium uranate would be transformed into uranophane when the cement contained 30% silica fume. (authors)

  7. New aspects of the etiology of lung carcinomas in respect to radon 222

    International Nuclear Information System (INIS)

    Merkel, K.

    1984-01-01

    Radon is the reason for the high cancer risk of uran miners. It also is present in building materials and therefore in the air inside houses. In the last year the radium content in houses increased because of the use of other row materials for building materials and because of a better isolation of the houses. This may increase the risc of lung cancer. (P.W.)

  8. A comparison and assessment of approaches for modelling flow over in-line tube banks

    International Nuclear Information System (INIS)

    Iacovides, Hector; Launder, Brian; West, Alastair

    2014-01-01

    Highlights: • We present wall-resolved LES and URANS simulations of periodic flow in heated in-line tube banks. • Simulations of flow in a confined in-line tube-bank are compared with experimental data. • When pitch-to-diameter (P/D) ratio becomes less than 1.6, the periodic flow becomes skewed. • URANS tested here unable to mimic the periodic flow at P/D = 1.6. • In confined tube banks URANS suggest alternate, in the axial direction, flow deflection. - Abstract: The paper reports experiences from applying alternative strategies for modelling turbulent flow and local heat-transfer coefficients around in-line tube banks. The motivation is the simulation of conditions in the closely packed cross-flow heat exchangers used in advanced gas-cooled nuclear reactors (AGRs). The main objective is the flow simulation in large-scale tube banks with confining walls. The suitability and accuracy of wall-resolved large-eddy simulation (LES) and Unsteady Reynolds-Averaged Navier–Stokes (URANS) approaches are examined for generic, square, in-line tube banks, where experimental data are limited but available. Within the latter approach, both eddy-viscosity and Reynolds-stress-transport models have been tested. The assumption of flow periodicity in all three directions is investigated by varying the domain size. It is found that the path taken by the fluid through the tube-bank configuration differs according to the treatment of turbulence and whether the flow is treated as two- or three-dimensional. Finally, the important effect of confining walls has been examined by making direct comparison with the experiments of the complete test rig of Aiba et al. (1982)

  9. Development and Application of a Method for Toxicological Assessment of Occupational Exposures to Chemicals in Marine Operations. Addendum.

    Science.gov (United States)

    1985-09-01

    Tank Entry 205 Class 1 208 Class II 208 Class III 208 Tier I Evaluations 208 Tier II Evaluations 210 V.3.4 Dermal Exposures 213 Tier I Evaluation 215...reactions or be absorbed through the skin into the body. It is also possible for food or cigarettes to become contaminated from chemicals on the...Compounds of uranium, polonium and radium have carcinogenic activity which is attributed chiefly to their radioactive properties. Uran- ium, radium and radon

  10. Sensitive rapid analysis of iodine-labelled protein mixture on flat substrates with high spatial resolution

    International Nuclear Information System (INIS)

    Zanevskij, Yu.V.; Ivanov, A.B.; Movchan, S.A.; Peshekhonov, V.D.; Chan Dyk Tkhan'; Chernenko, S.P.; Kaminir, L.B.; Krejndlin, Eh.Ya.; Chernyj, A.A.

    1983-01-01

    Usability of rapid analysis by electrophoresis of the admixture of I 125 -labelled proteins on flat samples by means of URAN type installation developed using a multiwire proportional chamber is studied. The sensitivity of the method is better than 200 cpm/cm 2 and the spatial resolution is approximately 1 mm. The procedure of the rapid analysis is no longer than several tens of minutes

  11. Development of Demonstrably Predictive Models for Emissions from Alternative Fuels Based Aircraft Engines

    Science.gov (United States)

    2017-05-01

    Engineering Chemistry Fundamentals, Vol. 5, No. 3, 1966, pp. 356–363. [14] Burns, R. A., Development of scalar and velocity imaging diagnostics...in an Aero- Engine Model Combustor at Elevated Pressure Using URANS and Finite- Rate Chemistry ,” 50th AIAA/ASME/SAE/ASEE Joint Propulsion Conference...FINAL REPORT Development of Demonstrably Predictive Models for Emissions from Alternative Fuels Based Aircraft Engines SERDP Project WP-2151

  12. Studies in solid state ionics

    International Nuclear Information System (INIS)

    Jakes, D.; Rosenkranz, J.

    1987-01-01

    Studies performed over 10 years by the high temperature chemistry group are reviewed. Attention was paid to different aspects of ionic solids from the point of view of practical as well as theoretical needs of nuclear technology. Thus ceramic fuel compound like uranates, urania-thoria system, solid electrolytes based on oxides and ionics transformations were studied under reactor irradiation. (author) 13 figs., 3 tabs., 46 refs

  13. Lacunarity of geophysical well logs in the Cantarell oil field, Gulf of Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Arizabalo, Ruben Dario [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico); Oleschko, Klavdia [Centro de Geociencias, Universidad Nacional Autonoma de Mexico, Juriquilla, Queretaro (Mexico); Korvin, Gabor [King Fahd University, Dhahran (Saudi Arabia); Lozada, Manuel [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico); Castrejon, Ricardo [Facultad de Ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico); Ronquillo, Gerardo [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico)

    2006-04-15

    Lacunarity and fractal variations in geophysical well logs are associated with stratigraphic and petrophysical properties of the naturally fractured Cantarell field in the Gulf of Mexico. Neutron porosity (NPHI), density (RHOB, DRHO, PEF), resistivity (LLD, LLS, MSFL), natural radioactivity (GR, CGR, URAN, POTA, THOR) and caliper (CALI) logs are studied. The resistivity logs yielded remarkably high lacunarity values, especially in the hydrocarbon source- and reservoir rocks. Lacunarity {delta} was found to depend on the resolution and radial depth of penetration of the logging method. It systematically increased in the following order: {delta}(RHOB) < {delta}(CALI) < {delta}(PEF) < {delta}(URAN) < {delta}(GR) < {delta}(NPHI) < {delta}(POTA) < {delta}(CGR) < {delta}(THOR) < {delta}(MSFL) < {delta}(DRHO) < {delta}(LLS) < {delta}(LLD). [Spanish] En este trabajo fueron analizadas las variaciones fractales y de lagunaridad de los registros geofisicos de pozo, con el fin de asociarlos con las propiedades estratigraficas y petrofisicas del yacimiento naturalmente fracturado de Cantarell, en el Golfo de Mexico. Los registros considerados fueron: porosidad neutron (NPHI), densidad (RHOB, DRHO, PEF), resistividad (LLD, LLS, MSFL), radiactividad natural (GR, CGR, URAN, POTA, THOR) y caliper (CALI). Los registros de resistividad produjeron valores de lagunaridad notablemente altos, especialmente en las rocas generadoras y almacenadoras, a diferencia de los demas registros, cuya homogeneidad de traza implico una baja lagunaridad. Los resultados indican que la lagunaridad observada depende de la resolucion y profundidad radial de penetracion del metodo geofisico estudiado y aumenta sistematicamente en el siguiente orden: {delta}(RHOB) < {delta}(CALI) < {delta}(PEF) < {delta}(URAN) < {delta}(GR) < {delta}(NPHI) < {delta}(POTA) < {delta}(CGR) < {delta}(THOR) < {delta}(MSFL) < {delta}(DRHO) < {delta}(LLS) < {delta}(LLD).

  14. Investigation of safety measures to severe accident of Fast Breeder Reactor

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-08-15

    So as to plan the accident management to severe accident of Fast Breeder Reactor (FBR), it is primary important to understand the progression of severe accident (SA) precisely. In this study, it has been aimed to reveal two items that work as keys in the evaluation of SA in sodium cooled FBR. One is the cool-ability of degraded core on the core support plate by sodium natural circulation in the post accident heat removal (PAHR) phase. An obstacle that hinders the smooth heat transfer from fuel debris to coolant is the formation of sodium-uranate by chemical reaction between sodium and fuel. Following the measurement of physical values of sodium-uranate in FY 2011, experiments has been performed to reveal the conditions for sodium-uranate formation on fuel debris in sodium pool simulating the actual situation of the degraded core. The cool-ability of the debris bed was analyzed using the Lipinski 1-D model. Another research performed in this study is the measurement of fission product (cesium and antimony) evaporation rates from FBR fuel as a function of temperature, because presently the fission product evaporation rates data for LWR is also temporarily used for FBR SA analysis. The measurement was performed using the irradiated fuels in the Test Reactor JOYO. (author)

  15. A case study of energy transfer mechanism from uranium to europium in ZnAl2O4 spinel host by photoluminescence spectroscopy

    Science.gov (United States)

    Kumar, Mithlesh; Mohapatra, M.

    2016-04-01

    Zinc aluminate (ZAO), a member of spinel class of inorganic compounds has been of much interest of late due to its wide range of use in catalysis, optical, electronic and ceramic industries. When doped with several lanthanides, this material has proved to be a potential host matrix for phosphors. As lanthanides suffer from poor (direct) excitation and emission cross sections, the use of a co-dopant ion can help to circumvent this and extract better emission from a lanthanide doped ZAO system. In this connection, energy transfer mechanism from uranium to europium in the ZAO host was investigated by photoluminescence spectroscopic technique. It was seen that uranium gets stabilized in the hexavalent state as UO66 - (octahedral uranate) where as the lanthanide ion, Eu is stabilized in its trivalent state in the ZAO host. In the co-doped system, an efficient energy transfer pathway from the uranate to europium ion was observed. Based upon emission and life time data a suitable mechanism was proposed for the energy transfer (quenching) process. It was proposed that after excitation by photons, the uranate ions transfer their energy to nearby 5D1 level of Eu3 + ions which non-radiatively de-excites to the corresponding lower levels of 5D0. Further this 5D0 level decays in a radiative mode to the 7F manifold giving the characteristic emission profile of trivalent Eu. It was proposed that both static and dynamic types of energy transfer mechanism were responsible for this process.

  16. Some characterisation profiles of uranium oxides pertaining to-ceramic fuel preparation

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Bishay, A.F.; Farah, M.Y.; Hammad, F.H.

    1978-01-01

    The effect of several variables during various stages of preparation of UO 2 powder such as precipitation, calcination and reduction on some physico-chemical properties of intermediate oxides and UO 2 powders were investigated. The methods used for characterisation were powder density, specific surface area by permeability, X-ray analysis and O/U ratio by T.G.A. The powder density of uranates was found to increase with the decrease of uranium content in uranyl nitrate solution, the increase of pH and duration of precipitation. The surface area of uranates was found to increase with the increase of pH, temperature of precipitation and the decrease of duration of precipitation. The effect of calcination for 18 hours showed that as the calcination temperature was increased for 100-800 0 C, the powder density increses and the surface area decreases. The variaton in powder density of uranates were eliminated when calcination was carried out at 700 0 C for 18 hours. The progress of the formation of intermediate oxide was followed by X-rays analysis. Two steps reduction methods, two hours at 400 0 C followed by two hours at 700 0 C, eliminated the effect of preparatory history on the 0/U ratio and produced powders having more or less the same 0/U ratio

  17. Unsteady Reynolds averaged Navier-Stokes: toward accurate predictions in fuel-bundles and T-junctions

    International Nuclear Information System (INIS)

    Merzari, E.; Ninokata, H.; Baglietto, E.

    2008-01-01

    Traditional steady-state simulation and turbulence modelling are not always reliable. Even in simple flows, the results can be not accurate when particular conditions occur. Examples are buoyancy, flow oscillations, and turbulent mixing. Often, unsteady simulations are necessary, but they tend to be computationally not affordable. The Unsteady Reynolds Averaged Navier-Stokes (URANS) approach holds promise to be less computational expensive than Large Eddy Simulation (LES) or Direct Numerical Simulation (DNS), reaching a considerable degree of accuracy. Moreover, URANS methodologies do not need complex boundary formulations for the inlet and the outlet like LES or DNS. The Test cases for this methodology will be Fuel Bundles and T-junctions. Tight-Fuel Rod-Bundles present large scale coherent structures than cannot be taken into account by a simple steady-state simulation. T-junctions where a hot fluid and a cold fluid mix present temperature fluctuations and therefore thermal fatigue. For both cases the capacity of the methodology to reproduce the flow field are assessed and it is evaluated that URANS holds promise to be the industrial standard in nuclear engineering applications that do not involve buoyancy. The codes employed are STAR-CD 3.26 and 4.06. (author)

  18. Numerical simulation of swirling flow in complex hydroturbine draft tube using unsteady statistical turbulence models

    Energy Technology Data Exchange (ETDEWEB)

    Paik, Joongcheol [University of Minnesota; Sotiropoulos, Fotis [University of Minnesota; Sale, Michael J [ORNL

    2005-06-01

    A numerical method is developed for carrying out unsteady Reynolds-averaged Navier-Stokes (URANS) simulations and detached-eddy simulations (DESs) in complex 3D geometries. The method is applied to simulate incompressible swirling flow in a typical hydroturbine draft tube, which consists of a strongly curved 90 degree elbow and two piers. The governing equations are solved with a second-order-accurate, finite-volume, dual-time-stepping artificial compressibility approach for a Reynolds number of 1.1 million on a mesh with 1.8 million nodes. The geometrical complexities of the draft tube are handled using domain decomposition with overset (chimera) grids. Numerical simulations show that unsteady statistical turbulence models can capture very complex 3D flow phenomena dominated by geometry-induced, large-scale instabilities and unsteady coherent structures such as the onset of vortex breakdown and the formation of the unsteady rope vortex downstream of the turbine runner. Both URANS and DES appear to yield the general shape and magnitude of mean velocity profiles in reasonable agreement with measurements. Significant discrepancies among the DES and URANS predictions of the turbulence statistics are also observed in the straight downstream diffuser.

  19. Numerical prediction of shock induced oscillations over a 2D airfoil: Influence of turbulence modelling and test section walls

    Energy Technology Data Exchange (ETDEWEB)

    Thiery, Mylene [Aerodynamics and Energetics Modelling Department, Turbulence Modelling and Prediction Unit, ONERA Toulouse, 2 avenue Edouard Belin, 31055 Toulouse Cedex 4 (France); Coustols, Eric [Aerodynamics and Energetics Modelling Department, Turbulence Modelling and Prediction Unit, ONERA Toulouse, 2 avenue Edouard Belin, 31055 Toulouse Cedex 4 (France)]. E-mail: Eric.Coustols@onera.fr

    2006-08-15

    The present study deals with recent numerical results from on-going research conducted at ONERA/DMAE regarding the prediction of transonic flows, for which shock wave/boundary layer interaction is important. When this interaction is strong enough (M {>=} 1.3), shock induced oscillations (SIO) appear at the suction side of the airfoil and lead to the formation of unsteady separated areas. The main issue is then to perform unsteady computations applying appropriate turbulence modelling and relevant boundary conditions with respect to the test case. Computations were performed with the ONERA elsA software and the URANS-type approach, closure relationships being achieved from transport-equation models. Applications are provided for the OAT15A airfoil data base, well documented for unsteady CFD validation (mean and r.m.s. pressure, phase-averaged LDA data, ...). In this paper, the capabilities of turbulence models are evaluated with two 2D URANS strategies, under free-stream or confined conditions. The latter takes into account the adaptive upper and lower wind-tunnel walls. A complete 3D URANS simulation was then performed to demonstrate the real impact of all lateral wind-tunnel walls on such a flow.

  20. Numerical prediction of shock induced oscillations over a 2D airfoil: Influence of turbulence modelling and test section walls

    International Nuclear Information System (INIS)

    Thiery, Mylene; Coustols, Eric

    2006-01-01

    The present study deals with recent numerical results from on-going research conducted at ONERA/DMAE regarding the prediction of transonic flows, for which shock wave/boundary layer interaction is important. When this interaction is strong enough (M ≥ 1.3), shock induced oscillations (SIO) appear at the suction side of the airfoil and lead to the formation of unsteady separated areas. The main issue is then to perform unsteady computations applying appropriate turbulence modelling and relevant boundary conditions with respect to the test case. Computations were performed with the ONERA elsA software and the URANS-type approach, closure relationships being achieved from transport-equation models. Applications are provided for the OAT15A airfoil data base, well documented for unsteady CFD validation (mean and r.m.s. pressure, phase-averaged LDA data, ...). In this paper, the capabilities of turbulence models are evaluated with two 2D URANS strategies, under free-stream or confined conditions. The latter takes into account the adaptive upper and lower wind-tunnel walls. A complete 3D URANS simulation was then performed to demonstrate the real impact of all lateral wind-tunnel walls on such a flow