Action of the city of Schweinfurt against Kernkraftwerk Grafenrheinfeld recognized

International Nuclear Information System (INIS)

Anon.

1979-01-01

In the appeal proceedings, the Bavarian Administrative Court with its interim decision of April 9, 1979 - No. 167 VI 74 - has recognized the action of the city of Schweinfurt against the state of Bavaria to set aside the 1st part license for the construction of Kernkraftwerk Grafenrheinfeld, although the right for action was limited to the city's legal position concerning planning authority, drinking water supply, and a city-owned lake used for swimming. Appeal was allowed. The city has lodged an appeal. The decision of the Administrative Court of Wuerzburg of March 25, 1977, which was contested by the appeal, had also recognized the city's rights but dismissed the action as being unfounded. Guidelines and reasons for the decision of the Bavarian Administrative Court are given in full wording. (orig./HP) 891 HP/orig.- 892 HIS [de

Exchange of pressurizer safeguarding system at Biblis nuclear power station

International Nuclear Information System (INIS)

Weber, D.; Hofbeck, W.

1991-01-01

Valves and piping of the pressurizer safeguarding system are exchanged and reset in such a way that they are suitable not only for discharging steam, but also for discharging a water-steam mixture and hot pressurized water; for the emergency measure of primary depressurization by hand (bleed) in the event of failure of the entire feedwater supply and station black-out, and in the event of operational transients with supposed failure of the reactor scram (ATWS). To achieve this, in addition to the requirements of the pressurizer discharging station, changes have to be made to the valve drive to dominate the water loads. During the 1990 inspection this exchange of the pressurizer discharging station was performed at the Biblis A unit as the first German plant. (orig.) [de

Application of metaheuristics to Loading Pattern Optimization problems based on the IAEA-3D and BIBLIS-2D data

International Nuclear Information System (INIS)

Meneses, Anderson Alvarenga de Moura; Araujo, Lenilson Moreira; Nast, Fernando Nogueira; Da Silva, Patrick Vasconcelos; Schirru, Roberto

2018-01-01

Highlights: •Metaheuristics were applied to Loading Pattern Optimization problems and compared. •The problems are based on data of the benchmarks IAEA and BIBLIS. •The metaheuristics compared were PSO, Cross-Entropy, PBIL and Artificial Bee Colony. •Angra 1 NPP data were also used for further comparison of the algorithms. -- Abstract: The Loading Pattern Optimization (LPO) of a Nuclear Power Plant (NPP), or in-core fuel management optimization, is a real-world and prominent problem in Nuclear Engineering with the goal of finding an optimal (or near-optimal) Loading Pattern (LP), in terms of energy production, within adequate safety margins. Most of the reactor models used in the LPO problem are particular cases, such as research or power reactors with technical data that cannot be made available for several reasons, which makes the reproducibility of tests unattainable. In the present article we report the results of LPO of problems based upon reactor physics benchmarks. Since such data are well-known and widely available in the literature, it is possible to reproduce tests for comparison of techniques. We performed the LPO with the data of the benchmarks IAEA-3D and BIBLIS-2D. The Reactor Physics code RECNOD, which was used in previous works for the optimization of Angra 1 NPP in Brazil, was also used for further comparison. Four Optimization Metaheuristics (OMHs) were applied to those problems: Particle Swarm Optimization (PSO), Cross-Entropy algorithm (CE), Artificial Bee Colony (ABC) and Population-Based Incremental Learning (PBIL). For IAEA-3D, the best algorithm was the ABC. For BIBLIS-2D, PBIL was the best OMH. For Angra 1 / RECNOD optimization problem, PBIL, ABC and CE were the best OMHs.

The mitochondrial genome of Cethosia biblis (Drury) (Lepidoptera: Nymphalidae).

Science.gov (United States)

Xin, Tianrong; Li, Lei; Yao, Chengyi; Wang, Yayu; Zou, Zhiwen; Wang, Jing; Xia, Bin

2016-07-01

We present the complete mitogenome of Cethosia biblis (Drury) (Lepidoptera: Nymphalidae) in this article. The mitogenome was a circle molecular consisting of 15,286 nucleotides, 37 genes, and an A + T-rich region. The order of 37 genes was typical of insect mitochondrial DNA sequences described to date. The overall base composition of the genome is A (37.41%), T (42.80%), C (11.87%), and G (7.91%) with an A + T-rich hallmark as that of other invertebrate mitochondrial genomes. The start codon was mainly ATA in most of the mitochondrial protein-coding genes such as ND2, COI, ATP8, ND3, ND5, ND4, ND6, and ND1, but COII, ATP6, COIII, ND4L, and Cob genes employing ATG. The stop codon was TAA in all the protein-coding genes. The A + T region is located between 12S rRNA and tRNA(M)(et). The phylogenetic relationships of Lepidoptera species were constructed based on the nucleotides sequences of 13 PCGs of mitogenomes using the neighbor-joining method. The molecular-based phylogeny supported the traditional morphological classification on relationships within Lepidoptera species.

Investigation of sensors and instrument components in boiling water reactors. Results from Oskarshamn 2, Barsebaeck 2 in Sweden and Kernkraftwerk Muehleberg in Switzerland

International Nuclear Information System (INIS)

Bergdahl, B.G.

1998-05-01

The reactor monitoring instruments are important for the operation and safety of the plants. Static properties of the instruments are controlled annually, but the dynamic properties are rarely, if ever, examined. This study is the result of a project initiated by the Swedish Nuclear Power Inspectorate. The examinations are based on signal analysis and simultaneous measurement of multiple signals. Results from Oskarshamn 2 (O2), Barsebaeck 2 (B2) and Kernkraftwerk Muehleberg (KKM) are discussed in this report. The presentation is focused on reactor pressure and reactor level signals. the analysis of O2 revealed that the dynamics for 3 out of 14 sensors was 'filtered', meaning that a rapid level displacement is registered with delay. Inspection showed that a 1 sec filter was installed instead of 1.2 sec. The study also showed that old pressure-sensors in use both at O2 and B2 could not cope with high frequencies, and that some level-sensors were disturbed by mechanical oscillations at Bw. At KKM, a 2 Hz resonance was observed with 12 pressure and level sensors. The oscillation was created by an old pressure sensor and influenced the other sensors through the common impulse network

Influence on components of EU directives; Einfluss von EG-Richtlinien auf Komponenten. Einfluss der EG-Druckgeraeterichtlinie (97/23/EG) auf die Komponenten eines Kernkraftwerks vom Typ Konvoi

Energy Technology Data Exchange (ETDEWEB)

Kreckel, D. [Siemens AG, Bereich Energieerzeugung (KWU), Offenbach (Germany)

1998-11-01

Convoy-type nuclear power plant maintenance is subject to the specifications contained in the Technical Rules, as dated in the Annex, on the basis of the operating permits issued under Sec. 7 of the German Atomic Energy Act. The introduction of the Single European Market and the adoption of European directives in the field of equipment safety have influenced, and will continue to influence, the national legislative structure. Changes affecting convoy-type nuclear power plants can be found in the applicable laws and directives, such as the Atomic Energy Act, the Industrial Code, and in new regulations, such as the Equipment Safety Act with its associated ordinances, and the applicable engineered safeguards rules, such as KTA, AD, VdTUeV, VDI. Moreover, the generally recognized state of the art as laid down in DIN, SEL, SEW publications is subject to permanent European harmonization and, consequently, comprehensive national reorganization. These boundary conditions can be upheld only if the specifications about the advancing state of the art specified in the operating permits are put into effect painstakingly. The profile of requirements contained in these specifications must be aligned to the new situation in Germany (dominated by Europe) with the licensing authority and the competent expert consultant within the supervisory procedure for operation under the Atomic Energy Act. The situation described here for the modern convoy-type nuclear power plants must be extrapolated also to older nuclear power plants, albeit subject to a supplementary adaptation to the respective licensing situation. (orig.) [Deutsch] Fuer die Instanhaltung der Konvoi-Kernkraftwerke gelten die Spezifikationen mit dem in den Anhaengen datierten Stand der Technischen Regeln gemaess der auf Basis des AtG Paragraph 7 erteilten Betriebsgenehmigungen. Mit der Einfuehrung des Europaeischen Binnenmarktes und Verabschiedung Europaeischer Richtlinien auf dem Sektor der Geraetesicherheit wurde und wird

D1+ Simulator: A cost and risk optimized approach to nuclear power plant simulator modernization

International Nuclear Information System (INIS)

Wischert, W.

2006-01-01

D1-Simulator is operated by Kraftwerks-Simulator-Gesellschaft (KSG) and Gesellschaft f?r Simulatorschulung (GfS) at the Simulator Centre in Essen since 1977. The full-scope control room training simulator, used for Kernkraftwerk Biblis (KWB) is based on a PDP-11 hardware platform and is mainly programmed in ASSEMBLER language. The Simulator has reached a continuous high availability of operation throughout the years due to specialized hardware and software support from KSG maintenance team. Nevertheless, D1-Simulator largely reveals limitations with respect to computer capacity and spares and suffers progressively from the non-availability of hardware replacement materials. In order to ensure long term maintainability within the framework of the consensus on nuclear energy, a 2-years refurbishing program has been launched by KWB focusing on quality and budgetary aspects. The so-called D1+ Simulator project is based on the re-use of validated data from existing simulators. Allowing for flexible project management methods, the project outlines a cost and risk optimized approach to Nuclear Power Plant (NPP) Simulator modernization. D1+ Simulator is being built by KSG/GfS in close collaboration with KWB and the simulator vendor THALES by re-using a modern hardware and software development environment from D56-Simulator, used by Kernkraftwerk Obrigheim (KWO) before its decommissioning in 2005. The Simulator project, launched in 2004, is expected to be completed by end of 2006. (author)

Leituras e ações na Encontros Bibli

Directory of Open Access Journals (Sweden)

Ursula Blattmann

2010-05-01

Full Text Available Em cada edição publicada merece o destaque a participação de autores, avaliadores e demais colegas. É um momento que deve ser festejado, pois são etapas nas quais a perseverança, a vontade de fazer e a pontualidade estão presentes.Das leituras dos originais à tomada de decisão pelo aceite ou não, se efetua por tantas mãos e se torna uma rotina, por vezes grata, outras, ingrata. Os afazeres e ações na nossa rotina interna da Encontros Bibli provém desta força maior que nos anima a cada edição publicada. E compartilhamos a todos os leitores a satisfação de apresentar a edição do volume 15, número 29 com 10 (dez artigos e um dossiê referente ao Encontro sobre Repositórios de Objetos Virtuais, realizado em novembro de 2009 em Florianópolis.Os artigos são de 17 colegas que atuam em sete universidades, sendo cinco brasileiras; uma argentina; uma espanhola; do Instituto Federal de Educação, Ciência e Tecnologia de Paraíba e do Instituto Brasileiro de Informação, Ciência e Tecnologia. Expressamos nossa admiração aos pesquisadores que se dedicam ao ensino e a pesquisa de nossa área do conhecimento e conseguem criar espaços para escrever e publicar, contribuindo com suas reflexões e análises para o crescimento da Ciência da Informação.Os textos tramitaram nos fluxos do processo editorial desde o início de 2009 e agora tornam-se disponíveis aos leitores: O campo da ciência da informação e o patrimônio cultural: reflexões iniciais para novas discussões sobre os limites da área, de Willian Eduardo Righini de Souza e Giulia Crippa.A infra-estrutura em informação científica e em Ciência da Informação na antiga União Soviética (1917-1991, escrita por Roberto Lopes dos Santos Júnior e Lena Vânia Ribeiro Pinheiro.O profissional bibliotecário como gestor de pessoas, na visão de Adilson Luiz Pinto e de José Antonio Moreiro González.Fluxos informacionais para o monitoramento da Convenção dos

Kernkraftwerk Sued - the Wyhl decision of March 30, 1982/July 6, 1982

International Nuclear Information System (INIS)

1982-01-01

This volume contains the complete Wyhl decision of the Higher Administrative Court of Baden-Wuerttemberg of March 30, 1982-X575/77, X578/77, X583/77 which cores 548 pages. According to the press release the complete decision has been delivered to the counsels of the parties to the lawsuit on July 7, 1983; on the appeal of the defendant Land and the attending Kernkraftwerk Sued GmbH the Higher Administrative Court has amended the decisions of the Administrative Court of Freiburg of March 14, 1977 and has rejected the actions of nine citizens against the first part construction permit. Moreover, the senate has sent to the parties to the lawsuit the decision of March 30, 1982, by which the value in dispute for these proceedings on appeal is fixed to DM 180,000. The time for the lodging of an appeal, which has been admitted by the senate in this process, begins with the delivery of the completely well-founded decision. Moreover, the volume contains a 10 pages summary of contents of the decision and a table of contents of the reasons for the decision. (orig./HSCH) [de

Chemical aspects of the treatment of radioactive concentrates at the nps Biblis

International Nuclear Information System (INIS)

Paffrath, G.; Schroeder, H.J.

1983-01-01

The methods of waste treatment in the Federal Republic of Germany can be separated in two periods and pathways. (1) Treatment of liquid waste by cementation and packing due to the doserate on the surface in drums of 400 litres, in drums of 200 litres put in drums of 400 litres and grout the space between the drums with cement. For higher doserates on the surface 200 litre drums could also be shielded by additional concrete shieldings. The limiting factors for this method of waste treatment were defined in the ASSE regulations. The treatment took place in transportable units at the reactor site. (2) Drying the concentrate and packing the product in thick-walled drums of cast-iron. This treatment, known as 'volume reducing' methods, was first practised in 1981 at the nps Biblis and took into account that: (1) at the reactor site exists only a storage capacity for liquid concentrates for one year and (2) after the closing of the experimental storage ASSE there was no prospect of an early final storage assembly in Germany. The methods are discussed. (author)

Determination of sodium and organic substances for quality control in the full-desalination plant of the Biblis nuclear power plant

International Nuclear Information System (INIS)

Brunner, R.E.; Doerr, A.

1977-01-01

After four years of operation of the make up water treatment plant of nuclear POWER STATION BIBLIS an examination was made concerning the total through put, the eluation of ions and organic matters, and further concerning the efficiency of a special regeneration technique for the counter current regenerated ion exchange beds. In order to determine the efficiency of the applied regeneration methods analisis were carried out on a great number of water samples for sodium, chloride, COD and humic acids as well. A comparison was made between the anialytical determination of Sodium with an automatic analyser and the method used in the laboratory by means of flame photometry respectively ion potential measurement. (orig.) [de

Recursos tecnológicos e informacionais ativos na Encontros Bibli

Directory of Open Access Journals (Sweden)

Araci Isaltina de Andrade Hillesheim

2010-10-01

Full Text Available As tecnologias da informação e comunicação permeiam o nosso processo de editoração científica. Entre os dias 14 e 16 de julho de 2010, realizou-se, em Florianópolis, no Auditório da Reitoria da Universidade Federal de Santa Catarina, o I Encontro Nacional de Usuários do SEER (a programação, vídeos e relatos estão disponíveis no site http://euseer.ibict.br/index.php/euseer1/euseer1. Foi uma satisfação receber e encontrar colegas editores, avaliadores, autores, bolsistas, leitores e principalmente nossos mestres no uso da Plataforma Open Journal Systems (http://pkp.sfu.ca/?q=ojs – ou melhor, toda a equipe do IBICT responsável pelos estudos, customização, desenvolvimento e disseminação da edição em português, resultando na adoção desse Sistema Eletrônico de Editoração de Revistas – SEER, utilizado por mais de 800 revistas científicas somente no Brasil (conforme registrado no Portal SEER - http://seer.ibict.br/.Acompanhar a evolução das ferramentas tecnológicas, aplicar os recursos de novas versões e a troca de conhecimentos tornam-se uma experiência enriquecedora nos processos de aprender-saber-fazer. Em julho desse ano, a administração do Portal Periódicos UFSC (http://www.periodicos.ufsc.br/ migrou a plataforma para a nova versão e novas funcionalidades foram ativadas pelos editores gerentes das revistas.A Encontros Bibli ativou algumas ferramentas, entre as quais, disponibilizar os acessos estatísticos dos arquivos publicados dos autores. Isto é, o autor que tem um artigo publicado em nossa revista poderá consultar, no seu perfil, os dados referentes aos respectivos acessos de cada artigo. Paralelamente, com a nova versão, houve mudanças no autoarquivamento, isto é, quando o autor submete um arquivo na plataforma, pode preencher os metadados com maior facilidade, pois estão disponibilizadas as abas nos idiomas português e inglês. Gradativamente, os metadados ganham maior destaque no tratamento

Carta do Editor de Encontros Bibli 10.5007/1518-2924.2008v13nesp1pi

Directory of Open Access Journals (Sweden)

Francisco das Chagas de Souza

2008-01-01

sociedade. Pode-se medir autoria, suporte, atualidade, circulação, uso, aplicação, custo de produção e vários outros fatores. Cada um desses fatores, ou melhor, cada uma dessas medidas trata de uma particularização em um amplo universo do conhecimento que lhe dá origem. Por isso mesmo, cada uma dessas medições implica em uma especial qualidade, o que as transforma em objeto sobre o qual se pode também estudar sob a perspectiva das qualidades que as constituem. Essa observação se constitui por causa da construção nos últimos quarenta anos de uma prática a cada dia mais forte de quantificação dos conteúdos e meios de circulação do conhecimento. Tal prática está associada à produção em número crescente de bases de dados ou de outros instrumentos similares a elas. Esse conjunto de recursos, além de servirem de instrumentos de registro e descrição dos documentos se transformam em mapas que propiciam fonte básica para a análise de produção, circulação e uso da ciência publicada ou da tecnologia desenvolvida, seu valor financeiro, sua origem, o contingente de especialistas envolvidos ou populações beneficiadas, o custo per capita de sua produção, etc. Examinada mais de perto, essa quantificação e sua instrumentalidade exercem um papel significativo de “arma” política e econômica, sujeita à manipulação e também como força para manipular populações inteiras. Pode, por isso, ser vista não como um singular recurso de medição da qualidade da informação, mas como um conjunto de medições às quais são atribuídas conotações de uma autoridade com posição neutra para verificar gastos e investimentos, por exemplo. Talvez, aí nesse ponto, é que se possa fazer o significativo questionamento sobre as qualidades que essas medições têm para assegurar a um único lado, o das forças econômicas, o seu poder de decidir em que investir, onde investir e por quanto tempo investir os seus capitais financeiros. As qualidades

German risk study nuclear power plants, phase B

International Nuclear Information System (INIS)

1990-01-01

The book documents the results of the probabilistic safety analysis performed at the Biblis-B reference plant. It covers 1) result course analyses and reliability analyses of loss of coolant accidents and transients without and with regard to on-site emergency measures; 2) event tree analyses of on-site and off-site events; 3) analyses of the function of the safety tank in the case of core meltdown accidents, and of the release of fission products into the environment in such case. The probability of a core meltdown is about 3-4 to 100,000 per year and plant. (HP) [de

El presupuesto del municipio del cantón Biblián. Diseño de un sistema para la formulación, ejecución, control y evaluación de presupuestos participativos.

OpenAIRE

Rojas Idrovo, Gladys Eulalia

2011-01-01

Diagnosticar los aspectos administrativos que provocan inconvenientes en la formulación, ejecución, control y evaluación del presupuesto. Este trabajo de investigación tuvo como informantes a autoridades, funcionarios, empleados y trabajadores de la Municipalidad de Biblián y a los Presidentes de las Juntas Parroquiales, y se realizó debido a la necesidad de promover prácticas de participación ciudadana a nivel local que contribuyan a mejorar la calidad de la inversión pública y fortalezca...

Poolside fuel assembly inspection campaigns performed at Kernkraftwerk Leibstadt during summer 1997

International Nuclear Information System (INIS)

Zwicky, H.U.; Wiktor, C.G.; Schrire, D.

1998-01-01

In order to minimise fuel cycle costs, fuel assembly discharge burnup and average U-235 enrichment were increasing over past years in the Kernkraftwerk Leibstadt (KKL) plant. In parallel, high burnup verification programs were defined in collaboration with fuel suppliers. The aim of these programs is to demonstrate safe and reliable fuel performance up to the designed burnup limit and to identify any problems in due time. This is not only achieved by detailed poolside inspections of lead test assemblies, but also by hot cell post-irradiation examination of selected rods. In the frame of a hot cell examination campaign, enhanced localised corrosion in the vicinity of spacers on SVEA-96 fuel rods was identified in May 1997 as a potential problem. The average rod burnup of the investigated rods was around 50 MWd/kgU after 5 one year cycles of operation. As fuel operation up to six cycles is foreseen in KKLs fuel management plants, the risk of fuel failures caused by enhanced localised corrosion could not be excluded. An action plan was therefore developed in order to identify the root cause. Part of the action plan were two poolside inspection campaigns: 1. Visual inspection of 38 assemblies unloaded during refuelling outage 1996 after 5 cycles in operation. This campaign was performed in June 1997. It gave a broader data base to develop a concept for fuel management for the upcoming refuelling outage scheduled in August 1997. 2. Visual inspection, oxide layer thickness measurements, crud sampling and rod diameter measurements on 29 assemblies with different operation histories. This campaign was performed during the outage. A large portion of the inspected bundles was re-inserted for continued operation. The collected data confirmed that assumptions made for reload licensing and safety analyses were conservative. The inspection campaigns performed at KKL during summer 1997 by ABB Atom demonstrated that it is possible to address unexpected problems in a short time

Main results of the german risk study, phase B

International Nuclear Information System (INIS)

Heuser, F.W.

1988-01-01

Work on the German Risk Study is under contract of the Federal Ministry of Research and Technology. The reference plant for the analysis is the Biblis nuclear power plant, Unit B, a KWU pressurized water reactor of the 1300 MWel class. The plant is in operation since 1976. First results on Phase A of the study have been published in 1979. Investigations on Phase B have been foreseen to endeepen the analysis. The principal purpose of these investigations is to improve and to optimize the plant's safety features on a more realistic basis. Main objectives of Phase B are: - Completeness of accident event tree analysis taking into account further accident initiating events. - Identification and analyses of accident management measures which are adequate to minimize accidental risk. - improvement of the analysis on an as far as possible realistic basis, thereby taking into account recent results of safety research. The paper deals with the most important results of the plant analyses (level 1 and level 2) which have been performed within the scope of Phases B of the study

STRATEG - an incident training system for thermohydraulic effects and principles

International Nuclear Information System (INIS)

Rehn, H.; Majohr, N.

1993-01-01

STRATEG is a 1:10 scale glass model of a PWR (Biblis B reactor coolant circuit) built by RWE in 1986 on the site of the Biblis plant as a training model. The model can be used for training of normal operation and incident situations since all important operating and incident sequences of a PWR can be simulated. Thermodynamic phenomena can also be demonstrated occurring under various operating situations and in particular associated with malfunctions. (Z.S.) 1 tab., 3 figs., 1 ref

Carta do editor de edições especiais da Encontros Bibli 10.5007/1518-2924.2011v16nesp1piv

Directory of Open Access Journals (Sweden)

Francisco das Chagas de Souza

2011-06-01

Full Text Available Dos horizontes arquivísticos e de seu sentido É significativo observar que a discussão sobre Arquivologia e sobre as práticas profissionais arquivisticas tem avançado muito nos últimos anos no Brasil, e as razões são claramente apontadas pelos organizadores desta edição especial de Encontros Bibli em seu texto editorial. Contendo sete artigos, esta edição temática traz o título Horizontes Arquivísticos.Para dar vida a este número, foi desenvolvido um trabalho de quase dois anos, liderado pelo pesquisador José Maria Jardim e colaboração de Renata Silva Borges. Aqui estão reunidos nove autores e seis avaliadores, todos vinculados a instituições de ensino e de pesquisa ligadas ao Serviço Público Federal, com sede nas cidades de Brasilia, Rio de Janeiro, Niteroi e Florianópolis: UNB, UNIRIO, UFF, UFRJ, UFSC, Arquivo Nacional e FIOCRUZ.Neste momento da história brasileira ─ em que se anunciam políticas governamentais em prol da cidadania, em que se diz da disposição de resgate da verdade sobre os fatos políticos acontecidos na gestão do estado brasileiro dos anos de 1964 a 1989 ─ os arquivos e seus profissionais passam a divisar um relevante protagonismo. Pode-se dizer que, de certa maneira, deu-se um movimento de preparação deste protagonismo e que, simultaneamente, essa preparação alicerçou a percepção de segmentos importantes do setor público para oferecer essa perspectiva para a sociedade nacional.Nesse sentido, tem peso relevante a instalação de novos cursos de bacharelado na área, totalizando, em 2011, o número de 14 universidades que os oferecem: UNIRIO, UFF, UFSM, UFES, UNB, UEL, UFBA ,UNESP/MARÍLIA, UFRGS, UEPB, UFAM, FURG, UFMG, UFSC. Uma nota marcante é que todas essas Instituições de Ensino Superior têm vínculos governamentais, sendo onze federais e três estaduais. Esse movimento não se faz por outro caminho senão o da pesquisa histórica e social. Em áreas como a História, Educa

Risk investigation for safety assessment of nuclear power stations

International Nuclear Information System (INIS)

Heuser, F.W.; Hoertner, H.; Kersting, E.

1987-01-01

The most important results of the technical system investigations for Phase B of the German Risk Study and the insight gained from them are discussed in connection with the risk analyses in judging the safety-related design. The results of the German Precursor Study for the Biblis A and B plants are given. There is also a comparison of the German with more recent American risk analyses. (DG) [de

Establishing a PWR burn-up library

International Nuclear Information System (INIS)

Lutz, D.C.

1981-01-01

Starting out from data file ENDF/B IV /1/, a cross-section library has been established for the calculation of operating conditions in pressurized water reactors of the type used in BIBLIS B. The library includes macroscopic, homogenized 2-group cross-sections for all types of fuel elements used in this reactor, including those equipped with boron glass rods. For their calculation the previous irradiation of the fuel has been taken into consideration by approximation. Information on fuel consumption from cell burn-up calculations has been stored in a separate data file. It was designed as a base for the determination of cross sections to be used in the calculation of the incident ''main-steam pipe fracture''. For this library the description of cross sections as a function of the moderator status chose the water densities at 300 0 C/155 bar, 190 0 C/140 bar and 100 0 C/100 bar as fixed values. The burn-up library has been tested by a three-dimensional calculation for the 1sup(st) cycle of the BIBLIS B-reactor using program QUABOX /2/. This showed variances with the anticipated course concerning critically, which can be explained almost quantitatively by known deficiencies of the ENDF/b-IV library. (orig.) [de

El ecosistema de la información científica: estructura y niveles de agregación

OpenAIRE

Abadal, Ernest; Codina, Lluís

2011-01-01

Se presentan los principales tipos de productos para el acceso a la información científica junto con sus rasgos diferenciales en cuanto a los contenidos analizados, la técnica utilizada (asignación y recolección de metadatos, indización o búsqueda federada) y los resultados ofrecidos. Los productos considerados son los siguientes: bases de datos bibliográficas, portales de revistas, repositorios, motores de búsqueda académicos, recolectores, metabuscadores académicos y metabuscadores de bibli...

Hamor-2: a computer code for LWR inventory calculation

International Nuclear Information System (INIS)

Guimaraes, L.N.F.; Marzo, M.A.S.

1985-01-01

A method for calculating the accuracy inventory of LWR reactors is presented. This method uses the Hamor-2 computer code. Hamor-2 is obtained from the coupling of two other computer codes Hammer-Techion and Origen-2 for testing Hamor-2, its results were compared to concentration values measured from activides of two PWR reactors; Kernkraftwerk Obrighein (KWO) and H.B. Robinson (HBR). These actinides are U 235 , U 236 , U 238 , Pu 239 , Pu 241 and PU 242 . The computer code Hammor-2 shows better results than the computer code Origem-2, when both are compared with experimental results. (E.G.) [pt

Emergency Diesel: Safety-related instrumentation and control with programmable logic controllers

International Nuclear Information System (INIS)

Breidenich, G.; Luedtke, M.

2004-01-01

This report presents a new concept for the design of emergency diesel equipment protection circuits as a part of the safety related instrumentation in the nuclear power plant Biblis, units A and B. The concept was implemented with state of the art SIMATIC S7/316 programmable logic controllers (PLCs) and can be adapted to any system with high availability requirements (e.g. power plant turbines, aircraft engines, mining pumps etc). (orig.)

Economía Política I, 2010-11

OpenAIRE

Antón Pérez, José Ignacio

2010-01-01

I. Materiales de clase: Teoría: 0. Conceptos básicos; 1. El problema económico; 2. Las ganancias derivadas del comercio; 3. Elementos básicos de la oferta y la demanda; 4. Elasticidades; 5. La medición del bienestar y la política económica; 6. La empresa: producción, costes y beneficios; 7. Las empresas en los mercados competitivos; Ejercicios: Ejercicios del Tema 2; Ejercicios del Tema 3; Ejercicios del Tema 4; Ejercicios del Tema 5; Ejercicios del Tema 6 y 7; Ejercicios de Repaso. II. Bibli...

Cancellation of the Kaiseraugst nuclear power plant project

International Nuclear Information System (INIS)

Blocher, C.; Schoenenberger, J.; Stucky, G.

1988-01-01

The nuclear power plant project at Kaiseraugst has been worked on for over 20 years. In 1985 the Swiss Parliament decided to license the plant. The cost of the work to date is about 1.2 x10 6 Swiss Franks. Continuation of the project is only sensible if it can be realized within a foreseeable space of time. It is probable that the discussions concerning future energy, environment and safety will continue for a long time. If this is clear that the Kaiseraugst project will not be realized during the next five to ten years for social, civic and political reasons. A continuation of the project is not justifiable. Kernkraftwerk Kaiseraugst AG must be adequately compensated. A motion has been presented to Parliament which charges the Government to negotiate with Kernkraftwerk Kaiseraugst AG for cancellation of the project

Medicinas complementarias]/alternativas en adolescentes con trastorno déficit atencional/hiperactividad y trastornos del ánimo

OpenAIRE

Pérez Carmona, María Pilar

2017-01-01

Las Medicinas Complementarias/alternativas (MCA) cada día son más utilizadas por los pacientes, incluidos niños y adolescentes. En Chile el Ministerio de Salud (Minsal), ha ido reconociendo y regulando alguna de ellas, aunque todavía existe gran desconocimiento sobre su efectividad y seguridad. Objetivo: Revisar la evidencia disponible en relación a las MCA en adolescentes con Trastorno déficit atencional/hiperactividad (TDAH) y trastornos del ánimo. Metodología: Se realizó una búsqueda bibli...

The 500 billion euro market. Dismantling of nuclear power plants; Der 500-Milliarden-Euro-Markt. Rueckbau von Kernkraftwerken

Energy Technology Data Exchange (ETDEWEB)

Trueck, Peter [Rochus Mummert Clean Energy, Hamburg (Germany); Oberle, Berthold [Rochus Mummert Clean Energy, Hamburg (Germany). Technologieberatung und Interim Management

2013-10-01

The decommissioning of the shut-down nuclear power plants is an enormous market potential. In order to develop this strategic business segment, different strategies offer for companies. [German] Der Rueckbau der abgeschalteten Kernkraftwerke bildet ein enormes Marktpotential. Um dieses strategische Geschaeftsfeld zu erschliessen, bieten sich fuer Unternehmen unterschiedliche Strategien an.

Pecat amagat és mitg perdonat.... La polèmica entre mossèn Gudiol i Antoni Bulbena arran de les edicions bibliòfiles de llibres eròtics

Directory of Open Access Journals (Sweden)

Albert Domènech

2014-06-01

Full Text Available El desembre de 1911 aparegué a la premsa local de Vic un article que va aixecar molta polseguera entre els bibliòfils de tot Catalunya. Un mossèn –historiador de l’art i gran moralistaacusava un conegut editor de llibres de bibliofília –sense dir-ne el nom-, d’editar llibres luxosos de contingut priàpic (pornogràfic. Aquest fet anecdòtic ens serveix per saber qui era l’editor esmentat, què hi havia de cert en l’»acusació» i com va encaixar el vituperat veure’s exposat a la vergonya pública. La correspondència creuada entre els dos protagonistes, exclusivament per mitjà d’un amic comú, ens facilita l’anàlisi de l’argumentari de l’un i de l’altre. Això ens permet copsar com s’entenia, des de la moral més conservadora a la d’un moderat lliurepensament, l’ampli arc que va de la literatura de temàtica amorosa a les obres clarament pornogràfiques. In December 1911 appeared in the local press in Vic (a town near Barcelona an article that raised an uproar in the bibliophile circles all over Catalonia. A priest (an Art historian and great moralist accused a well-known editor of fine books, without naming him, of editing luxury books of pornographic content. This anecdote serves us to find out who this editor was, how much truth there was in the «accusation» and how the censored editor took the fact of being exposed to public shame. The correspondence between the priest and the editor, facilitated by a common friend, helps us analyze the arguments of both parties. We can grasp how the vast frame that embraces love literature to clearly pornographic works was perceived, both from the most conservative moral to a moderate free-thinking perspective.

Training programme for direct operating functions

International Nuclear Information System (INIS)

Reuhl, R.

1986-01-01

In the lecture the initial and retraining programs for licensed and non-licensed nuclear power plant shift personnel will be commented. The programs were developed by Biblis Nuclear Power Plant Operations Management (RWE-Betriebsverwaltung) with regard to one decade of operational experience in Biblis nuclear power plants (2 PWR, 1300/1204 MW) and on the basis of the existing guidelines issued by the German Federal Ministry of the Interior. During the application and the constant development of the training programs emphasis was put on the connection of theory and practice following a special training strategy using different training facilities. In this context the role and qualification of the licensed instructors with shift supervisor experience get high importance. (orig./GL)

Future energy mix - also without nuclear power?

International Nuclear Information System (INIS)

George, C.

2005-01-01

The considerable rises in the price of oil in the months of October and November 2004 assigned topical importance to the 'Future Energy Mix - also without Nuclear Power?' meeting of young nuclear engineers and students with experts from politics, industry, and research at the YOUNG GENERATION event organized at the Biblis nuclear power station on November 4-6, 2004. Specialized presentations were made about these topics: The Biblis Nuclear Power Plant Site. The Effects of Deregulation on the Electricity Market Emission Trading - a Combination of Economy and Ecology? Energy Mix for the 21 st Century. The event was completed by a round-table discussion among leading experts, and a presentation of perspectives in university education in areas encompassing power technology. (orig.)

Organización y conflictos por el agua en el sistema de riego Quinuales-Buerán de la parroquia Honorato Vásquez del Cantón Cañar

OpenAIRE

Calle Calle, Carlos Humberto

2007-01-01

El canal de riego Quinuales-Buerán, fue construido a inicios del siglo XIX por los propietarios de haciendas, principalmente la hacienda El Colegio que utilizó mano de obra de indígenas y campesinos. Su captación está ubicada en la subcuenca del río Burgay, que corresponde a la cuenca del Cañar y los páramos de Patococha-Quinuales-Tuzhin se encuentran a 3.785 m.s.n.m que pertenecen a los cantones Biblián y Cañar, la infraestructura es canal abierto, cuya longitud es de 18 Kilómetros, que b...

Model study radioecology Biblis. Vol. 1

International Nuclear Information System (INIS)

1976-01-01

The first part of the study deals with questions concerning radiation on account of the release of radioactive substances into the environment via the aquatic pathway. The discussion is preceded by a lecture on the basis for the calculations, and on a lecture on the results of primary radiological model calculations. The colloquium aims at establishing existing knowledge, at coordinating deviating opinions, and at elaborating questions still open and the possibility to deal with these. On the whole, ten questions have emerged. They are mainly concerned with site conditions. These questions will be dealt with in the form of partial studies by individual participants or by task groups. The results will be discussed at further colloquia. (orig.) [de

Model study radioecology Biblis. Vol. 2

International Nuclear Information System (INIS)

1976-01-01

The second part of the study deals with questions concerning the release of radioactive substances into the environment via the air pathway and their diffusion. On the basis of an introductory lecture on basic principles the interrelations within the whole complex to be considered are discussed. For the release itself, the fundamental issues concerning type and quantity of radioactive substances and their time behaviour are established. With regard to diffusion, calculation models and their parameters are reviewed. Much the same as the first colloquium, this one too aims at compiling existing models and data, determining the known facts and the questions still open and formulating tasks for the further activities. Thirteen questions emerged. They are concerned, above all, with the existing conditions for release and diffusion at the site. These questions will be dealt with in the forms of partial studies by individual participants or by task groups. Results will be reported on at further colloquia. (orig.) [de

Fotografie und atomare Katastrophe

OpenAIRE

Bürkner, Daniel

2015-01-01

Die Dissertation setzt sich mit den fotografischen Repräsentationen der Atombombenabwürfe auf Hiroshima und Nagasaki sowie der Havarie des Kernkraftwerks Tschernobyl auseinander. Dabei werden künstlerische, dokumentarische und touristische Bilder analysiert, die sich der jeweiligen Strahlenkatastrophe oftmals erst Jahre nach dem Ereignis annehmen und ikonografische oder medial-materielle Bezüge zu ihr aufweisen. Es zeigen sich zentrale Strategien, atomare Katastrophen, seien sie militäri...

The Federal Administrative Court confirms unlawfulness of nuclear power moratorium. Political primacy is only valid in the bounds of justice; Bundesverwaltungsgericht bestaetigt Rechtswidrigkeit des Kernkraftmoratoriums. Primat der Politik gilt nur in den Schranken des Rechts

Energy Technology Data Exchange (ETDEWEB)

Leidinger, Tobias [Gleiss-Lutz Rechtsanwaelte, Duesseldorf (Germany)

2014-03-15

With its decision on December 20{sup th}, the Federal Administrative Court (BVwerfG) came to the legally valid conclusion that after the Fukushima nuclear power plant accident, the supervision court order related to the law on nuclear installation by the Hessian Ministry for the Environment, in order to stop operating nuclear power plants Biblis A and B for 3 months or rather not to put in operation again, was unlawful (BVwerfG 7 B 18.13 und 7 B 19.13). Beforehand, the Hessian Administrative Court (Hess. VGH) had already pronounced its judgement on February 27{sup th} 2013. The supervising orders were part of the so-called nuclear power moratorium. They were issued after the resolution of the federal government, at demand of the Federal Ministry for the Environment, Nature Conservation and Nuclear Safety (BMU) towards their nearby countries, and were identically executed by the supervisory authority of the other site-countries. Besides Biblis in Hesse, nuclear power plants in Neckarwestheim I and Philippsburg 1, Baden-Wurttemberg, Isar 1 in Bavaria, Unterweser in Lower Saxony, as well as Brunsbuettel in Schleswig-Holstein, were affected. However only RWE took legal action and was now affirmed - after the Hessian VGH verdict- by the highest German administrative court: The nuclear power moratorium - the first step to withdrawal of nuclear power in Germany - was unlawful. The decision taken by the BVerwG - as well as the one by the Hessian VGH - indicates a juridical clear and precise argumentation. The partially polemic and unobjective critic, which the VHG-verdict experienced, did not disguise, just as little as the political conflict concerning the withdrawal from nuclear energy, the view of federal judges, regarding the decision-relevant questions nor did they influence their reply. The political primacy finds its limits in the bounds of justice. Existing rights do not become thus a paper waste because there is a fundamental decision. This takes effectiveness for

The Federal Administrative Court confirms unlawfulness of nuclear power moratorium. Political primacy is only valid in the bounds of justice

International Nuclear Information System (INIS)

Leidinger, Tobias

2014-01-01

With its decision on December 20 th , the Federal Administrative Court (BVwerfG) came to the legally valid conclusion that after the Fukushima nuclear power plant accident, the supervision court order related to the law on nuclear installation by the Hessian Ministry for the Environment, in order to stop operating nuclear power plants Biblis A and B for 3 months or rather not to put in operation again, was unlawful (BVwerfG 7 B 18.13 und 7 B 19.13). Beforehand, the Hessian Administrative Court (Hess. VGH) had already pronounced its judgement on February 27 th 2013. The supervising orders were part of the so-called nuclear power moratorium. They were issued after the resolution of the federal government, at demand of the Federal Ministry for the Environment, Nature Conservation and Nuclear Safety (BMU) towards their nearby countries, and were identically executed by the supervisory authority of the other site-countries. Besides Biblis in Hesse, nuclear power plants in Neckarwestheim I and Philippsburg 1, Baden-Wurttemberg, Isar 1 in Bavaria, Unterweser in Lower Saxony, as well as Brunsbuettel in Schleswig-Holstein, were affected. However only RWE took legal action and was now affirmed - after the Hessian VGH verdict- by the highest German administrative court: The nuclear power moratorium - the first step to withdrawal of nuclear power in Germany - was unlawful. The decision taken by the BVerwG - as well as the one by the Hessian VGH - indicates a juridical clear and precise argumentation. The partially polemic and unobjective critic, which the VHG-verdict experienced, did not disguise, just as little as the political conflict concerning the withdrawal from nuclear energy, the view of federal judges, regarding the decision-relevant questions nor did they influence their reply. The political primacy finds its limits in the bounds of justice. Existing rights do not become thus a paper waste because there is a fundamental decision. This takes effectiveness for

The Chernobyl reactor accident, ten years on. Teaching projects for mathematics instruction in interdisciplinary working groups; 10 Jahre nach Tschernobyl. Unterrichtsprojekte fuer den Mathematikunterricht in faecheruebergreifenden Kooperationen

Energy Technology Data Exchange (ETDEWEB)

Boer, H. [comp.; Delle, E. [comp.; Mies, K. [comp.; Warmeling, A. [comp.

1996-10-01

The booklet presents background information and addresses the following aspects: ionizing radiation and radiation effects; safety of German nuclear power plants; statistical evidence of radiation injuries; short-lived and long-lived ionizing radiation; radioactive waste; CO{sub 2} emissions as an argument in favour of nuclear power generation. The material presented is intended for use by a school project team interested in the subjects, or as a basis for collaborative, interdisciplinary teaching in working groups, and it offers information and problems for mathematics teaching. (HP) [Deutsch] Neben vielen Informationen behandelt die Broschuere: Strahlen und Strahlenwirkungen; Sicherheit deutscher Kernkraftwerke; statistischer Nachweis von Strahlenschaeden; Kurz- und Langfestigkeit der Strahlenbelastung; radioaktiver Abfall; CO{sub 2}-Problematik als Argument fuer die Kernenergie. Die Broschuere ist gedacht z.B. fuer eine Projektgruppe, einen Projekttag, fuer eine Lerngruppe in faecheruebergreifender Kooperation. Die Materialien sind ausgearbeitet fuer die Themembearbeitung im Mathematikunterricht mit Uebungsaufgaben. (HP)

Federal Administrative Court on priorities between water law and nuclear law procedures

International Nuclear Information System (INIS)

Anon.

1980-01-01

With its decision of November 22, 1979 - BVerwG 4 B 162/79 -, the Federal Administration Court, at the expense of the plaintiff, has judged against a Bremen resident who had lodged a complained against the non-admission of an appeal in a partial verdict by the Lueneburg Higher Administrative Court concerning licenses under water law for Kernkraftwerk Unterweser. The value in litigation for the complaint procedure was set at DM 5000,-. In its partial verdict of February 12, 1979 - VII OVG A 113/77 - the Lueneburg Higher Administrative Court had decided that the plaintiff's rights are not infringed by the administrative steps under water law taken by the defendant district, and that pleas under nuclear law cannot be entered in the present procedure. The Federal Administrative Court was of the same opinion. The reasons for its decision are given in full wording. (orig./HP) 891 HP/orig.- 892 CKA [de

Evaluation of load case ``switch-off of the high pressure pump of the emergency core cooling system``, measures of verification and in situ-test; Einstufung des Lastfalls ``Ausfall der TH-Hochdruckeinspeisepumpe``, Massnahmen zur Verifikation bis hin zum Grossversuch

Energy Technology Data Exchange (ETDEWEB)

Trobitz, M.; Mattheis, A. [Kernkraftwerke Gundremmingen Betriebsgesellschaft m.b.H. (Germany); Kerkhof, K.; Hippelein, K. [Stuttgart Univ. (Germany). Staatliche Materialpruefungsanstalt; Gurr-Beyer, C. [Buero fuer Baudynamik, Stuttgart (Germany); Hofstoetter, P. [Technischer Ueberwachungs-Verein Rheinland e.V., Koeln (Germany)

1998-11-01

Within the framework of periodic safety inspection of the Gundremmingen power station (RWE-Bayernwerk - KRB II), the load collectives used for the design of safety-relevant systems and components were checked for their consistency with latest updates of the design basis. It was found that there was no analytical information or study available describing a particular process and its effects, namely switch-off of the high-pressure feedwater pump of the emergency core cooling system. The paper reports the work performed for closing the gap, including preparatory analyses, accompanying measures such as vibration measurements during plant shut-down, as well as the preparation and performance of the in-situ test. The experimental results and the comparative evaluation of calculated and experimental data are presented. (orig./CB) [Deutsch] Im Rahmen der periodischen Sicherheitsueberpruefung des Kernkraftwerkes Gundremmingen (Kernkraftwerke RWE-Bayernwerk - KRB II) wurden u.a. die Lastkollektive, die zur Auslegung sicherheitstechnisch relevanter Systeme und Komponenten herangezogen wurden, auf Aktualitaet ueberprueft. Dabei zeigte sich, dass bislang fuer eine Betriebsweise - naemlich das Abschalten der Hochdruckeinspeisepumpe des nuklearen Not- und Nachkuehlsystems (TH-HD-Pumpe) - keine analytischen Untersuchungen vorliegen. Vorbetrachtungen fuer analytische Untersuchungen, begleitende Massnahmen wie Schwingungsmessungen waehrend des Anlagenstillstandes, sowie der Versuchsaufbau und die Versuchsdurchfuehrung des Anlagenversuches werden hier dargestellt. Die Ergebnisse und der Vergleich Rechnung-Messung zum Grossversuch werden in diesem Beitrag vorgestellt. (orig.)

Tasks of radiation protection in the centralized collection and ultimate disposal of radioactive waste

International Nuclear Information System (INIS)

Boerst, F.M.; Fasten, C.; Koerner, W.; Oppermann, U.; Werner, H.J.; Zappe, D.

1988-01-01

In the GDR, the ERAM (Endlager fuer radioaktive Abfaelle, Morsleben), an operating unit of Volkseigenes Kombinat Kernkraftwerke 'Bruno Leuschner' in Greifswald, is responsible for the central collection and ultimate disposal of radioactive waste. From the licensing body's point of view an assessment is given of the legislation for radioactive wastes, especially as to their collection, transport to and handling in the final repository. As a result, some conclusions are drawn concerning future work in this field. 9 tabs., 34 refs. (author)

A licence to discharge cooling waters in tidal rivers, examplified by the 'Nuclear Power Station Unterweser'

International Nuclear Information System (INIS)

Kunz, H.

1976-01-01

Illustrated by the example of the lower Weser, aspects for automatic control, supervision measurements, and measurements for the securing of evidence, all in connection with cooling water discharges, are presented. The particularities of tidal rivers and the conditions for measuring systems resulting therefrom are explained. The cooling water discharge of the Kernkraftwerk Unterweser has been assigned an extensive measurement system for the automatic compilation of hydrologic data. The measurement systems design, the measurement stations, and the central station are described. (orig.) [de

Nuevas nociones sobre el género Ficus en Colombia, III

Directory of Open Access Journals (Sweden)

Dugand Armando

1944-06-01

Full Text Available En este trabajo, continuación de mi estudio del genero Ficus en Colombia, se describe una especie nueva de este país y se proponen sendos nombres nuevos para dos especies antiguas recientemente halladas en Colombia pero originalmente descritas del Amazonas brasileño y de la América Central. Aprovecho esta oportunidad para expresar mi más vivo agradecimiento a la señorita Marjorie W. Stone, Bibliógrafa del Gray Herbarium, Universidad de Harvard, y al señor León Groizat, del Arnold Arboretum, Universidad de Harvard, por la muy diligente y valiosa ayuda que me han prestado en la búsqueda de datos bibliográficos referentes a algunas especies de Ficus de status nomenclatural incierto o dudoso.

Kernkraftwerk Obrigheim GmbH. Annual report 1989

International Nuclear Information System (INIS)

Koerner, C.

1990-01-01

The Obrigheim nuclear power station was operated at full load during the year 1989: 7.756 operating hours produced electrical energy of 2.689 GWh. This is the fifth best annual result during Obrigheim's operating period. Since commissioning in October 1968, 154.866 hours of operation have generated 52.125 GWh (gross) and from test operation in March 1969 until the end of 1989, 154.086 hours of operation have generated 52.013 GWh. This is an availability of power of 82.1% in this period and a time availability of 84.4%. In 1988, the plant was shut down for 927 hours for the 20th refueling including testing, inspection and repair work. Apart from refueling, the plant had a good time availability and therefore contributed 5% to the safe, economical and environmentally acceptable electricity supply of the Land Baden-Wuerttemberg. The power station is of great significance to the region, both in terms of power supply and the economy. (orig.) [de

Kernkraftwerk Obrigheim GmbH. Annual report 1990

International Nuclear Information System (INIS)

Koerner, C.

1991-01-01

The Obrigheim nuclear power station was operated at full load from January 1 through May 25, 1990, generating 1.236 GWh of electrical energy in 3.475 operating hours. The Obrigheim nuclear power station thus achieved during this period of 145 days in 1990 an operating availability of 100%. Since its commissioning in October 1968, the Obrigheim reactor station has been operating for 158.341 hours, generating 53.361 GWh (gross), and from test operation started in March 1969 up to the end of 1990, all in all 53.249 GWh have been generated in 157.561 operating hours, which means an availability time ratio of 82.3 %, and a capacity factor of 80.1%. The plant was shut down in 1990 for the 21st refuelling operation including inspection and repair work, for a fictitious period of 942 hours. In addition, power operation was stopped by an order of the supervisory authority for another 4.343 hours, so that the plant remained disconnected from the grid between May 26 and December 31, 1990. In the first part of the year 1990, until May 26, the plant had an excellent availability time ratio and thus contributed about 2.5% of the safe, economic and environmentally sound electricity supplies in Baden-Wuerttemberg. (orig./HP) [de

On the failure probability of the primary piping of the PWR

International Nuclear Information System (INIS)

Schueller, G.I.; Hampl, N.C.

1984-01-01

A methodology for quantification of the structural reliability of the primary piping (PP) of a PWR under operational and accidental conditions is developed. Biblis B is utilized as reference plant. The PP structure is modeled utilizing finite element procedures. Based on the properties of the operational and internal accidental conditions, a static analysis suffices. However, a dynamic analysis considering non-linear effects of the soil-structure-interaction is to be used to determine load effects due to earthquake induced loading. Considering realistically the presence of initial cracks in welds and considering annual frequencies of occurrence of the various loading conditions, a crack propagation calculation utilizing the Forman model is carried out. Simultaneously leak and break probabilities using the 'Two Criteria'-Aproach are computed. A Monte Carlo simulation procedure is used as method of solution. (Author) [pt

Investigation of the burn-up behavior of boron poison rods, placed in a fuel assembly of a pressurized water reactor

International Nuclear Information System (INIS)

Arnold, C.; Lutz, D.C.

1979-09-01

The excess reactivity of a pressurized water reactor is compensated by boron, disolved in the moderator. In addition during the first cycle boron poison rods are placed in fuel assemblies without control rods. The burn-up behavior of a poison rod in a Biblis B fuel assembly is analysed in the present paper. Multigroup spectrum calculations were performed. The influence of critical boron concentration depending from burn-up, the changes of fuel concentration and the concentration of burnable poison were taken into consideration. Furthermore the built-up of rapidly saturating fisson products 135 Xe and 149 Sm was considered. The interaction of these effects are discussed. Spatial influences are emphasized most. Finally two group cross sections were calculated. The results are compared with calculations for a fuel assembly of the same type without burnable poison rods. (orig.) [de

Operating experience with PWR in the FRG (Federal Republic of Germany)

International Nuclear Information System (INIS)

Cramer, H.

1980-01-01

Operating experiences with PWR's in the Federal Republic of Germany has been exclusively with KWU turnkey power plants with U tube steam generators. Such experience started with the 345 MW Obrigheim plant in 1968 and includes the 670 MW Stade plant, the 1200/1300 MW Biblis plants, The 900 MW Neckarwestheim and the 1300 MW Unterweser plants. (E.G.) [pt

Development of an EDV-supported decision instrument for site pre-selection of nuclear power plants. EDV-supported instrument for calculation of the space distribution of the collective dose rate and area contamination. Vol. 1. Radiation exposure through air- and water paths under authorized operating conditions and during incidents

Energy Technology Data Exchange (ETDEWEB)

Bruessermann, K; Eschhaus, M; Kreymborg, A; Muenster, M; Schommer, N

1980-01-01

The collective dose rate and the area contamination form a basis for site criteria going beyond the individual considerations of distribution of the population, hydrology, meteorology etc. The possibilities of radio-ecological models on the radiation exposure through air- and water paths during operation and incidents are described by example of Biblis, Muelheim-Kaerlich and Esensham. Comparative evaluations were effected for Fessenheim.

Lucien Febvre. Vivre L’histoire

Directory of Open Access Journals (Sweden)

Renán Silva

2011-07-01

Full Text Available En una edición buena, barata y fácil de manejar a pesar del número de páginas de la publicación, con todos los índices necesarios para hacer del propio libro un instrumento de investigación, y bajo la responsabilidad de dos verdaderos especialistas en la obra de Lucien Febvre —B. Mazon es la responsable de la organización de los archivos del gran historiador y B. Müller es bibliógrafo e intérprete de Febvre y responsable de la edición científica de su correspondencia con Marc Bloch—, se puede hoy disponer en un solo volumen de dos de las grandes obras de crítica histórica del notable historiador francés, uno de los fundadores de los Annales y en buena medida el responsable del programa de investigaciones históricas que durante el siglo xx caracterizó lo que con más o menos justicia se llamó la “escuela histórica francesa”.

Nuclear waste or the farewell to an expensive dream. Atommuell oder der Abschied von einem teuren Traum

Energy Technology Data Exchange (ETDEWEB)

Fischer, H; Goedecke, R; Herzer, W; Kollert, R; Poel, B; Schmidt, P G; Schubert, W [Bremen Univ. (Germany, F.R.). Fachsektion Physik

1977-01-01

After the controversies over Wyhl and Biblis, Esensham and Brokdorf, resistance rises in the North of Germany against the planned nuclear waste factories. This book informs on problems and hazards in connection with reprocessing plants for spent fuel. It takes a critical look at the dangers of the 'peaceful' uses of nuclear energy and bids farewell to an expensive, and for everybody fateful dream.

Nuclear waste or the farewell to an expensive dream

International Nuclear Information System (INIS)

Fischer, H.; Goedecke, R.; Herzer, W.; Kollert, R.; Poel, B.; Schmidt, P.G.; Schubert, W.

1977-01-01

After the controversies over Wyhl and Biblis, Esensham and Brokdorf, resistance rises in the North of Germany against the planned nuclear waste factories. This book informs on problems and hazards in connection with reprocessing plants for spent fuel. It takes a critical look at the dangers of the 'peaceful' uses of nuclear energy and bids farewell to an expensive, and for everybody fateful dream. (orig.) [de

Design and realization of a dosimetry and radiology system for nuclear power plants

International Nuclear Information System (INIS)

Capelle, M.

Computer-assisted acquisition of radiation exposure data and related tasks was established at an early stage at Biblis nuclear power plant of RWE. Due to the positive experience with this system a similar, more sophisticated system has been developed for the nuclear power plants at Grundremmingen, Muelheim-Kaerlich and Kalkar. This system, DORA (Dosimetry and radiological monitoring) is described in the article. (RW) [de

German precursor study: methods and results

International Nuclear Information System (INIS)

Hoertner, H.; Frey, W.; von Linden, J.; Reichart, G.

1985-01-01

This study has been prepared by the GRS by contract of the Federal Minister of Interior. The purpose of the study is to show how the application of system-analytic tools and especially of probabilistic methods on the Licensee Event Reports (LERs) and on other operating experience can support a deeper understanding of the safety-related importance of the events reported in reactor operation, the identification of possible weak points, and further conclusions to be drawn from the events. Additionally, the study aimed at a comparison of its results for the severe core damage frequency with those of the German Risk Study as far as this is possible and useful. The German Precursor Study is a plant-specific study. The reference plant is Biblis NPP with its very similar Units A and B, whereby the latter was also the reference plant for the German Risk Study

Fast reactor cycle calculation routine using a 3D-simulator and investigation of new burnup stategies for pressurized water reactors

International Nuclear Information System (INIS)

Li Yulun.

1987-03-01

Three-dimensional calculations of the longtime behaviour of PWR can be done in short computing times with satisfactory accuracy for power and burn-up distributions. This has been proved by comparison with operational data of Biblis-B. Various possibilities are investigated to increase the discharge burn-up and to improve the utilization of uranium. In view of the increase of discharge burn-up due to enhanced cycle number (decreased batch size) and decreased neutron leakage these new strategies are intensively studied in the conventional fuel management scheme (Out-in) and in the low leakage fuel management scheme (In-Out). By a conventional fuel management scheme with four cycle operation and a low leakage fuel management scheme with three cycle operation an attractive increase of discharge burn-up to about 40% can be achieved by an increase in the reload enrichment to 4%. (orig.) [de

Seudónimos de escritores colombianos

Directory of Open Access Journals (Sweden)

Boletín Cultural y Bibliográfico Banco de la República

1960-02-01

Full Text Available El Instituto Caro y Cuervo, al publicar este catálogo de Seudónimos de escritores colombianos, quiere rendir homenaje a su autor, el esclarecido historiador, bibliotecario y bibliógrafo don Gustavo Otero Muñoz (1894-1957. El presente trabajo es fruto de las pesquisas adelantadas por el doctor Otero Muñoz en el curso de sus estudios sobre literatura colombiana.

Publication concerning licensing notices for the Kernkraftwerk Kruemmel

International Nuclear Information System (INIS)

1977-01-01

The 3rd supplement to the 2nd partial licence sector concerns the change of concept regarding the scram system by going over from the scram collecting tank system to the individual tank system. The 7th partial licence notice refers to the construction of 1) the control rod drive and the scram system including the related operational controls; 2) the emergency power diesel aggregates; 3) the condensation pipe transverse system (transverse system in the condensation chamber). (orig./HP) [de

Hochtemperatur-Kernkraftwerk GmbH (HKG). Annual report 1985

International Nuclear Information System (INIS)

1986-01-01

The annual report presents the agenda of the general meeting of members, held on July 3, 1986 at Hamm-Uentrop, the report of the managing board, and the annual financial statement as of December 31, 1985, including the profit and loss account of the period January 1 to December 31, 1985. The object of the HKG GmbH is the planning, financing, installation, and operation of the Hamm-Uentrop nuclear power station equipped with a high-temperature reactor, as a joint enterprise of the European partners. (UA) [de

Kernkraftwerk Obrigheim (KWO) GmbH. Annual report 1991

International Nuclear Information System (INIS)

Koerner, C.

1992-01-01

The Obrigheim nuclear power station was operated at full load from August 21 through Dec. 31, 1991, generating 1.108 GWh of electrical energy in 3.186 operating hours. The Obrigheim nuclear power station thus achieved during this period of 133 days in 1991 an operating availability of 100%. Since its commissioning in October 1968, the Obrigheim reactor station has been operating for 161.527 hours, generating 54.409 GWh (gross), and from test operation started in March 1969 up to the end of 1991, all in all 54.284 GWh have been generated in 160.747 operating hours, which means an availability time ratio of 78.2%, and a capacity factor of 80.4%. The plant was shut down in 1991 for the 21st refuelling operation including inspection and repair work, for a fictitious period of 1783 hours. In addition, power operation was stopped by an order of the supervisory authority for another 3.791 hours, so that the plant remained disconnected from the grid between Januar 1 and August 8, 1991. In the last part of the year 1991, until May 26, the plant had an excellent availability time ratio and thus contributed about 2.5% of the safe, economic and environmentally sound electricity supplies in Baden-Wuerttemberg. (orig.) [de

Surveillance systems (PWR) - loose parts monitoring - vibration monitoring - leakage detection

International Nuclear Information System (INIS)

Schuette, A.; Blaesig, H.

1982-01-01

The contribution is engaged in the task and the results of the loose parts monitoring and the vibration monitoring following from the practice at the PWR of Biblis. First a description of both systems - location and type of the sensors used, the treatment of the measurements and the indications - is given. The results of the analysis of some events picked up by the surveillance systems are presented showing applicabilty and benefit of such systems. (orig.)

New faunistic records of ground beetles (Coleoptera, Carabidae from Hormozgan province, Iran

Directory of Open Access Journals (Sweden)

Azadbakhsh Saeed

2016-09-01

Full Text Available This paper presents the results of a faunal study of ground beetles (Coleoptera: Carabidae from Hormozgan province in southern Iran, which was carried out from winter 2015 to winter 2016. A total of 30 species belonging to 18 genera were collected and identified. Two species – Calodromius mayeti and Elaphropus (Tachyura biblis – are reported from Iran for the first time; in addition, the occurrence of several species in Iran was confirmed.

Global Ethics Applied: Global Ethics, Economic Ethics

OpenAIRE

Stückelberger, Christoph

2016-01-01

Global Ethics Applied’ in four volumes is a reader of 88 selected articles from the author on 13 domains: Vol. 1 Global Ethics, Economic Ethics; Vol. 2 Environmental Ethics; Vol. 3 Development Ethics, Political Ethics, Dialogue and Peace Ethics, Innovation and Research Ethics, Information and Communication Ethics; Vol. 4 Bioethics and Medical Ethics, Family Ethics and Sexual Ethics, Leadership Ethics, Theological Ethics and Ecclesiology, Methods of Ethics. It concludes with the extended Bibli...

SIMULA - C a simplified PC simulation training fool developed for the initial training of NPP operations personnel

International Nuclear Information System (INIS)

Reuhl, R.

1997-01-01

During initial training of some 50 young reactor operators and shift supervisors in the last 5 years in Biblis it was found that it takes some time before trainees gain a food overview of the most important plant systems and develop a ''feeling'' of the dynamic plant behaviour which is an important prerequisite for the first full-scope simulator training courses. To enhance this, a PC software training tool was developed SIMULA - C. (author)

Reliability assessment of the containment of a PWR

International Nuclear Information System (INIS)

Schueller, G.I.; Wellein, R.; Wittmann, F.H.; Boulahdour, T.; Mihashi, M.; Zorn, N.F.; Bauer, J.

1981-09-01

The aim of this research effort was to contribute to the development of methods to quantify the risk involved with nuclear power plants. Using a large component, i.e. the containment of the reference plant BIBLIS B (PWR) as sample structure a reliability analysis was performed which is based on realistic assumptions of loads and material properties. For this purpose in many fields it was necessary to develop new methods, collect data, and where not available, obtain data in tests. This effort concentrated on partial aspects and on the other hand on the development of a methodology for an overall reliability concept. According to the results of the previous project, the keypoints of this effort are the treatment of loss of coolant accidents (small leak), earthquake loading, the possibly resulting crackpropagation in the steel hull, and the structural mechanics and material strength aspects of the reinforced concrete hull subjected to impact loading (aircraft impact). (orig./HP) [de

The German reactor safety study

International Nuclear Information System (INIS)

Birkhofer, A.

1980-01-01

The most important results of the German risk study of a nuclear power plant equipped with a pressurized water reactor were published in August 1979. The main volume of the study with the approach used and the results elaborated has been available for reference since late 1979. Eight technical volumes contain detailed descriptions and documentations of the investigations carried out. The reference facility used as a basis for the technical plant studies was unit B of the Biblis Nuclear Power Station, a KWU PWR of 3750 MW thermal power. This contribution provides more detailed explanations of the methods and the results of the risk study illustrated by examples. The description refers to accident categories and categories of radioactivity releases, probabilities of specific sequences of accident events, and the damage associated with core meltdown accidents as a function of various types of failure. For purposes of evaluation and application of the results the limits in the basic assumptions of the study are referred to. (orig./HP) [de

PRA for emergency planning: assessing the risk profile of a 3-loop PWR on the basis of US and German risk studies

International Nuclear Information System (INIS)

Chakraborty, S.; Fuchs, H.; Gubler, R.; Landolt, J.; Miteff, L.

1985-01-01

Emergency planning around nuclear power plants should be based on a realistic assessment of their risk profile. Since the results of the Rasmussen study (WASH-1400) and later of the German risk study (Phase A) were not judged to be fully representative for NPP's in Switzerland, an investigation was started to transfer applicable US and German results to a Swiss 3-loop PWR (Goesgen) and to assess the impact of differences in plant design compared to Surry-1 and Biblis-B. The core melt probability for Goesgen was calculated to be more than a factor of ten smaller than for the US and German studies. This is mainly due to more redundancy/better separation (especially in the emergency feedwater) and to partial automation of cooldown after a small break. The results were instrumental in limiting the release categories to be used as reference cases for emergency planning. Further reduction of postulated accidental releases is expected from the current source term research

Atomic energy - challenge to the church. Atomenergie - Herausforderung an die Kirchen

Energy Technology Data Exchange (ETDEWEB)

Altner, G [comp.

1977-01-01

In the nuclear debate, the church has astonishingly soon and clearly stated its point of view and supported the social-ethic commitment of many of its members, of preachers, bishops, and church councils. This volume, in its first part, presents and comments on the church's statements concerning the nuclear problem, with special interest in the focal points of the nuclear debate, i.e. Wyhl, Brokdorf, Biblis, Grafenrheinfeld, and Borken. The second part deals with the challenge of nuclear power.

Results of the reliability investigations for the design basis accident 'Rupture of a cold primary coolant system'

International Nuclear Information System (INIS)

Hoertner, H.; Nieckau, E.; Spindler, H.

1976-12-01

This report gives a comprehensive presentation of the detailed reliability investigation carried out for the engineered safety features installed to cope with the design basis accident 'Large LOCA' of a German nuclear power plant with pressurized water reactor. The investigation is based on the engineered safety features of the Biblis Nuclear Power Plant, Unit A. The reliability investigation is carried out by means of a fault tree analysis. The influence of common-mode failures is assessed. (orig.) [de

Organization patterns of PWR power plants

International Nuclear Information System (INIS)

Leicman, J.

1980-01-01

Organization patterns are shown for the St. Lucia 1, North Anna, Sequoyah, and Beaver Valley nuclear power plants, for a typical PWR power plant in the USA, for the Biblis/RWE-KWU nuclear power plants and for a four-unit nuclear power plant operated by Electricite de France as well as for the Loviisa power plant. Organization patterns are also shown for relatively independent and non-independent nuclear power plants according to IAEA recommendations. (J.P.)

Kernkraftwerke Lippe-Ems GmbH (KLE). 1995 annual report

International Nuclear Information System (INIS)

1996-01-01

The tasks and activities of the operators of the Emsland reactor station (KKE) are reported. The year-end statement of 1995 includes many details about the financial situation, (such as the balance sheet, profit and loss account, etc.). (UA) [de

Annual report 1988 of the Kernkraftwerk Obrigheim GmbH

International Nuclear Information System (INIS)

Koerner, C.

1989-01-01

The Obrigheim nuclear power station was operated at full load during the year 1988; 7.800 operating hours produced electrical energy of 2.755 GWh. This is the second best annual result during Obrigheim's operating period. Since commissioning in October 1968, 147.110 hours of operation have generated 49.436 GWh (gross) and from test operation in March 1969 until the end of 1988, 146.330 hours of operation have generated 49.324 GWh. This is an availability of power of 81.9% in this period and a time availability of 84.1%. In 1988, the plant was shut down for 927 hours for the 18th refueling including testing, inspection and repair work. Apart from refueling, the plant had a good time availability and therefore contributed 5% to the safe, economical and environmentally acceptable electricity supply of the Land Baden-Wuerttemberg. The power station is of great significance to the region, both in terms of power supply and the economy. (orig./HP) [de

German study on the risks of nuclear power plants

International Nuclear Information System (INIS)

Wollny, V.

1987-01-01

The 'Deutsche Risikostudie Kernkraftwerke', DRS, (German study on the risks of nuclear plants) calculates a frequency of 1/10000 years (i.e. once in 10000 years of reactor operation) for the event of insufficient cooling of the reactor core occurring. The resulting collective risk is put at approximately 10 deaths per year for 25 plants. As the explanations show, the error margin of such a risk statement is enormous. Moreover, much seems to indicate that the risk was underrated. Apart from this, risk analyses are of doubtful value in the decision process for or against the introduction of large-scale technologies. They cannot replace the individual decision of all concerned. (orig./HSCH) [de

Risk reduction category (RRC-A) accident studies in the safety analysis report of the EPR trademark reactor

International Nuclear Information System (INIS)

Poehlmann, M.; Bleher, G.; Ismaier, A.; Knoll, A.; Levi, P.; Garcia, E. Vera; Schels, A.; Seitz, H.; Lima Campos, L.

2013-01-01

The Risk Reduction Category (RRC-A) is considered in the safety demonstration of nuclear reactors in addition to design basis operating conditions (Plant Condition Category, PCC), in order to analyze with a risk reduction approach any operating conditions with multiple failures. As extending the operating conditions of the plant 'beyond design basis', the Risk Reduction Category (RRC-A) is also denoted as Design Extension Condition (DEC-A). In the German licensing framework, the RRCA (or DEC-A) transients correspond to safety assessment level '4b' of the 'Sicherheitsanforderungen an Kernkraftwerke' (Safety Requirements for Nuclear Power Plants), Az. RS I 5 - 13303/01 of the German Federal Ministry for the Environment, Nature Conservation and Nuclear Safety. These RRC-A (or DEC-A) operating conditions require specific design provisions (implemented by manual or automatic action), known as RRC-A measures, intended to render consequences of accumulated failures admissible. In contrast, RRC-B constitute severe accidents that lead to core melt. Identification of RRC-A operating conditions and corresponding RRC-A measures is based on the use of results of probabilistic safety assessments. After the Fukushima accident the RRC-A accidents like Station Black Out (SBO) or Loss of Ultimate Heat Sink (LUHS) are of particular interest in the safety assessment of nuclear new builds. In several chapters of the Safety Analysis Report it is demonstrated that the AREVA EPRTM design is resistant at RRC-A accident conditions. (orig.)

Absorption of selected radionuclides. Analysis of a literature study. Resorption ausgewaehlter Radionuklide. Analyse einer Literaturstudie

Energy Technology Data Exchange (ETDEWEB)

Roedler, H D; Kraus, H M

1979-12-01

In October 1978, the Institut fuer Energie- und Umweltforschung Heidelberg e.V. published a contribution to part 26 of the model study of radio-ecology at Biblis under the title 'Estimation of the absorption of radionuclides from the gastrointestinal tract in the blood'. Using the example of this contribution, a critical analysis is made to show how a selection of the information contained in various scientific publications and other items of literature can give uncritical readers the impression that all statements made are scientifically well founded.

Arabic in the Specialised Literature on Translation and Interpreting

OpenAIRE

Zanón, Jesús

2011-01-01

The purpose of this work is to investigate the research activity on Arabic translation and interpretation, to explore the most widely discussed topics, and to depict their recent evolution. The most remarkable results can be summarized as follows. An interest on Arabic translation studies is confirmed: it starts in the XIX century and extends through the XX century, where there is a slight but constant increase on the number of publications up to the 1980s. From the 1990s onwards, a big bibli...

Mechanized radiation testing of austenitic pipe welds. Testing of media filled pipes and determination of the flaw depth by tomosynthesis; Mechanisierte Durchstrahlungspruefung von Rundschweissnaehten. Pruefung mediengefuellter Rohrleitungen und Tiefenlagenbestimmung durch Tomosynthese

Energy Technology Data Exchange (ETDEWEB)

Ewert, U.; Redmer, B. [Bundesanstalt fuer Materialforschung und -pruefung (BAM), Berlin (Germany); Mueller, J. [COMPRA GmbH, Frechen (Germany); Trobitz, M. [Kernkraftwerke Gundremmingen Betriebsgesellschaft mbH, Gundremmingen (Germany); Baranov, V.A. [Institute for Introscopy, Tomsk (Russian Federation)

1999-08-01

A compact detection system was built for multi-angle inspection of pipes, consisting of a high-sensitivity radiometric line scanner and an ultrasonic manipulator. Improved flaw imaging quality is achieved with this system as compared to film radiography. Measurements have been carried out on site in a nuclear power plant and in a laboratory. Better flaw imaging quality was also achieved in the testing of water-filled pipes. Non-linear tomosynthesis was applied for processing and interpretation of measured data. The system delivers considerably better images of planary materials inhomogeneitites, (such as cracks and lack-of-bond defects). (orig./CB) [Deutsch] Eine hoch empfindliche radiometrische Zeilenkamera wurde mit einem Ultraschall-Manipulator zu einem Gesamtsystem aufgebaut und fuer Mehrwinkel-Inspektionen von Rohrleitungen angewandt. Bei der Inspektion von Rundschweissnaehten an Rohren mit ca. 8... 20 mm Wanddicke wurde eine Verbesserung der Bildqualitaet im Vergleich zur Filmradiographie erreicht. Diese Messungen wurden in einem Kernkraftwerk unter Vor-Ort-Bedingungen sowie im Labor ausgefuehrt. Ein signifikantes Ansteigen der Bildqualitaet wurde auch bei der Pruefung von wassergefuellten Rohren erzielt. Methoden der nicht-linearen Tomosynthese wurden fuer die Verarbeitung und Interpretation der gemessenen Projektionsdaten genutzt. Das entwickelte System gestattet eine erhebliche Verbesserung der Anzeige von planaren Materialinhomogenitaeten (z.B. Risse und Bindefehler). (orig./DGE)

Integrated disturbance analysis (IDA): A basis for expert systems in nuclear power plants

International Nuclear Information System (INIS)

Bastl, W.

1987-01-01

In the framework of a project sponsored by the Bundesminister fur Forschung und Technologie (BMFT) and the Rheinisch-Westfalisches Elektrizitatswerk AG (RWE) the concept of Integrated Disturbance Analysis (IDA) has been developed and applied to the Biblis Unit B Nuclear Power Plant. Rather than using the classical approach, which aims at finding the cause of a plant disturbance, the main goal was to make transparent to the operator what it really means for the process, when a set of parameters begins to deviate from its normal state. Therefore the goal was to help the operator to combine the information on the individual process parameters to the complete picture of the evolving transient, thus facilitating the decision about the importance of a disturbance for operational safety. Considering this goal the most important subjects taken care of were: to extend event sequence analysis by means of analog information; to provide adequate modelling of time dependent processes and feedback loops; to integrate IDA information effectively into the existing control room environment

Safety and risk assessments for the SNR 300

International Nuclear Information System (INIS)

Maschek, W.; Froehlich, R.; Jacobs, H.; Schikorr, M.; Heusener, G.; Caldarola, L.; Royl, P.; Struwe, D.

1983-01-01

Under the official inquiry ''Future Nuclear Energy Policies'', KfK have carried out a number of studies concerning the hazards arising from core-destructive accidents at the SNR-300 reactor. Among these, there was the so-called ''Upper Limit Study'' providing a critical evaluation of literature on all research done on core-destructive accidents (Bethe-Tait excursion) with a high mechanic energy release potential; the other one was the so-called ''SAI Study'' (a cooperation of KfK, Science Applications, Inc. (SAI) and Interatom (IA)) which investigated the hazards of an uncontrolled coolant flow rate disturbance occurring in the SNR-300 reactor. KfK also took part in the analysis of hazards comparing the SNR-300 reactor with an LWR-type reactor like the one at Biblis B, ordered by the Federal Ministry of Research and Technology (BMFT). These studies have already been dealt with KfK-Nachrichten, 14th annual set issue 4/1982. The article on hand summarizes and evaluates once more the most important results. (orig./RW) [de

Case Law

International Nuclear Information System (INIS)

2014-01-01

This section treats of the following case laws sorted by country: 1 - Germany: Federal Administrative Court confirms the judgments of the Higher Administrative Court of the Land Hesse: The shutdown of nuclear power plant Biblis blocks A and B based on a 'moratorium' imposed by the Government was unlawful; List of lawsuits in the nuclear field. 2 - Slovak Republic: Further developments in cases related to the challenge by Greenpeace Slovakia to the Mochovce nuclear power plant; Developments in relation to the disclosure of information concerning the Mochovce nuclear power plant. 3 - United States: Judgment of the Nuclear Regulatory Commission resuming the licensing process for the Department of Energy's construction authorisation application for the Yucca Mountain high-level radioactive waste repository; Judgment of the Licensing Board in favour of Shaw AREVA MOX Services regarding the material control and accounting system at the proposed MOX Facility; Dismissal by US District Court Judge of lawsuit brought by US military personnel against Tokyo Electric Power Company (TEPCO) in connection with the Fukushima Daiichi nuclear power plant accident

Consequences of the Federal Administrative Court decisions about the Biblis on-site interim store and the 'Biblis condition' as seen by the Nuclear Regulatory Authority of the State of Baden-Wuerttemberg; Folgerungen aus den Urteilen des Bundesverwaltungsgerichts zum Standortzwischenlager Biblis und zur 'Biblis-Auflage' aus der Sicht der Atomaufsichtsbehoerde des Landes Baden-Wuerttemberg

Energy Technology Data Exchange (ETDEWEB)

Rauscher, Dieter [Umweltministerium Baden-Wuerttemberg, Stuttgart (Germany)

2009-03-15

On March 17, 2005, the Baden-Wuerttemberg State Ministry of Economics, following instructions by the Federal Ministry for the Environment, Nature Conservation, and Nuclear Safety (BMU), imposed an ex-post-facto condition on the licensee of the Philippsburg Units 1 and 2 nuclear power station. Its content can be summed up as follows: In case of deviations from criteria specified in the license which are relevant to accident management, the plant must be shut down. In case of suspicion that, for whatever reason, accident management could be doubtful, accident management must be demonstrated to function; failing this, the plant must be shut down. In a decision of February 26, 2007, the Baden-Wuerttemberg State Court of Administration set this condition aside. The Federal Administrative Court, in its ruling of April 10, 2008, essentially confirmed the decision of the court of first instance. Both decisions are analyzed. Licensees and public authorities are shown the general framework of administrative law within which their relations are regulated. Another subject covered is jurisdiction about provisions against damage in connection with the ruling of the Federal Administrative Court of April 10, 2008 in the matter of the Brunsbuettel interim store. The court comments on the question of provision against damage in the area of protection, develops the dogma from scratch again as to the borderlines separating provisions against damage from residual risk and, within this framework, addresses the problem of third-party action against execution, especially so with respect to protection. The question of possible repercussions upon practice is discussed also for this court ruling. (orig.)

Comparison of plant-specific probabilistic safety assessments and lessons learned

Energy Technology Data Exchange (ETDEWEB)

Balfanz, H.P. [TUeV Nord, Hamburg (Germany); Berg, H.P. [Bundesamt fuer Strahlenschutz, Salzgitter (Germany); Steininger, U. [TUeV Energie- und Systemtechnik GmbH, Unternehmensgruppe TUeV Sueddeutschland, Muenchen (Germany)

2001-11-01

Probabilistic safety assessments (PSA) have been performed for all German nuclear power plants in operation. These assessments are mainly based on the recent German PSA guide and an earlier draft, respectively. However, comparison of these PSA show differences in the results which are discussed in this paper. Lessons learned from this comparison and further development of the PSA methodology are described. (orig.) [German] Probabilistische Sicherheitsanalysen (PSA) sind fuer alle in Betrieb befindlichen deutschen Kernkraftwerke durchgefuehrt worden. Diese Analysen basierten in der Regel auf dem aktuellen deutschen PSA-Leitfaden bzw. einem frueheren Entwurf. Ein Vergleich dieser PSA zeigt Unterschiede in den Ergebnissen, die in diesem Beitrag diskutiert werden. Erfahrungen und Erkenntnisse, die aus diesem Vergleich abgeleitet werden koennen, und weitere Entwicklungen der PSA-Methoden werden beschrieben. (orig.)

Gestion de bibliothèque au niveau de la Faculté de technologie

OpenAIRE

Mekkioui, Nadjet; Belhadj, Fatima Zohra

2014-01-01

Notre projet consiste à développer un logiciel permettant la gestion automatique de la bibliothèque de la Faculté de technologie. Cette automatisation concerne la gestion de prêt d’ouvrages, et ce en utilisant la méthode d'informatisation Merise. Cette dernière permet de concevoir un système d'information pour implanter le logiciel de gestion qui est développé dans un environnement Delphi. Nous avons focalisé notre projet sur la gestion automatique de prêt au niveau de la bibli...

The role of the operations management

International Nuclear Information System (INIS)

Distler, K.

1986-01-01

This lecture gives an overview of the pre-requisites for the operation of a nuclear power plant in the field of organization, staffing, training and the cooperation of the operation team. It points out the needs of setting goals and criteria for the day-to-day operation in relation to the demands of the electrical grid and the possibilities of the plant. Taking Biblis nuclear power plant (two PWR units 1200/1300 MW) as example, the lecture points out the specific tasks of the management for a safe and reliable plant operation. (orig.)

La agricultura en la Biblia

OpenAIRE

Cerrizuela, Edmundo A.

2005-01-01

La Biblia, es el libro que relata el encuentro de Dios con su Pueblo, en el que nos habla de muchas y variadas formas y lo hace a través de los acontecimientos de su epoca. Dentro de su cualidad esencialmente profética, hace referencia a muchas cosas relacionadas con el pensamiento y actividades de su pueblo. En mi carácter de profesional de la Agronomía estimo que las menciones sobre este tema citadas en numerosos capítulos de casi todos los Libros sagrados que constituyen la Bibli...

Análisis y Diseño técnico económico de la Red de Interconexión de las redes en el Campus Girón, Sur, Kennedy y Cayambe de la Universidad Politécnica Salesiana sede Quito

OpenAIRE

Chicaiza Iza, Oscar Patricio; Domínguez Ayala, Juan Carlos

2012-01-01

Interconexión de campus: Universidad Politécnica Salesiana sede Quito. Equipos disponibles para el diseño de red. Metodología. Tipos de estudio. Metodología PPDIOO. Marco Referencial. Marco Teórico. Enterprise Composite Network Model (ECNM). Marco Conceptual. Conceptos Generales. Modelo OSI. el modelo TCP/IP. Protocolo TCP/IP. Pasos para crear el área funcional de frontera de la empresa. Diseño de la solución. Configuraciones de dispositivo de borde. Análisis económico de la solución. Bibli...

Data and results

International Nuclear Information System (INIS)

1980-01-01

In order to assess the radioecological consequences to the environment caused by the discharge of radioactive material at normal operation, taking into account the exposure from other sources of radiation, existing model concepts for calculating the radiation exposure and the relevant assumptions and parameters have to be specialized for the Biblis site. All relevant problems and decisions are discussed in an open manner and the minutes are made available to the public. The substudies investigating the aspects of the atmospheric and the water pathway often have been treated by means of competing models. (RW) [de

The Slovenian bibliography

Directory of Open Access Journals (Sweden)

Lidija Wagner

2000-01-01

Full Text Available The Slovenian bibliography is our national bibliography. We want to show the criteria of the selection of the particular materials, which are included in the Slovenian bibliography. We described the bibliographic description and classification of the records with UDC and the descriptors. The printing and the CD-ROM issues of the Slovenian bibli¬ography are described. We compared UNESCO guidelines for the national bibliography on the field of the selection, bibliographic description and classification, arrangement of the records and the useful of the national bibliography.

Collection development: birth of contemporary foundations

OpenAIRE

Weitzel, Simone da Rocha

2012-01-01

O artigo apresenta o resultado de uma pesquisa cujo objetivo foi identificar as correspondências entre os fundamentos da área hoje denominada de desenvolvimento de coleções e aqueles estabelecidos no século XIX, a fim de reconstruir os principais conceitos, métodos e práticas da área. Propõe um estudo exploratório para viabilizar essa correspondência a partir de oito obras escolhidas de autores europeus do século XIX, a maioria bibliófilos reconhecidos, a saber: Peignot (1823), Namur (1834), ...

Køb af B2B serviceydelser

DEFF Research Database (Denmark)

Grünbaum, Niels Nolsøe; Hollensen, Svend; Andresen, Marc

2011-01-01

I den tidlige B-t-B-købsadfærdslitteratur har man lagt megen vægt på, at købsadfærden i forbindelse med B-t-B-serviceydelser er meget rationel præget. Gennem en større eksplorativ undersøgelse af danske virksomheders indkøb af konsulentydelser inden for hr, har forfatterne fået indblik i de fakto...

Contributions to economical and safe operation of nuclear power plants

International Nuclear Information System (INIS)

Ackermann, G.; Meyer, K.

1989-01-01

Selected results of scientific and technical research works in the Department 'Nuclear Power' of the Zittau Technical University are summarized which have been obtained on behalf of the Kombinat Kernkraftwerke 'Bruno Leuschner' and in conjunction with the education of scientific successors and have been partly adopted in textbooks. Works on improved utilization of nuclear fuel in pressurized water reactors are mentioned which, among other things, are related with the use of stretch-out mode of operation and optimization of nuclear fuel loading sequence. Results of experimental and theoretical investigations on coolant mixing in the reactor core are presented. A complex modelling of the dynamical long-term behaviour of nuclear power plants with pressurized water reactors due to xenon poisoning are briefly described. Finally, some results on noise diagnostics theory of power reactors are summarized. (author)

The hearing. Expectations and communication. Two selected examples are given

International Nuclear Information System (INIS)

Eisenhardt, G.

1980-01-01

The results of the hearings concerning Wyhl and Biblis C show that the basic tendencies can also be found in the analysis of the formal licensing procedure within the ATVfV - Atomrechtliche Verfahrensordnung (an order of the Atomic Energy Law concerning the licensing procedure). The corresponding explanations are formulated in an understandable manner; thus disputes about function and procedure of the hearing are theoretically not to be expected. In practice, however, it is obvious that disputes about the usefulness and purpose of the procedure itself continue to remain the topic of violent controversies during the hearing. (DG) [de

Portable digital reactivity meter for power reactors

Energy Technology Data Exchange (ETDEWEB)

Steffen, G [Nuklear-Ingenieur Service G.m.b.H., Hanau (Germany, F.R.)

1977-07-01

A digital reactivity meter has been developed, which can be used for all kinds of kinetic reactivity measurements in PWR's and BWR's. The input signals may be supplied by standard neutron detectors of the reactor. The hardware configuration consists of a minicomputer with ADC and DAC, a 'Silent' terminal and a high speed paper tape reader/punch. It is easily transportable. The reactivity meter solves the inverse kinetics equations for 6 delayed neutron groups, simultaneously for up to 8 logarithmic or linear neutron flux signals. It has been successfully tested at Biblis A PWR and the KRB BWR.

Nuclear power plant remote monitoring system of Hessen (KFUe Hessen) now fully available

International Nuclear Information System (INIS)

Lettmann, W.; Merkel, M.

1991-01-01

The remote monitoring system for the Biblis nuclear power station has commenced operation in 1990. It is intended to provide the radiological data and other information required by the supervisory Land authority for performing its supervisory functions in accordance with the Atomic Energy Act. The monitoring station records and reports emissions of the reactor station during specified normal operation and as a result of incidents or accidents, measures local dose rates at four measuring stations at the power plant fence, and records the meteorological conditions. The system is explained in detail, including illustration and graphs. (BBR) [de

Non disponible / Not available

OpenAIRE

Frédéric , Pitetti

2004-01-01

Non disponible / Not available; L'article R5015-G du Code de déontologie impose au pharmacien de « faire preuve du même dévouement envers toutes les personnes qui ont recours à son art». Par conséquent, les pharmaciens doivent être capables de s'adapter et de trou ver des solutions pour communiquer avec les personnes étrangères, illettrées, aveugles ou sourdes . Dans cette thèse, nous nous intéressons à la relation de communication entre le pharmacien et le sourd profond .Dans la partie bibli...

Estudio correlacional entre la autoestima y el rendimiento escolar

OpenAIRE

Ávila Vicuña, Alfredo

2015-01-01

La importancia de esta investigación es el evidenciar la influencia de la autoimagen (familiar, corporal y con pares) en el rendimiento escolar de los adolescentes de primeros y segundos de bachillerato del colegio Dr. “Camilo Gallegos” del cantón Biblián. Asimismo, se investigaron los temas relacionados con; el clima afectivo familiar: ¿En cuánto valora la relación con su padre? ¿En cuánto valora la relación con la madre? ¿Le da miedo ser objeto de burlas cuando está con sus familiares?, ¿Le...

Measurement of the ratios of branching fractions B(B0s --> Ds- pi+ pi+ pi-)/B(B0-->D- pi+ pi+ pi-) and B(B0s --> Ds- pi+)/B(B0-->D- pi+).

Science.gov (United States)

Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; Dituro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

2007-02-09

Using 355 pb;{-1} of data collected by the CDF II detector in pp[over ] collisions at sqrt[s]=1.96 TeV at the Fermilab Tevatron, we study the fully reconstructed hadronic decays B_{(s)};{0}-->D_{(s)};{-}pi;{+} and B_{(s)};{0}-->D_{(s)};{-}pi;{+}pi;{+}pi;{-}. We present the first measurement of the ratio of branching fractions B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})/B(B;{0}-->D;{-}pi;{+}pi;{+}pi;{-})=1.05+/-0.10(stat)+/-0.22(syst). We also update our measurement of B(B_{s};{0}-->D_{s};{-}pi;{+})/B(B;{0}-->D;{-}pi;{+}) to 1.13+/-0.08(stat)+/-0.23(syst), improving the statistical uncertainty by more than a factor of 2. We find B(B_{s};{0}-->D_{s};{-}pi;{+})=[3.8+/-0.3(stat)+/-1.3(syst)]x10;{-3} and B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})=[8.4+/-0.8(stat)+/-3.2(syst)]x10;{-3}.

Law concerning water and nuclear power station licensing

International Nuclear Information System (INIS)

Anon.

1985-01-01

The competent water authority, within the purview of the legal provisions concerning water is entitled to define a maximum of radioactive contamination of cooling water taken from and re-fed into the Rhine river, and is entitled to make such limit form part of the permit granted to a nuclear power station (here: Biblis B reactor). This right is not overruled by sections 45, 46 of the Rad. Protection Ordinance which determine dose limits (among others also for radioactivity released through waste water), and which state the competent licensing authority under atomic energy law to be entitled to set higher or lower limits by discretion. The provisions of sections 45 ff Rad. Prot. Ordinance are to be interpreted to mean that since the competent authority in accordance with section 46, sub-sections (2) and (5) Rad. Prot. Ordinance is given the right to define maximum acceptable radioactivity release through water discharge, it many also define the lowest limit of contamination and is hence entitled to declare discharged cooling water not to fall under atomic energy law, but rather under the law relating to water management. (orig.) [de

Stock-taking of the safety design of the nuclear power plant with PWR type Biblis B and the radiation exposure connected with its operation

International Nuclear Information System (INIS)

Drescher, H.P.; Geiser, H.; Roedder, P.; Dagbjartsson, S.; Ernst, H.; Ledermann, H.; Hecke, R. van.

1976-06-01

The study comprises: 1) Environmental pollution due to radioactive emissions; 2) personnel exposure during operation, maintenance, inspection, and repair; 3) environmental pollution due to the closing of the fuel cycle; 4) safety requirements; 5) state of the art of safety design; 6) reliability analysis; 7) the importance of the testability of systems and components relevant for safety. (HP) 891 HP [de

Køb af B-t-B serviceydelser

DEFF Research Database (Denmark)

Hollensen, Svend; Grünbaum, Niels Nolsøe; Andresen, Marc

2011-01-01

Early B2B buying-behavior literature strongly emphasizes the rational aspects of buying behavior in B2B services. Based on a comprehensive exploratory study of Danish companies‟ purchases of HR consulting services, the authors provide insights into the factors that determine how Danish companies...... choose a consulting services supplier. Five hypotheses are developed based on a literature review. The results show that buying behavior is much less rational than has been presumed. For example, it is revealed that a consultant‟s personal relationships to customers can often compensate...

B-tagging in boosted h → b anti b decays

Energy Technology Data Exchange (ETDEWEB)

Jacobs, Ruth; Gaycken, Goetz; Hageboeck, Stephan; Kostyukhin, Vadim; Lenz, Tatjana; Schopf, Elisabeth; Toerne, Eckhard von; Wermes, Norbert [Physikalisches Institut, University of Bonn (Germany)

2015-07-01

The most likely decay channel of the standard model Higgs boson is the decay into a b- and an anti-b-quark. The properties of b-jets formed by the hadronization of b-quarks are essential input variables to all ATLAS h → b anti b analyses. In boosted topologies the performance of standard b-tagging algorithms is diminished due to the merging of close - by jets. The aim of the study presented is the optimization of a b-tagging algorithm for boosted h → b anti b decays using track jets with a smaller than standard cone radius. The study is based on simulated events containing boosted Higgs bosons from the decay of a new heavy gauge boson W{sup '} → Wh. A motivation for the use of track jets for b-tagging is the fact that the reconstructed jet axis for track jets more closely describes the b-hadron flight direction than for calorimeter jets. Using jets with a smaller cone radius allows to resolve topologies where larger radius jets are already merged.

A current perspective on the risk significance of steam explosions

International Nuclear Information System (INIS)

Snyder, A.W.

1982-01-01

The view currently held in the Sandia National Laboratory is that, in the case of a meltdown in the reactor core, the probability of a steam explosion is greater than was estimated in WASH-1400, but that the extent and effect of an explosion will be very much smaller than assumed in WASH-1400. This results in a far smaller total risk with regard to containment. In WASH-1400, a nominal conditional probability of 1% was assumed for a containment rupture in a PWR-type reactor, should a large part of the reactor fuel be subject to meltdown during the course of the accident. The German risk analysis study 'Deutsche Risikostudie Kernkraftwerke' dated 1979 considers an explosion of a size sufficient to represent a threat to containment to be considerably more improbable than was assumed in WASH-1400. (orig./DG) [de

B2B or Not to Be: Does B2B E-Commerce Increase Labour Productivity?

OpenAIRE

Bertschek, Irene; Fryges, Helmut; Kaiser, Ulrich

2004-01-01

We implement an endogeneous switching-regression model for labour productivity and firms' decision to use business-to-business (B2B) e-commerce. Our approach allows B2B usage to affect any parameter of the labour productivity equation and to properly take account of strategic complementarities between the input factors and B2B usage. Empirical evidence from 1,394 German firms shows that firms using B2B e-commerce have a significantly higher output elasticity with respect to ICT-investment and...

Safety culture in nuclear power plants. Proceedings; Sicherheitskultur im Kernkraftwerk. Seminarbericht

Energy Technology Data Exchange (ETDEWEB)

NONE

1994-12-01

As a consequence of the INSAG-4 report on `safety culture`, published by the IAEA in 1991, the Federal Commission for the Safety of Nuclear Power Plants (KSA) decided to hold a one-day seminar as a first step in this field. The KSA is an advisory body of the Federal Government and the Federal Department of Transport and Energy (EVED). It comments on applications for licenses, observes the operation of nuclear power plants, assists with the preparation of regulations, monitors the progress of research in the field of nuclear safety, and makes proposals for research tasks. The objective of this seminar was to familiarise the participants with the principles of `safety culture`, with the experiences made in Switzerland and abroad with existing concepts, as well as to eliminate existing prejudices. The main points dealt with at this seminar were: - safety culture from the point of view of operators, - safety culture from the point of view of the authorities, - safety culture: collaboration between power plants, the authorities and research organisations, - trends and developments in the field of safety culture. Invitations to attend this seminar were extended to the management boards of companies operating Swiss nuclear power plants, and to representatives of the Swiss authorities responsible for the safety of nuclear power plants. All these organisations were represented by a large number of executive and specialist staff. We would like to express our sincerest thanks to the Head of the Federal Department of Transport and Energy for his kind patronage of this seminar. (author) figs., tabs., refs.

Determination of flow times and flow velocities in the upper Rhine river using 3HHO as tracer

International Nuclear Information System (INIS)

Krause, W.J.; Mundschenk, H.

1990-01-01

The behaviour of water bodies of the Upper Rhine river discretely traced with 3 HHO-loaded waste waters from the nuclear power plants of Beznau, Fessenheim, Philippsburg and Biblis was investigated along a distance of nearly 385 km down to Nierstein. The passage of the distinct entrainment charged by different emissions was measured at the sampling points of Bad Saeckingen, Weil, Weisweil, Iffezheim and Nierstein. From these profiles the flow times and flow velocities were calculated for the discharge range from 0.6 to 1.7 MQ (mean discharge), taking the begin, end and duration of the individual releases into account. (orig./HP) [de

B0-anti B0 mixings and rare B-decays

International Nuclear Information System (INIS)

Ali, A.

1992-11-01

I present an update on the Cabibbo-Kobayashi-Maskawa (CKM) matrix elements taking into account the current experimental and theoretical information on weak decays. The resulting fit is combined with the measured value of the B 0 d -anti B 0 d mixing ratio x d and estimates of the pseudoscalar coupling constants to determine the allowed range of the B 0 s -anti B 0 s mixing ration x s in the Standard Model (SM). For the central values of the parameters used we find 8 ≤ x s ≤ 24. Flavour changing neutral current (FCNC) B-decays are briefly reviewed; in particular the role of such decays in determining the CKM matrix elements V td and V ts is emphasized on the example of radiative B-decays, B → (X d + γ) and B → (X s + γ). (orig.)

B physics on the Lattice $\\overline{\\Lambda}$, $\\lambda_{1}$, $\\overline{m}_{b}(\\overline{m}_{b})$, $\\lambda_2$, $B^{0}-\\overline{B}^{0}$ mixing, $f_{B}$ and all that

CERN Document Server

Gimenez, V.; Sachrajda, Christopher T.

1996-01-01

We present a short review of our most recent high statistics lattice determinations in the HQET of the following important parameters in B physics: the B--meson binding energy, $\\overline{\\Lambda}$ and the kinetic energy of the b quark in the B meson, $\\lambda_1$, which due to the presence of power divergences require a non--perturbative renormalization to be defined; the value in the HQET is determined by the matrix element of the chromo--magnetic operator between B meson states, $\\lambda_2$; the B parameter of the $B^{0}$--$\\bar{B}^{0}$ mixing, $B_{B}$, and the decay constant of the B meson, $f_{B}$. All these quantities have been computed using a sample of $600$ gauge field configurations on a $24^{3}\\times 40$ lattice at $\\beta=6.0$. For estimates by combining results from three independent lattice simulations at

Defining B-c, B* and B-phi for YBCO Thin Films

DEFF Research Database (Denmark)

Paturi, Petriina; Irjala, Matti; Abrahamsen, Asger Bech

2009-01-01

of superconducting films. Similarly, the characteristic field, B c, can be obtained from magneto-optical (MO) images from when the flux fronts meet in the middle of the film. The matching field, B phi, at which there is one vortex line per pinning site, is sometimes thought to be the same as B*, but in BaZrO3-doped...... YBa2Cu3O7 films the calculated B phi is much higher than the observed B*. B phi can be determined from angular dependent transport measurements. All of the field values correspond to some special case in the flux pinning in the film and relate to J c. In this work we have determined B c, B* and B phi...

Administrative Court Kassel, judgement of March 4, 1985 (nuclear power station Biblis)

International Nuclear Information System (INIS)

Anon.

1985-01-01

Licences pursuant to the Atomic Energy Act and the production of nuclear energy are not contrary to public order. Persons not having raised objections timely in administrative procedures concerning a nuclear installation, remain excluded from the procedure despite of later substantial arguments. (CW)

Measurement of $R_{b}$ and $B_{r}(b \\to l\

CERN Document Server

Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Baksay, L.; Balandras, A.; Ball, R.C.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Barone, L.; Bartalini, P.; Basile, M.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brigljevic, V.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Busenitz, J.; Button, A.; Cai, X.D.; Campanelli, Mario; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chereau, X.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colijn, A.P.; Colino, N.; Costantini, S.; Cotorobai, F.; Cozzoni, B.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; Della Volpe, D.; Denes, P.; De Notaristefani, F.; De Salvo, A.; Diemoz, M.; van Dierendonck, D.; Di Lodovico, F.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Extermann, P.; Fabre, M.; Faccini, R.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Ferroni, F.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Fredj, L.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kamrad, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, D.H.; Kim, J.K.; Kim, S.C.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopp, A.; Korolko, I.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lassila-Perini, K.; Laurikainen, P.; Lavorato, A.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Leonardi, Emanuele; Levtchenko, P.; Li, C.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Marchesini, P.; Marian, G.; Martin, J.P.; Marzano, F.; Massaro, G.G.G.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Molnar, P.; Monteleoni, B.; Moulik, T.; Muanza, G.S.; Muheim, F.; Muijs, A.J.M.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Oh, Y.D.; Organtini, G.; Ostonen, R.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Pascale, G.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Peach, D.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Produit, N.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; van Rhee, T.; Riemann, S.; Riles, Keith; Robohm, A.; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Rubio, J.A.; Ruschmeier, D.; Rykaczewski, H.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Sarakinos, M.E.; Schafer, C.; Shchegelskii, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Sciarrino, D.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stone, H.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Timmermans, Charles; Ting, S.C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitskii, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Ziegler, F.; Zilizi, G.; Zoller, M.

2000-01-01

We present a combined measurement of $\\Rb = \\Gamma(\\mathrm{Z \\rightarrow b\\overline{b}}) / \\Gamma(\\mathrm{Z} \\rightarrow\\mbox{hadro ns})$ and the semileptonic branching ratio of b quarks in Z decays, $\\Brbl$, using double-tag methods. Two analyses are performed on one million hadronic Z decays collected in 1994 and 1995. The first analysis exploits the capabilities of the silicon microvertex detector. The tagging of b-events is based on the large impact parameter of tracks from weak b-decays with respect to the $\\mathrm{e^+e^-}$ collision point. In the second analysis, a high-$p_t$ lepton tag is used to enhance the b-component in the sample and its momentum spectrum is used to constrain the model dependent uncertainties in the semileptonic b-decay. The analyses are combined in order to provide precise determinations of $\\Rb$ and $\\Brbl$:

Measurements of the $B^+$, $B^0$, $B_s^0$ meson and $\\Lambda_b^0$ baryon lifetimes

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bonis, Isabelle; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dorosz, Piotr; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Fitzpatrick, Conor; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Hafkenscheid, Tom; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Iakovenko, Viktor; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Wallaa; Karacson, Matthias; Karbach, Moritz; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luisier, Johan; Luo, Haofei; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marconi, Umberto; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muryn, Bogdan; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neubert, Sebastian; Neufeld, Niko; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pavel-Nicorescu, Carmen; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Pessina, Gianluigi; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Polok, Grzegorz; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redford, Sophie; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teodorescu, Eliza; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Webber, Adam Dane; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiechczynski, Jaroslaw; Wiedner, Dirk; Wiggers, Leo; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-01-01

Measurements of $b$-hadron lifetimes are reported using $pp$ collision data, corresponding to an integrated luminosity of 1.0fb$^{-1}$, collected by the LHCb detector at a centre-of-mass energy of $7$Tev. Using the exclusive decays $B^+\\to J/\\psi K^+$, $B^0\\to J/\\psi K^*(892)^0$, $B^0\\to J/\\psi K^0_{\\rm S}$, $\\Lambda_b^0\\to J/\\psi \\Lambda$ and $B^0_s\\to J/\\psi \\phi$ the average decay times in these modes are measured to be $\\tau_{B^+\\to J/\\psi K^+}$ = $1.637 \\pm$ 0.004 $\\pm$ 0.003 ps, $\\tau_{B^0\\to J/\\psi K^*(892)^0}$ = $1.524 \\pm$ 0.006 $\\pm$ 0.004 ps, $\\tau_{B^0\\to J/\\psi K^0_{\\rm S}}$ = $1.499 \\pm$ 0.013 $\\pm$ 0.005 ps, $\\tau_{\\Lambda_b^0\\to J/\\psi \\Lambda}$ = $1.415 \\pm$ 0.027 $\\pm$ 0.006 ps and $\\tau_{B^0_s\\to J/\\psi \\phi}$ = $1.480 \\pm$ 0.011 $\\pm$ 0.005 ps, where the first uncertainty is statistical and the second is systematic. These represent the most precise lifetime measurements in these decay modes. In addition, ratios of these lifetimes, and the ratio of the decay-width difference, $\\Delta\\Gamma_...

Measurements of the B+, B-0, B-s(0) meson and Lambda(0)(b) baryon lifetimes

NARCIS (Netherlands)

Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Onderwater, G.; Pellegrino, A.

2014-01-01

Measurements of b-hadron lifetimes are reported using p p collision data, corresponding to an integrated luminosity of 1.0 fb(-1), collected by the LHCb detector at a centre-of-mass energy of 7 TeV. Using the exclusive decays B+ -> J/psi K+, B-0 -> J/psi K* (892)(0), B-0 -> J/K-s(0), Lambda(0)(b) ->

B/B-bar flavour tagging and doubly charmed B decays in ALEPH

International Nuclear Information System (INIS)

Barate, R.

1999-01-01

This contribution concerns three contributed papers that share the common feature of analysing fully- (or almost fully-) reconstructed B decays coming from a sample of four million hadronic Z decays collected with the ALEPH detector at LEP. In the first paper, 404 charged and neutral B mesons decaying in standard modes are fully reconstructed and used to look for resonant structure in the Bπ ± system. In the framework of Heavy Quark Symmetry (HQS), the mass of the B 2 * state and the relative production rate of the B ** system are measured. In the same sample of B mesons, significant Bπ ± charge-flavour correlations are observed. In the second paper, a search for doubly-charmed B decays with both charmed mesons reconstructed is performed. A clear signal is observed in the channels b → D S D-bar(X) and b → DD-bar(X) providing the first direct evidence for doubly-charmed b decays involving no D S production. Evidence for associated K S 0 and K ± production in the decays B → DD-bar(X) is also presented and some candidates for completely reconstructed B meson decays B → D S D-bar(nπ), B → DD-bar K S 0 and B → DD-bar K ± are observed. Furthermore, candidates for the two-body Cabibbo suppressed decays B 0 → D *- D *+ and B - → D (*)0 D (*)- are also observed. One B S 0 → D S + D S - event is reconstructed, which can be only the short-lived CP even eigenstate. In the third paper, the B S decay to D S (*)+ D S (*)- (X) is observed, tagging the final state with two φ in the same hemisphere. It corresponds mostly to the short-lived CP even eigenstate. A preliminary value of the B S short lifetime is obtained. (author)

Expert report of ENSI on the request of KKN AG for a general license - Project 'New nuclear power plant Niederamt'; Gutachten des ENSI zum Rahmenbewilligungsgesuch der KKN AG. Neubauprojekt Kernkraftwerk Niederamt

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-09-15

The 'Kernkraftwerk Niederamt AG' (KKN) Company submitted to the Swiss Federal Inspectorate of Nuclear Safety (ENSI) a request for a general license for a new power plant to be built near to the Goesgen power plant. According to the law, all damage risks with a probability higher than 10{sup -4}/a must be taken into account through protection measures. The considered risks concern the power plant itself as well as the population in the neighbourhood and the environment. The purpose of the general license is to demonstrate that the site chosen for the foreseen power plant is acceptable and that the risks can be counteracted through adequate measures. The buildings of the power plant and their partition over the two banks of the Aare River are briefly described. The reactor is a Light Water Reactor of third generation with a maximum thermal power of 5.8 GW{sub th}. The main cooling is provided by a hybrid system of water evaporation and air heating, what reduces the plume at the exit of the cooling tower. First, it is demonstrated that, in the case of a very unlikely severe accident in the power plant, the people in the neighbourhood can be evacuated quickly. Then, numerous types of possible accidents in the neighbourhood of the power plant are analyzed in order to settle their possible negative influence on the operation of the power plant: bursting of gas containers on the neighbouring roads and railways, fires of all types of hydrocarbons, air pollution through chloride gas, etc. The check by ENSI of the KKN studies on the potential danger for the power plant through neighbouring industrial plants, roads or railways demonstrated that none of the considered accidents presents an unacceptable risk for the power plant: on the one hand, these plants are located too far from the power plant, so that a sensible injury to the power plant safety can be excluded; on the other, the protection of the power plant can be guaranteed through appropriate technical

Marketing Optimization for B2B Market

OpenAIRE

Kaynova Tatyana V.

2012-01-01

The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

A publicação de periódicos científicos digitais

Directory of Open Access Journals (Sweden)

Rosângela Schwarz Rodrigues

2011-05-01

Portugal (REDALYC  e pelo Sistema Regional de Información para las Revistas Científicas de América Latina, el Caribe, España y Portugal (LATINDEX, passando a ser espelhada por esses diretórios tendo, adicionalmente, uma fonte a mais para o acesso a seus conteúdos. Na avaliação de periódicos nacionais, obteve reconhecimento pelo QUALIS/CAPES (http://qualis.capes.gov.br/webqualis/, sendo avaliada como de nível NACIONAL “A”; em 2003 e na categoria B2 em 2009 na área de Ciências Sociais Aplicadas. Em 2007, a equipe editorial da Encontros Bibli lidera a criação do Portal de Periódicos na UFSC e migra para a plataforma SEER.  Em 2009, a gestão do Portal passa a ser de responsabilidade da Biblioteca Central da UFSC, porém, é mantido um membro da equipe editorial da Encontros Bibli, como membro permanente no Conselho Editorial do Portal de Periódicos da UFSC. Ao dar sequencia às atividades relacionadas ao Acesso Aberto e com o intuito de acompanhar a evolução tecnológica, editorial e de gestão de periódicos, a equipe editorial da revista cria a Incubadora de Periódicos da UFSC com o objetivo de contribuir para a criação, migração e gestão de novos periódicos e para o desenvolvimento de pesquisas sobre publicação científica digital. A partir do fascículo 30, de outubro de 2010, a Encontros Bibli passa a contar com o identificador Digital Object Identifier (DOI em seus artigos e editorial como prática do Portal de Periódicos para todas as revistas da UFSC. Nos artigos dos fascículos anteriores a 2010, o número do DOI será incluído paulatinamente. Os indicadores da revista até abril de 2011 apresentam: 1175 usuários cadastrados e 950 leitores. A média de acessos mensal é de 9.000 visitantes únicos, destacamos o acesso anual durante os últimos anos ultrapassando a marca de cem mil acessos únicos anuais e salientamos a participação de colegas de diversos países. Para esta edição expressamos nossos agradecimentos em primeiro

A publicação de periódicos científicos digitais

Directory of Open Access Journals (Sweden)

Rosângela Schwarz Rodrigues

2011-05-01

ón para las Revistas Científicas de América Latina, el Caribe, España y Portugal (LATINDEX, passando a ser espelhada por esses diretórios tendo, adicionalmente, uma fonte a mais para o acesso a seus conteúdos.Na avaliação de periódicos nacionais, obteve reconhecimento pelo QUALIS/CAPES (http://qualis.capes.gov.br/webqualis/, sendo avaliada como de nível NACIONAL “A”; em 2003 e na categoria B2 em 2009 na área de Ciências Sociais Aplicadas.Em 2007, a equipe editorial da Encontros Bibli lidera a criação do Portal de Periódicos na UFSC e migra para a plataforma SEER. Em 2009, a gestão do Portal passa a ser de responsabilidade da Biblioteca Central da UFSC, porém, é mantido um membro da equipe editorial da Encontros Bibli, como membro permanente no Conselho Editorial do Portal de Periódicos da UFSC.Ao dar sequencia às atividades relacionadas ao Acesso Aberto e com o intuito de acompanhar a evolução tecnológica, editorial e de gestão de periódicos, a equipe editorial da revista cria a Incubadora de Periódicos da UFSC com o objetivo de contribuir para a criação, migração e gestão de novos periódicos e para o desenvolvimento de pesquisas sobre publicação científica digital.A partir do fascículo 30, de outubro de 2010, a Encontros Bibli passa a contar com o identificador Digital Object Identifier (DOI em seus artigos e editorial como prática do Portal de Periódicos para todas as revistas da UFSC. Nos artigos dos fascículos anteriores a 2010, o número do DOI será incluído paulatinamente.Os indicadores da revista até abril de 2011 apresentam: 1175 usuários cadastrados e 950 leitores. A média de acessos mensal é de 9.000 visitantes únicos, destacamos o acesso anual durante os últimos anos ultrapassando a marca de cem mil acessos únicos anuais e salientamos a participação de colegas de diversos países.Para esta edição expressamos nossos agradecimentos em primeiro lugar aos professores, alunos e pesquisadores que consideraram

B2B myynnin johtaminen ravintola-alalla

OpenAIRE

Pajari, Katja

2014-01-01

Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

Measurement of the Λ(b)(0), Ξ (b)(-), and Ω(b((-) Baryon masses.

Science.gov (United States)

Aaij, R; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2013-05-03

Bottom baryons decaying to a J/ψ meson and a hyperon are reconstructed using 1.0 fb(-1) of data collected in 2011 with the LHCb detector. Significant Λ(b)(0) → J/ψΛ, Ξ(b((-) → J/ψΞ(-) and Ω(b)(-) → J/ψΩ(-) signals are observed and the corresponding masses are measured to be M(Λ(b)(0))=5619.53 ± 0.13(stat.) ± 0.45(syst.) MeV/c(2), M(Ξ(b)(-)) = 5795.8 ± 0.9(stat.) ± 0.4(syst.) MeV/c(2), M(Ω(b)(-)) = 6046.0 ± 2.2(stat.) ± 0.5(syst.) MeV/c(2) , while the differences with respect to the Λ(b)(0) mass are M(Ξ(b)(-))-M(Λ(b)(0))=176.2 ± 0.9(stat.) ± 0.1(syst.) MeV/c(2), M(Ω(b)(-))-M(Λ(b)(0))=426.4 ± 2.2(stat.) ± 0.4(syst.) MeV/c(2). These are the most precise mass measurements of the Λ(b)(0), Ξ(b)(-) and Ω(b)(-) baryons to date. Averaging the above Λ(b)(0) mass measurement with that published by LHCb using 35 pb(-1) of data collected in 2010 yields M(Λ(b)(0)) = 5619.44 ± 0.13(stat.)± 0.38(syst.) MeV/c(2).

Measurement of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryon masses

CERN Document Server

Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2013-01-01

Bottom baryons decaying to a $J/\\psi$ meson and a hyperon are reconstructed using $\\rm 1.0~fb^{-1}$ of data collected in 2011 with the LHCb detector. Significant $\\Lambda_b^0 \\rightarrow J/\\psi \\Lambda$, $\\Xi_b^-\\rightarrow J/\\psi \\Xi^-$ and $\\Omega_b^- \\rightarrow J/\\psi \\Omega^-$ signals are observed and the corresponding masses are measured to be \\begin{eqnarray} M(\\Lambda_b^0) = 5619.53 \\pm 0.13 (stat) \\pm 0.45 (syst) MeV/c^2, \\cr M(\\Xi_b^-) = 5795.8 \\pm 0.9 (stat) \\pm 0.4 (syst) MeV/c^2, \\cr M(\\Omega_b^-) = 6046.0 \\pm 2.2 (stat) \\pm 0.5 (syst) MeV/c^2,\\end{eqnarray} while the diffierences with respect to the $\\Lambda_b^0$ mass are \\begin{eqnarray} M(\\Xi_b^-) - M(\\Lambda_b^0) = 176.2 \\pm 0.9 (stat) \\pm 0.1 (syst) MeV/c^2, \\cr M(\\Omega_b^-) - M(\\Lambda_b^0) = 426.4 \\pm 2.2 (stat) \\pm 0.4 (syst) MeV/c^2.\\end{eqnarray} These are the most precise mass measurements of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryons to date. Averaging the above $\\Lambda_b^0$ mass measurement with that published...

Pyrazolones and amides from b-alkoxy- and b-alkylthio-b-chloroacryloyl chlorides

NARCIS (Netherlands)

Bosch, G.; Bos, H.J.T.; Arens, J.F.

1971-01-01

Conversion of b-alkoxy- and b-alkylthio-b-chloroacryloyl chlorides R1YCCl:CRCOCl (R = H, alkyl, R1 = alkyl and Y = O or S) with amines R2NH2 yields the expected carboxamides R1YCCl:CRCONHR2. Phenylhydrazine reacts with b-alkoxy-b-chloroacryloyl chlorides to give a mixt. of

Hybrid cooling tower Neckarwestheim 2 cooling function, emission, plume dispersion

International Nuclear Information System (INIS)

Braeuning, G.; Ernst, G.; Maeule, R.; Necker, P.

1990-01-01

The fan-assisted hybrid cooling tower of the 1300 MW power plant Gemeinschafts-Kernkraftwerk Neckarwestheim 2 was designed and constructed based on results from theoretical and experimental studies and experiences from a smaller prototype. The wet part acts in counterflow. The dry part is arranged above the wet part. Each part contains 44 fans. Special attention was payed to the ducts which mix the dry into the wet plume. The cooling function and state, mass flow and contents of the emission were measured. The dispersion of the plume in the atmosphere was observed. The central results are presented in this paper. The cooling function corresponds to the predictions. The content of drifted cooling water in the plume is extremely low. The high velocity of the plume in the exit causes an undisturbed flow into the atmosphere. The hybrid operation reduces visible plumes strongly, especially in warmer and drier ambient air

Evidos: optimisation of individual monitoring in mixed neutron/photon fields at workplaces of the nuclear fuel cycle

International Nuclear Information System (INIS)

Luszik-Bhadra, M.; Reginatto, M.; Schuhmacher, H.; Lacoste, V.; Muller, M.; Boschung, M.; Fiechtner, A.; Coeck, M.; Vanhavere, F.; Curzio, G.; D'errico, F.; Kyllonen, J.E.; Lindborg, L.; Molinos, C.; Tanner, R.; Derdau, D.; Lahaye, Th.

2005-01-01

Within its 5. Framework Programme, the EC is funding the project EVIDOS ('Evaluation of Individual Dosimetry in Mixed Neutron and Photon Radiation Fields'). The aim of this project is the optimisation of individual monitoring at workplaces of the nuclear fuel cycle with special regard to neutrons. Various dosemeters for mixed field application - passive and new electronic devices - are tested in selected workplace fields in nuclear installations in Europe. The fields are characterised using a series of spectrometers that provide the energy distribution of neutron fluence (Bonner spheres) and newly developed devices that provide the energy and directional distribution of the neutron fluence. Results from the first measurement campaign, carried out in simulated workplace fields (IRSN, Cadarache. France), and those of a second measurement campaign, carried out at workplaces at a boiling water reactor and at a storage cask with used fuel elements (Kernkraftwerk Kriimmel, Germany), are described. (authors)

TRUST IN B2B E-MARKETPLACES

Directory of Open Access Journals (Sweden)

SEBASTIAN KOT

2011-01-01

Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

Ab initio investigation of B16(GeS), B27(FeB) and B33(CrB/TlI) phases of lead chalcogenides

International Nuclear Information System (INIS)

Demiray, Ferhat; Berber, Savas

2013-01-01

We report an ab initio investigation of the intermediate phases occurring in the pressure-induced B1–B2 phase transitions of lead chalcogenides PbX (X = S, Se and Te). The equilibrium lattice constants and atomic positions were calculated without symmetry constraints. The total energies of the optimized structures under pressure were obtained to determine the structures of possible intermediate phases and transitions between these structures. PbTe prefers to be in the B27 structure in the whole transition pressure range while the intermediate phase of PbSe is B27 at lower pressures and becomes B16/B33 at ≈5 GPa. Our results help in understanding the difficulties in experimental investigations of the intermediate phase of PbSe. The intermediate phase of PbS is in the B27 structure at lower pressure values, but it should be in the B16/B33 structure with a transition around ≈6 GPa. Our finding that it is possible to find the intermediate structures of PbS and PbSe in B27 and B16/B33 while PbTe adopts only B27 as the intermediate structure is in good agreement with previous research. The electronic structures of the three structures remain semi-conducting in their calculated optimized structures and the fundamental electronic energy gap decreases with increasing pressure. The projected density of states indicates that the bonding between the Pb atom and the chalcogen has both covalent and ionic contributions with a charge transfer from the Pb atom to the chalcogen. (paper)

Serogroup B Meningococcal Vaccine (MenB)

Science.gov (United States)

What are meningococcal group B vaccines?Two serogroup B meningococcal group B vaccines (Bexsero and Trumenba) have been licensed by the Food and Drug ... Who should not get meningococcal group B vaccine or should wait?Tell the person ... you the vaccine:If you have any severe, life-threatening allergies. ...

E+e- linear collider B-barB factory for rare B decay studies

International Nuclear Information System (INIS)

Cline, D.B.

1987-01-01

We outline the physics goals of a B-barB factory to produce greater than 10 8 B 0 /sub d/, B/sup +- / per year. Emphasis is placed on the search for large CP violating effects in rare B decays. An e + e - linear collider is proposed for the B-barB factory and a preliminary estimate of the parameters of the machine that might reach L = 10 34 cm -2 sec -1 is given

Short syntheses of enantiopure calystegine B-2, B-3, and B-4

DEFF Research Database (Denmark)

Skaanderup, Philip Robert; Madsen, Robert

2001-01-01

Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

EDUCAÇÃO AMBIENTAL: PESQUISA BIBLIOGRÁFICA UTILIZANDO PORTAL CAPES

Directory of Open Access Journals (Sweden)

Eveline Pinheiro Beserra

2009-01-01

Full Text Available La salud ambiental es un asunto importante que debe ser discutido, ya que se relaciona con el bienestar humano. El objetivo fue investigar la temática sobre salud ambiental en las disertaciones y tesis brasileñas. Se trata de una investigación bibliOgráfica realizada con ayuda de los resúmenes disponibles en la base de datos portal capes tesis, que utilizó como asunto para la búsqueda: Educación Ambiental, medio ambiente y residuos sólidos, en la cual se encontró un total de 60 producciones entre el período de 1999 a 2006. Se constató que hubo un crecimiento del número de producciones sobre esa temática, siendo el área de Ciencias Exactas y de la Tierra la más sensibilizada por el tema; sin embargo, los estudios fueron realizados en mayor cantidad en el máster, con la intención de conocer/diagnosticar la realidad. En relación a la implementación educativa, se observaron pocos estudios con ese objetivo. Se concluye, consecuentemente, que hay necesidad de elaborar investigaciones que conciban a la educación ambiental como foco de intervención.

REBEKA bundle experiments

International Nuclear Information System (INIS)

Wiehr, K.

1988-05-01

This report is a summary of experimental investigations describing the fuel rod behavior in the refilling and reflooding phase of a loss-of-coolant accident of a PWR. The experiments were performed with 5x5 and 7x7 rod bundles, using indirectly electrically heated fuel rod simulators of full length with original PWR-KWU-geometry, original grid spacers and Zircaloy-4-claddings (Type Biblis B). The fuel rod simulators showed a cosine shaped axial power profile in 7 steps and continuous, respectively. The results describe the influence of the different parameters such as bundle size on the maximum coolant channel blockage, that of the cooling on the size of the circumferential strain of the cladding (azimuthal temperature distribution) a cold control rod guide thimble and the flow direction (axial temperature distribution) on the resulting coolant channel blockage. The rewetting behavior of different fuel rod simulators including ballooned and burst Zircaloy claddings is discussed as well as the influence of thermocouples on the cladding temperature history and the rewetting behavior. All results prove the coolability of a PWR in the case of a LOCA. Therefore, it can be concluded that the ECC-criteria established by licensing authorities can be fulfilled. (orig./HP) [de

Structural, mechanical, and electronic properties of TaB2, TaB, IrB2, and IrB: First-principle calculations

International Nuclear Information System (INIS)

Zhao Wenjie; Wang Yuanxu

2009-01-01

First-principle calculations were performed to investigate the structural, elastic, and electronic properties of TaB 2 , TaB, IrB 2 , and IrB. The calculated equilibrium structural parameters, shear modulus, and Young's modulus of TaB 2 are well consistent with the available experimental data, and TaB 2 with P6/mmm space group has stronger directional bonding between ions than WB 2 , OsB 2 , IrN 2 , and PtN 2 . For TaB 2 , the hexagonal P6/mmm structure is more stable than the orthorhombic Pmmn one, while for IrB 2 the orthorhombic Pmmn structure is the most stable one. The high shear modulus of P6/mmm phase TaB 2 is mainly due to the strong covalent π-bonding of B-hexagon in the (0001) plane. Such a B-hexagon network can strongly resist against an applied [112-bar0] (0001) shear deformation. Correlation between the hardness and the elastic constants of TaB 2 was discussed. The band structure shows that P6/mmm phase TaB 2 and Pmmn phase IrB 2 are both metallic. The calculations show that both TaB and IrB are elastically stable with the hexagonal P6 3 /mmc structure. - Elastic constant c 44 of TaB 2 is calculated to be 235 GPa. This value is exceptionally high, exceeding those of WB 2 , OsB 2 , WB 4 , OsN 2 , IrN 2 , and PtN 2 .

B(H) B(H) ⊗ B(H)

Indian Academy of Sciences (India)

[8] Lance C, On nuclear C∗. -algebras. J. Funct. Anal. 12 (1973) 157–176. [9] Ozawa N, An application of expanders to B(l2)⊗B(l2), J. Funct. Anal. 198 (2003) 499–. 510. [10] Pisier G, Introduction to operator space theory, London Mathematical Society Lecture. Note Series 294, (Cambridge: Cambridge University Press) ...

Rare B decays at B factories

International Nuclear Information System (INIS)

Trabelsi, Karim

2010-01-01

Radiative and Electroweak Penguin Decays are Flavor Changing Neutral Currents (FCNC) occurring in the Standard Model only at the loop level. They are characterized by high sensitivity to New Physics (they can appear in the loop with size comparable to leading SM contributions) and they are Complementary to the direct production of new particles expected at LHC. Huge datasets collected at the two B- factories, BaBar and Belle, have made it possible to explore precisely these decays in exclusive channels and inclusive measurements. b →sγ, b→dγ, b→s l + l - , B + →τν, B→Dτν etc measured provide tests of SM predictions and interesting BSM constraints: Charged Higgs bounds from b →sγ, B + →τν, B + →Dτν; Constraints on Wilson coefficients C 7 , C 9 and C 10 ; and Constraints on |V td |/|V ts |. They provide interesting signatures: B(B + →τ + ν) direct measurement versus CKM fit; and large forward-backward asymmetry of K* l + l - . Final Belle/BaBar data samples are yet to be analyzed and even more interesting results are expected at Super B factories with two orders of magnitude larger data samples

Bibliofilia. De las notas sobre El Quijote y otras consideraciones

Directory of Open Access Journals (Sweden)

Nelson Nicholls Santacoloma

1966-03-01

Full Text Available Después de considerar cuan grande es el número de tomos incompletos que se encuentran por ahí, a cada uno de los cuales cabe muy bien la denominación de libro expósito según lo dicho a nosotros por don Luis Villagómez en pasada oportunidad, no hemos resistido la tentación de averiguar con el devoto bibliófilo por la existencia de otros medios más, de aquellos que él propone para eliminar tan grave calamidad como es la de no poder reunir una obra completa especialmente cuando se trata de alguna vieja e inhallable edición.

Proyecto Turístico de Cabañas de Bajo Impacto Ambiental en la Paz Km70

OpenAIRE

Quito, Natali

2015-01-01

El método que servirá de base para la realización del presente proyecto turístico de “Cabañas de Bajo Impacto Ambiental en la Paz Km70”, es el inductivo, por cuanto se efectuará los análisis de los temas mencionados en el esquema de contenidos, también me apoyaré en la investigación exploratoria de campo debido a que se deben realizar visitas al lugar, ayudándome en las técnicas de investigación como son: observación, entrevistas, grupos focales, así también se empleará la investigación bibli...

Recommendation for a resolution and report of 2. Bundestag committee of investigation according to section 44 of Basic Law concerning resolutions of the Bundestag of January 21, 1988 according to the motions of the parliamentary parties of CDU/CSU and FDP - BT publication 11/1680 - setting up of a committee of investigation of the parliamentary party of SPD - BT publication 11/1683 (neu) - setting up of a committee of investigation and concerning resolution of January 25, 1989 according to the motions of parliamentary parties of CDU/CSU, SPD, FDP and parliamentary party of the Greens - BT publication 11/3911 - extension of the scope of the inquiry for the 2. committee of investigation. Recommendation for a resolution

International Nuclear Information System (INIS)

1990-01-01

The final report of the Bundestag's 'Transnuklear' Committee, including annexes and deviating reports and assessments by the reporters of the SPD and the Greens comprises 1420 pages. It is divided into: Setting up the committee and course of the procedure; determination of state of affairs: international nuclear material safeguards - physical protection of nuclear material - drums - bribes - nuclear exports - examination of the suspicion of proliferation of January 1988 - the special incidents on 16./17. December 1987 in Biblis A; assessment of investigation results with recommendations. Considering the consequences for the peaceful uses of nuclear energy, the committee could not find grounds which would make it necessary, or just only sensible, to do without this source of energy. (HSCH) [de

RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets

Directory of Open Access Journals (Sweden)

SOTE VLADIMIROV

2005-10-01

Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanol–water (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.

Identification of four novel HLA-B alleles, B*1590, B*1591, B*2726, and B*4705, from an East African population by high-resolution sequence-based typing.

Science.gov (United States)

Luo, M; Mao, X; Plummer, F A

2005-02-01

We report here four novel HLA-B alleles, B*1590, B*1591, B*2726, and B*4705, identified from an East African population during sequence-based HLA-B typing. The novel alleles were confirmed by sequencing two separate polymerase chain reaction products, and by molecular cloning and sequencing multiple clones. B*1590 is identical to B*1510 at exon 2 and exon 3, except for a difference (GCCGTC) at codon 158. Sequence differences at codon 152 (GAGGTG) and codon 167 (TGGTCG) differentiate B*1591 from B*1503 at exon 3. B*2726 is identical to B*2708 at exon 2 and exon 3, except for a difference (AAGCAG) at codon 70. B*4705 was identified in three Kenyan women. The allele is identical to B*47010101/02 at exon 2 and exon 3, except for differences at codon 97 (AGGAAT) and codon 99 (TTTTAT). These new alleles have been named by the WHO Nomenclature Committee. Identification of these novel HLA-B alleles reflects the genetic diversity of this East African population.

B2B oriented on-line applications generator

OpenAIRE

Vintilă Bogdan-Cătălin

2008-01-01

B2B applications are presented. Quality characteristics of B2B applications are defined. B2B application structure is defined. The application for contracts is developed. The advantages are identified.

LHCb: Measurement of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryon masses

CERN Multimedia

Märki, R

2013-01-01

Mass measurements of $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ at LHCb using 1~fb$^{-1}$ of data collected in 2011, reconstructing $\\Lambda_b^0 \\rightarrow J/\\psi \\Lambda$, $\\Xi_b^- \\rightarrow J/\\psi \\Xi^-$ and $\\Omega_b^- \\rightarrow J/\\psi \\Omega^-$.

10B-NMR determination of 10B-BPA, 10B-BPA–fructose complex and total 10B in blood for BNCT

International Nuclear Information System (INIS)

Yoshino, K.; Yabe, T.; Hattori, T.; Saito, K.; Ishikawa, A.; Ohki, H.

2014-01-01

First spontaneous, noninvasive determination method of 10 B-BPA, 10 B-BPA–fructose complex, and total 10 B in blood is described. 10 B-NMR measurement with 100,000 FT accumulation enables us to obtain the result within 100 min/sample. The detection limits for the simultaneous analysis were 3 ppm, 3 ppm and 6 ppm for 10 B-BPA, 10 B-BPA–fructose complex and total 10 B respectively in this study. By this method, we can actually discuss behavior of the 10 B-BPA–fructose complex in blood. - Highlights: • First 10 B-NMR determination of 10 B-BPA and 10 B-BPA–fructose complex in blood. • Total 10 B concentration in blood could be obtained by this method • The detection limit was 3 ppm for total 10 B

Hepatitis B Foundation Newsletter: B Informed

Science.gov (United States)

... Clinical Trials Physician Directory HBV Meeting What Is Hepatitis B? What Is Hepatitis B? The ABCs of Viral Hepatitis Liver Cancer and Hepatitis B Hepatitis Delta Coinfection Hepatitis C Coinfection HIV/AIDS ...

Measurement of the ratio B(B-→D0K-)/B(B-→D0π-) and of the CP asymmetry of B-→DCP+0K- decays

International Nuclear Information System (INIS)

Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; Grauges-Pous, E.; Palano, A.; Pompili, A.; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; Eigen, G.; Ofte, I.; Stugu, B.

2005-01-01

We study the decays B - →D 0 π - and B - →D 0 K - , where the D 0 decays into D 0 π 0 , with the D 0 reconstructed in the CP-even (CP+) eigenstates K - K + and π - π + and in the (non-CP) channels K - π + , K - π + π + π - , and K - π + π 0 . Using a sample of about 123x10 6 BB pairs, we measure the ratios of decay rates R non-CP ≡ (B(B - →D non-CP 0 K - )/B(B - →D non-CP 0 π - ))=0.0813±0.0040(stat) -0.0031 +0.0042 (syst), and provide the first measurements of R CP+ ≡ (B(B - →D CP+ 0 K - )/B(B - →D CP+ 0 π - ))=0.086±0.021(stat)±0.007(syst), and of the CP asymmetry A CP+ ≡ (B(B - →D CP+ 0 K - )-B(B + →D CP+ 0 K + )/B(B - →D CP+ 0 K - )+B(B + →D CP+ 0 K + ))=-0.10±0.23 (stat) -0.04 +0.03 (syst).

B Vitamins

Science.gov (United States)

The B vitamins are B1 (thiamine) B2 (riboflavin) B3 (niacin) B5 (pantothenic acid) B6 B7 (biotin) B12 Folic acid These ... help form red blood cells. You can get B vitamins from proteins such as fish, poultry, meat, eggs, ...

32 CFR Attachment B to Subpart B... - Standard B-Single Scope Background Investigation (SSBI)

Science.gov (United States)

2010-07-01

... (SSBI) B Attachment B to Subpart B of Part 147 National Defense Department of Defense OFFICE OF THE... FOR ACCESS TO CLASSIFIED INFORMATION Investigative Standards Pt. 147, Subpt. B, Att. B Attachment B to... Place of Birth: Corroboration of date and place of birth through a check of appropriate documentation; a...

Measurement of sigma Lambda b0/sigma B0 x B(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-) in pp collisions at square root s=1.96 TeV.

Science.gov (United States)

Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Le, Y; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tseng, J; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

2007-03-23

We present the first observation of the baryon decay Lambda b0-->Lambda c+pi- followed by Lambda c+-->pK-pi+ in 106 pb-1 pp collisions at square root s=1.96 TeV in the CDF experiment. In order to reduce systematic error, the measured rate for Lambda b0 decay is normalized to the kinematically similar meson decay B0-->D+pi- followed by D+-->pi+K-pi+. We report the ratio of production cross sections (sigma) times the ratio of branching fractions (B) for the momentum region integrated above pT>6 GeV/c and pseudorapidity range |eta|Lambda b0X)/sigma(pp-->B0X)xB(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-)=0.82+/-0.08(stat)+/-0.11(syst)+/-0.22[B(Lambda c+-->pK-pi+)].

B11 NMR in the layered diborides OsB2 and RuB2

Science.gov (United States)

Suh, B. J.; Zong, X.; Singh, Y.; Niazi, A.; Johnston, D. C.

2007-10-01

B11 nuclear magnetic resonance (NMR) measurements have been performed on B11 enriched OsB2 and RuB2 polycrystalline powder samples in an external field of 4.7T and in the temperature range, 4.2KOsB2 and RuB2 , respectively. The experimental results indicate that a p character dominates the conduction electron wave function at the B site with a negligibly small s character in both compounds.

Los destructivos B&B

Directory of Open Access Journals (Sweden)

Daniel López

2015-01-01

Full Text Available En los últimos años varios dibujos animados para jóvenes han cautivado a los mayores por la temática que tratan. Ese es el caso de los Simpson o de Vida de Perros, que son fiel representación de la sociedad norteamericana. Ahora se suma a este fenómeno el dúo juvenil integrado por los destructivos BEAVIS & BUTT HEAD -B&B- jóvenes desempleados piromaniáticos cuyas vidas están marcadas por sus locuras, el amor a la música heavy metal, viven en una zona suburbana y retratan fielmente a la sociedad estadounidense. La exhibición de esta serie en América Latina es tomada como otra forma de penetración cultural norteamericana, son productos de mala calidad que nada tienen que ver con nuestra manera de ser, pero el marketing se impone y muy posiblemente en poco tiempo los B&B se impondrá como los Simpson.

Searches for Charmless Decays B0 --> eta omega, B0 --> eta K0, B+ --> eta rho+, and B+ --> eta' pi+

International Nuclear Information System (INIS)

Aubert, B

2004-01-01

The authors report results for measurements of the decay branching fractions of B 0 to the charmless final states ηω and ηK 0 , and of B + to ηρ + and η'π + . None of these decays have been observed definitively. Measurements of the related decays B + --> ηK + , B + --> ηπ + , and B --> η'K were published recently. Charmless decays with kaons are usually expected to be dominated by b --> s loop (''penguin'') transitions, while b --> u tree transitions are typically larger for the decays with pions and ρ mesons. However the B --> ηK decays are especially interesting since they are suppressed relative to the abundant B --> η'K decays due to destructive interference between two penguin amplitudes. The CKM-suppressed b --> u amplitudes may interfere significantly with penguin amplitudes, possibly leading to large direct CP violation in B + --> ηρ + and B + --> η'π + ; numerical estimates are available in a few cases. The authors search for such direct CP violation by measuring the charge asymmetry A ch (equivalent t o) (Γ - - Γ + )/(Γ - + Γ + ) in the rates Γ ± = Γ(B ± --> f ± ), for each observed charged final state f ± . Charmless B decays are becoming useful to test the accuracy of theoretical predictions. Phenomenological fits to the branching fractions and charge asymmetries can be used to understand the importance of tree and penguin contributions and may provide sensitivity to the CKM angle γ

Resonant Higgs boson pair production in the $hh\\rightarrow b\\bar{b} \\; WW \\rightarrow b\\bar{b} \\ell^+ \

CERN Document Server

Martín Lozano, Víctor; Park, Chan Beom

2015-01-01

Adding a scalar singlet provides one of the simplest extensions of the Standard Model. In this work we briefly review the latest constraints on the mass and mixing of the new Higgs boson and study its production and decay at the LHC. We mainly focus on double Higgs production in the $hh \\rightarrow b \\bar{b} WW \\rightarrow b \\bar{b} \\ell^+ \

Digitaalisen markkinoinnin suunnitelma b2b-yritykselle

OpenAIRE

Harhakoski, Oskari

2011-01-01

Työ käsittelee digitaalisen markkinoinnin suunnitelman tekemistä b2b-yritykselle. Tavoitteena oli kilpailuedun hankkiminen sosiaalisen median tehokkaalla hyödyntämisellä mark-kinoinnissa. Konkreettisemmin yritys halusi lisää näkyvyyttä ja myyntiä. Suunnitelman laatimisessa hyödynnettiin POST-menetelmää. Erityistä huomiota kiinnitettiin b2b-markkinoinnin eroihin b2c-markkinointiin verrattuna. Myös yrityksen toimiminen Suomen markkinoilla huomioitiin. Lisäksi analysoitiin kilpailijoita asia...

Contract-related dose determination in the Biblis nuclear power station of the RWE

International Nuclear Information System (INIS)

Kallmeyer, D.; Ambros, R.

1979-01-01

An important method of control (and hence reduction) of the exposure to radiation is the work- or contract-related dosage determination. (ADOS). The aim of ADOS in the detailed determination of the dosage to which personnel is exposed during all operations in the controlled area, and the allocation of this dosage to the operations in the controlled zone. The authors describe the methodology and give selected results from a computerised acquisition system for the contract-related dosage determination. (orig.) [de

Qatar Exoplanet Survey : Qatar-3b, Qatar-4b, and Qatar-5b

Science.gov (United States)

Alsubai, Khalid; Mislis, Dimitris; Tsvetanov, Zlatan I.; Latham, David W.; Bieryla, Allyson; Buchhave, Lars A.; Esquerdo, Gilbert A.; Bramich, D. M.; Pyrzas, Stylianos; Vilchez, Nicolas P. E.; Mancini, Luigi; Southworth, John; Evans, Daniel F.; Henning, Thomas; Ciceri, Simona

2017-04-01

We report the discovery of Qatar-3b, Qatar-4b, and Qatar-5b, three new transiting planets identified by the Qatar Exoplanet Survey. The three planets belong to the hot Jupiter family, with orbital periods of {P}{{Q}3{{b}}} = 2.50792 days, {P}{{Q}4{{b}}} = 1.80539 days, and {P}{{Q}5{{b}}} = 2.87923 days. Follow-up spectroscopic observations reveal the masses of the planets to be {M}{{Q}3{{b}}} = 4.31 ± 0.47 {M}{{J}}, {M}{{Q}4{{b}}} = 6.10 ± 0.54 {M}{{J}}, and {M}{{Q}5{{b}}} = 4.32 ± 0.18 {M}{{J}}, while model fits to the transit light curves yield radii of {R}{{Q}3{{b}}} = 1.096 ± 0.14 {R}{{J}}, {R}{{Q}4{{b}}} = 1.135 ± 0.11 {R}{{J}}, and {R}{{Q}5{{b}}} = 1.107 ± 0.064 {R}{{J}}. The host stars are low-mass main sequence stars with masses and radii M Q3 = 1.145 ± 0.064 M ⊙, M Q4 = 0.896 ± 0.048 M ⊙, M Q5 = 1.128 ± 0.056 M ⊙ and R Q3 = 1.272 ± 0.14 R ⊙, R Q4 = 0.849 ± 0.063 R ⊙, and R Q5 = 1.076 ± 0.051 R ⊙ for Qatar-3, 4, and 5 respectively. The V magnitudes of the three host stars are V Q3 = 12.88, V Q4 = 13.60, and V Q5 = 12.82. All three new planets can be classified as heavy hot Jupiters (M > 4 M J).

Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

Science.gov (United States)

Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

1983-06-01

The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

Observation of B0-anti B0 mixing

International Nuclear Information System (INIS)

Albrecht, H.; Andam, A.A.; Binder, U.; Boeckmann, P.; Glaeser, R.; Harder, G.; Nippe, A.; Schaefer, M.; Schmidt-Parzefall, W.; Schroeder, H.; Schulz, H.D.; Wurth, R.; Yagil, A.; Donker, J.P.; Drescher, A.; Kamp, D.; Kolanoski, H.; Matthiesen, U.; Scheck, H.; Spaan, B.; Spengler, J.; Wegener, D.; Frisken, W.R.; Gilkinson, D.J.; Gingrich, D.M.; Kim, P.C.H.; Kutschke, R.; McKenna, J.A.; Orr, R.S.; Padley, P.; Parsons, J.A.; Prentice, J.D.; Seywerd, H.C.J.; Swain, J.D.; Yoon, T.S.; MacFarlane, D.B.; McLean, K.W.; Nilsson, A.W.; Patel, P.M.; Tsipolitis, G.; Ammar, R.; Coppage, D.; Davis, R.; Kanekal, S.; Kwak, N.; Bostjancic, B.; Kernel, G.; Plesko, M.; Childers, R.; Darden, C.W.; Oku, Y.; Gennow, H.

1987-01-01

Using the ARGUS detector at the DORIS II storage ring we have searched in three different ways for B 0 -anti B 0 mixing in Υ (4S) decays. One explicitly mixed event, a decay Υ (4S) → B 0 B 0 , has been completely reconstructed. Furthermore, we observe a 4.0 standard deviation signal of 24.8 events with like-sign lepton pairs and a 3.0 standard deviation signal of 4.1 events containing one reconstructed B 0 (anti B 0 ) and an additional fast l + (l - ). This leads to the conclusion that B 0 -anti B 0 mixing is substantial. For the mixing parameter we obtain r = 0.21±0.08. (orig.)

The EPR (European Pressurized Water Reactor) containment - concept, testing of leakage behaviour, FRP liner

Energy Technology Data Exchange (ETDEWEB)

Touret, J.P. [EDF SEPTEN, Villeurbanne (France); Liersch, G. [Bayernwerk Kerenergie GmbH, Muenchen (Germany); Danisch, R. [Siemens AG, KWU NAD, Erlangen (Germany)

2001-07-01

The Basic Design of the EPR has now been completed. The containment plays a major safety-related role with respect to protection of the environment against radioactive releases. The EPR features a double (steel-reinforced concrete/prestressed concrete) containment design, with the inner containment coated additionally with a fibreglass-reinforced plastic (FRP) liner in certain areas. This means that containment leaktightness is provided mainly by the prestressed concrete and the FRP liner in the event of a postulated accident. The numerous findings of the tests carried out so far in both France and Germany are summarized. (orig.) [German] Das Basic Design fuer den EPR ist fertiggestellt. Entscheidend fuer eine Realisierung wird neben der politischen Akzeptanz vor allem die Wettbewerbsfaehigkeit mit anderen Energietraegern sein. Im EPR-Projekt wird der hohe Sicherheitsstandard der heutigen Kernkraftwerke in Deutschland und Frankreich ergaenzt, indem zusaetzlich technische Massnahmen ergriffen werden, um die Konsequenzen beim unterstellten Versagen aller sicherheitstechnischen Einrichtungen mit der Folge eines postulierten Niederschmelzen des Kerns technisch zu beherrschen. (orig.)

Comparison calculation/experiment on the load case ``shutdown of TH high pressure pumps under consideration of fluid structure interaction``; Vergleich Rechnung/Messung zum Lastfall ``Abschaltung der TH-Hochdruckpumpen unter Beruecksichtigung der Fluid-Struktur-Wechselwirkung``

Energy Technology Data Exchange (ETDEWEB)

Erath, W.; Nowotny, B.; Maetz, J. [KED, Rodenbach (Germany)

1998-11-01

Measurements of an experiment in a pipe system with pump shutdown and valve closing have been performed in the nuclear power plant KRB II. Comparative calculations of fluid and structure including interaction show an excellent agreement with the measured results. Theory and implementation of the fluid/structure interaction and the results of the comparison are described. It turns out that the consideration of the fluid/structure interaction is mostly a significant increase of the effective structural damping. (orig.) [Deutsch] Es wurden Messungen am nuklearen Nachkuehlsystem des Kernkraftwerks Gundremmingen (KRB II) bei einem Versuche mit Pumpenabschalten und Ventilschliessen durchgefuehrt. Vergleichsrechnungen der Fluid-Strukturdynamik unter echter Beruecksichtigung der Wechselwirkung ergaben eine ausgezeichnete Uebereinstimmung der Rechnung mit den Messungen. Es werden Theorie und Implementierung der Koppelung der Fluid- und Struktur-Berechnungen sowie die Vergleiche von Messung und Rechnung beschrieben. Es ergibt sich, dass die Beruecksichtigung der Wechselwirkung notwendig ist zur genaueren Berechnung von `weichen` Rohrleitungsystemen. Eine wichtige Folge der Wechselwirkung ist meist eine deutliche Erhoehung der effektiven Strukturdaempfung. (orig.)

Practical event analysis; Durchfuehrung von Ereignisanalysen in der Praxis

Energy Technology Data Exchange (ETDEWEB)

Scheuring, R. [Bayernwerk Kernenergie GmbH - Kernkraftwerk Grafenrheinfeld (Germany)

1999-04-01

The paper explains the systematic approaches and practical aspects of evaluation of NPP operating reports and implementation of identified remedial action for enhancing the safety in terms of human, organisational, and technology factors. The procedures adopted for the Grafenrheinfeld nuclear power station (KKG) serve as an example. (orig./CB) [German] Ein wichtiger Bestandteil zur Erhaltung und Fortentwicklung des Sicherheitsniveaus ist das Lernen aus der Erfahrung. Hierzu wiederum ist ein systematisches Vorgehen zur Vermeidung von Fehlern und Behebung von Schwachstellen menschlicher, technischer und organisatorischer Natur unabdingbare Voraussetzung. Die Anwendung einer umfassenden Auswertemethodik beinhaltet - die Erfassung und Informationsweitergabe externer und interner Vorkommnisse und Erfahrungen - eine systematische Analyse/Auswertung - eine konsequente Umsetzung der Abhilfemassnahmen unter Einbeziehen aller betroffenen Organisationseinheiten. Wie erfolgt die Umsetzung dieser Vorgaben in die Praxis? Im Kernkraftwerk Grafenrheinfeld (KKG) ist die Auswertung von externen und internen Betriebserfahrungen als Aufgabe im Betriebshandbuch (BHB) 'Personelle Betriebsorganisation' vorgegeben und im Detail im Sinne der Ablauforganisation im Qualitaetssicherungshandbuch in Qualitaetssicherungsanweisungen (QSA) beschrieben. (orig.)

E-Business Models in B2B: Process Based Categorization and Analysis of B2B Models

OpenAIRE

Mahesh S. Raisinghani; Turan Melemez; Lijie Zou; Chris Paslowski; Irma Kimvidze; Susanne Taha; Klaus Simons

2005-01-01

The business models in business-to-business (B2B) e-commerce and their effectiveness have been a major topic of research in recent years. Due to the variety of existing models, it seems difficult to find a widely accepted categorization that can be analyzed and assessed. An in-depth study that provides a process-based approach to B2B e-commerce is presented and illustrated with examples from industry. A comparative examination of both the buy and the sell side based on a process-related appro...

Consequences of the Federal Administrative Court decisions about the Biblis on-site interim store and the 'Biblis condition' as seen by the Nuclear Regulatory Authority of the State of Baden-Wuerttemberg

International Nuclear Information System (INIS)

Rauscher, Dieter

2009-01-01

On March 17, 2005, the Baden-Wuerttemberg State Ministry of Economics, following instructions by the Federal Ministry for the Environment, Nature Conservation, and Nuclear Safety (BMU), imposed an ex-post-facto condition on the licensee of the Philippsburg Units 1 and 2 nuclear power station. Its content can be summed up as follows: In case of deviations from criteria specified in the license which are relevant to accident management, the plant must be shut down. In case of suspicion that, for whatever reason, accident management could be doubtful, accident management must be demonstrated to function; failing this, the plant must be shut down. In a decision of February 26, 2007, the Baden-Wuerttemberg State Court of Administration set this condition aside. The Federal Administrative Court, in its ruling of April 10, 2008, essentially confirmed the decision of the court of first instance. Both decisions are analyzed. Licensees and public authorities are shown the general framework of administrative law within which their relations are regulated. Another subject covered is jurisdiction about provisions against damage in connection with the ruling of the Federal Administrative Court of April 10, 2008 in the matter of the Brunsbuettel interim store. The court comments on the question of provision against damage in the area of protection, develops the dogma from scratch again as to the borderlines separating provisions against damage from residual risk and, within this framework, addresses the problem of third-party action against execution, especially so with respect to protection. The question of possible repercussions upon practice is discussed also for this court ruling. (orig.)

Inclusive b and b anti b production with quasi-multi-Regge kinematics at the Tevatron

Energy Technology Data Exchange (ETDEWEB)

Kniehl, B.A. [Hamburg Univ. (Germany). II. Institut fuer Theoretische Physik; Saleev, V.A.; Shipilova, A.V. [Samara State University (Russian Federation)

2010-03-15

We consider b-jet hadroproduction in the quasi-multi-Regge-kinematics approach based on the hypothesis of gluon and quark Reggeization in t-channel exchanges at high energies. The preliminary data on inclusive b-jet and b anti b-dijet production taken by the CDF Collaboration at the Fermilab Tevatron are well described without adjusting parameters. We find the main contribution to inclusive b-jet production to be the scattering of a Reggeized gluon and a Reggeized b-quark to a b quark, which is described by the effective Reggeon-Reggeon-quark vertex. The main contribution to b anti b-pair production arises from the scattering of two Reggeized gluons to a b anti b pair, which is described by the effective Reggeon-Reggeon-quark-quark vertex. Our analysis is based on the Kimber-Martin-Ryskin prescription for unintegrated gluon and quark distribution functions using as input the Martin-Roberts-Stirling-Thorne collinear parton distribution functions of the proton. (orig.)

HPLC analysis of water-soluble vitamins (B1, B2, B3, B5, B6) in in ...

African Journals Online (AJOL)

... B6 (pyridoxine HCl) were higher in in vitro germinated seedlings. Thus, vitamin production was age and culture conditions dependent, which is discussed in detail. The study revealed that the germinated chickpea grains can be used for human consumption with value addition of vitamin B-group in the diet of vegetarians.

Enhanced B doping in CVD-grown GeSn:B using B δ-doping layers

Science.gov (United States)

Kohen, David; Vohra, Anurag; Loo, Roger; Vandervorst, Wilfried; Bhargava, Nupur; Margetis, Joe; Tolle, John

2018-02-01

Highly doped GeSn material is interesting for both electronic and optical applications. GeSn:B is a candidate for source-drain material in future Ge pMOS device because Sn adds compressive strain with respect to pure Ge, and therefore can boost the Ge channel performances. A high B concentration is required to obtain low contact resistivity between the source-drain material and the metal contact. To achieve high performance, it is therefore highly desirable to maximize both the Sn content and the B concentration. However, it has been shown than CVD-grown GeSn:B shows a trade-off between the Sn incorporation and the B concentration (increasing B doping reduces Sn incorporation). Furthermore, the highest B concentration of CVD-grown GeSn:B process reported in the literature has been limited to below 1 × 1020 cm-3. Here, we demonstrate a CVD process where B δ-doping layers are inserted in the GeSn layer. We studied the influence of the thickness between each δ-doping layers and the δ-doping layers process conditions on the crystalline quality and the doping density of the GeSn:B layers. For the same Sn content, the δ-doping process results in a 4-times higher B doping than the co-flow process. In addition, a B doping concentration of 2 × 1021 cm-3 with an active concentration of 5 × 1020 cm-3 is achieved.

Searches for Charmless Decays B0 --> eta omega, B0 --> eta K0, B+ --> eta rho+, and B+ --> eta' pi+

Energy Technology Data Exchange (ETDEWEB)

Aubert, B

2004-08-13

The authors report results for measurements of the decay branching fractions of B{sup 0} to the charmless final states {eta}{omega} and {eta}K{sup 0}, and of B{sup +} to {eta}{rho}{sup +} and {eta}'{pi}{sup +}. None of these decays have been observed definitively. Measurements of the related decays B{sup +} --> {eta}K{sup +}, B{sup +} --> {eta}{pi}{sup +}, and B --> {eta}'K were published recently. Charmless decays with kaons are usually expected to be dominated by b --> s loop (''penguin'') transitions, while b --> u tree transitions are typically larger for the decays with pions and {rho} mesons. However the B --> {eta}K decays are especially interesting since they are suppressed relative to the abundant B --> {eta}'K decays due to destructive interference between two penguin amplitudes. The CKM-suppressed b --> u amplitudes may interfere significantly with penguin amplitudes, possibly leading to large direct CP violation in B{sup +} --> {eta}{rho}{sup +} and B{sup +} --> {eta}'{pi}{sup +}; numerical estimates are available in a few cases. The authors search for such direct CP violation by measuring the charge asymmetry A{sub ch} {equivalent_to} ({Gamma}{sup -} - {Gamma}{sup +})/({Gamma}{sup -} + {Gamma}{sup +}) in the rates {Gamma}{sup {+-}} = {Gamma}(B{sup {+-}} --> f{sup {+-}}), for each observed charged final state f{sup {+-}}. Charmless B decays are becoming useful to test the accuracy of theoretical predictions. Phenomenological fits to the branching fractions and charge asymmetries can be used to understand the importance of tree and penguin contributions and may provide sensitivity to the CKM angle {gamma}.

Materials for the field test - students' attitudes to nuclear power stations. Materialien zum Unterrichtsversuch: Kernkraftwerke in der Einstellung von Jugendlichen

Energy Technology Data Exchange (ETDEWEB)

Hoffmann, L; Kattmann, U; Lucht, H; Spada, H [Kiel Univ. (Germany, F.R.). Inst. fuer die Paedagogik der Naturwissenschaften (IPN)

1975-01-01

This working paper contains all the materials developed for and used in the field test of 'Student Attitudes toward Atomic Power Stations'. This research is a component of a larger project called 'Attitudes and Attitudes Change with Regard to Problems of Energy Supply and their Consequences for our Environment'. A central aim of this project is the development of instrumental strategies enabling the student to build up in this field a critically reflective and active behavior and attitudes based on sound problem consciousness. These instrumental strategies are derived from theories of social, learning and environmental psychology. A concrete result of these efforts are the materials of the field test mentioned above. They include: a) The draft of an instructional unit 'Atomic Power Stations - Prosperity or Disaster' with - a booklet on the subject matter for students and teachers - a paper on the contents of the instructional unit and their sequence - information for the students concerning the aims of the investigation - working materials for the students - reading materials for the teachers informing them about the proposed instructional strategies based on the psychological theories: (1) model-learning and the structuring of knowledge, (2) how to activate and motivate students, (3) the stabilization of attitudes and (4) small group work. b) Instruments for testing and observation. These instruments were used within a criterion-oriented evaluation and for a test of the effects of the different proposed items used in the instruction.

Induction of the nuclear IκB protein IκB-ζ upon stimulation of B cell antigen receptor

International Nuclear Information System (INIS)

Hijioka, Kuniaki; Matsuo, Susumu; Eto-Kimura, Akiko; Takeshige, Koichiro; Muta, Tatsushi

2007-01-01

The nuclear IκB protein IκB-ζ is barely detectable in resting cells and is induced in macrophages and fibroblasts following stimulation of innate immunity via Toll-like receptors. The induced IκB-ζ associates with nuclear factor (NF)-κB in the nucleus and plays crucial roles in its transcriptional regulation. Here, we examined the induction of IκB-ζ in B lymphocytes, one of the major players in adaptive immunity. Upon crosslinking of the surface immunoglobulin complex, IκB-ζ mRNA was robustly induced in murine B-lymphoma cell line A20 cells. While the crosslinking activated NF-κB and induced its target gene, IκB-α, co-crosslinking of Fcγ receptor IIB to the surface immunoglobulin complex inhibited NF-κB activation and the induction of IκB-ζ and IκB-α, suggesting critical roles for NF-κB in the induction. These results indicate that IκB-ζ is also induced by stimulation of B cell antigen receptor, suggesting that IκB-ζ is involved in the regulation of adaptive immune responses

Directional crystallization of B4C-NbB2 and B4C-MoB2 eutectic compositions

International Nuclear Information System (INIS)

Paderno, Varvara; Paderno, Y.B.; Filippov, Vladimir; Liashchenko, Alfred

2004-01-01

We studied the directional crystallization of different compositions in B 4 C-NbB 2 and B 4 C-MoB 2 systems. The eutectic compositions for both systems are evaluated. It is shown that in the first system the rod-like eutectic structure is formed, in second, the 'Chinese hieroglyphics'. In both cases high hardness and high microplasticity are observed, which are much more than for individual component phases. These compositions may be considered as a new kind of self-strengthening composite materials

Ia-restricted B-B cell interaction. I. The MHC haplotype of bone marrow cells present during B cell ontogeny dictates the self-recognition specificity of B cells in the polyclonal B cell activation by a B cell differentiation factor, B151-TRF2

International Nuclear Information System (INIS)

Ono, S.; Takahama, Y.; Hamaoka, T.

1987-01-01

We have demonstrated that B cell recognition of Ia molecules is involved in polyclonal B cell differentiation by B151-TRF2. The present study was undertaken to examine the Ia recognition specificity of B151-TRF2-responsive B cells in fully major histocompatibility complex (MHC)-allogeneic P1----P2, semiallogeneic P1----(P1 x P2)F1, and double donor (P1 + P2)----(P1 x P2)F1 and (P1 + P2)----P1 radiation bone marrow chimeras. The B cells from both P1----P2 and P1----(P1 x P2)F1 chimeras could give rise to in vitro immunoglobulin M-producing cells upon stimulation with B151-TRF2 comparable in magnitude to that of normal P1 B cells, and their responses were inhibited by anti-I-AP1 but not by anti-I-AP2 monoclonal antibody even in the presence of mitomycin C-treated T cell-depleted P2 spleen cells as auxiliary cells. In contrast, the B151-TRF2 responses of P1 B cells isolated from both (P1 + P2)----(P1 x P2)F1 and (P1 + P2)----P1 double bone marrow chimeras became sensitive to the inhibition of not only anti-I-AP1 but also anti-I-AP2 monoclonal antibody only when the culture was conducted in the presence of P2 auxiliary cells, demonstrating that they adaptively differentiate to recognize as self-structures allogeneic as well as syngeneic Ia molecules. Moreover, the experiments utilizing B cells from H-2-congenic mice and B cell hybridoma clones as auxiliary cells revealed that B151-TRF2-responsive B cells recognize Ia molecules expressed on B cells. Taken together, these results demonstrate that B151-TRF2-responsive B cells recognize Ia molecules expressed by B cells as self-structures and that their self-recognition specificity is dictated by the MHC haplotype of bone marrow cells present during the B cell ontogeny but not by the MHC haplotype of a radiation-resistant host environment

Search for b->u Transitions inB- -> D0 K- and B- -> D*0 K-

Energy Technology Data Exchange (ETDEWEB)

Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

2005-05-27

The authors search for B{sup -} {yields} {tilde D}{sup 0}K{sup -} and B{sup -} {yields} {tilde D}*{sup 0}K{sup -}, with {tilde D}*{sup 0} {yields} {tilde D}{sup 0}{pi}{sup 0} or {tilde D}*{sup 0} {yields} {tilde D}{sup 0}{gamma}, and {tilde D}{sup 0} {yields} K{sup +}{pi}{sup -} (and charge conjugates). These final states can be reached through the b {yields} c transition B{sup -} {yields} D{sup (*)0}K{sup -} followed by the doubly CKM-suppressed D{sup 0} {yields} K{sup +}{pi}{sup -}, or the b {yields} u transition B{sup -} {yields} {bar D}{sup (*)0}K{sup -} followed by the CKM-favored {bar D}{sup 0} {yields} K{sup +}{pi}{sup -}. The interference of these two amplitudes is sensitive to the angle {gamma} of the unitarity triangle. The results are based on 232 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at SLAC. They find no significant evidence for these decays. They set a limit r{sub B} {triple_bond} |A(B{sup -} {yields} {bar D}{sup 0}K{sup -})/A(B{sup -} {yields} D{sup 0}K{sup -})| < 0.23 at 90% C.L. using the most conservative assumptions on the values of the CKM angle {gamma} and the strong phases in the B and D decay amplitudes. In the case of the D* they set a 90% C.L. limit r*{sub B}{sup 2} {triple_bond} |A(B{sup -} {yields} {bar D}*{sup 0}K{sup -})/A(B{sup -} {yields} D*{sup 0} K{sup -})|{sup 2} < (0.16){sup 2} which is independent of assumptions on {gamma} and strong phases.

Model independent calculation of B(anti B0→D(*)+τ- anti ν)/B(anti B0→D(*)+e- anti ν)

International Nuclear Information System (INIS)

Hwang, D.S.

2000-01-01

Using the formulas for the dΓ/dq 2 distribution with non-zero lepton mass and experimentally determined form factors, we calculate the dΓ(D (*)+ l - anti ν)/dq 2 spectra and branching fractions for l=e,μ and τ. We obtain the results B(anti B 0 →D + τ - anti ν)/B(anti B 0 →D + e - anti ν)=0.278 +0.049 -0.035 and B(anti B 0 →D *+ τ - anti ν)/B(anti B 0 →D *+ e - anti ν)=0.256 +0.014 -0.013 . Since we used the experimentally measured form factors, these results are independent of theoretical models of the form factors. (orig.)

Preventive maintenance measures and repeat tests on actuators

International Nuclear Information System (INIS)

Hueren, H.

1990-01-01

At Biblis Nuclear Power Station, about 1500 electrical actuators and variable speed drives of various model ranges and with various driving end speeds and actuating times are installed and about 600 of these are located in important safety engineering systems. In order to optimize the preventive maintenance measures on the drives, a data bank has been established into which are stored, in addition to the fixed type data of each drive, inter alia, statements about location of application, valve type, inspection cycle, calendar year of next maintenance, findings during inspection measures and causes of faults. Before each unit inspection, in addition to the inspection lists, the maintenance and installation records and also the associated job instructions are produced from this data processing equipment. (orig.) [de

Solution of the Lambda modes problem of a nuclear power reactor using an h–p finite element method

International Nuclear Information System (INIS)

Vidal-Ferrandiz, A.; Fayez, R.; Ginestar, D.; Verdú, G.

2014-01-01

Highlights: • An hp finite element method is proposed for the Lambda modes problem of a nuclear reactor. • Different strategies can be implemented for increasing the accuracy of the solutions. • 2D and 3D benchmarks have been studied obtaining accurate results. - Abstract: Lambda modes of a nuclear power reactor have interest in reactor physics since they have been used to develop modal methods and to study BWR reactor instabilities. An h–p-Adaptation finite element method has been implemented to compute the dominant modes the fundamental mode and the next subcritical modes of a nuclear reactor. The performance of this method has been studied in three benchmark problems, a homogeneous 2D reactor, the 2D BIBLIS reactor and the 3D IAEA reactor

Compilation of data on the release of radioactive substances in the vent air of nuclear power plants in the Federal Republic of Germany in 1975

International Nuclear Information System (INIS)

Winkelmann, I.; Endrulat, H.J.; Haubelt, R.; Westpfahl, U.

1976-04-01

The present compilation of data on the release of radioactive substances in the vent air of nuclear power plants in the FRG is a continuation of a report series on aerosol filter and iodine filter samples from the exhaust air control systems of the nuclear power plants Gundremmingen, Obrigheim, Wuergassen, Stade, Lingen and Biblis A. The reports have been issued by the Federal public health office since 1972. This report is supplemented by annual release values on radioactive noble gases, on short- and long-lived aerosols, and on gaseous 131 I, supplied by the individual nuclear power plants as in previous years on uniform questionnaires. Data on the release of tritium are also available from some nuclear power plants. (orig.) [de

B2B-myynnin nykytila ja haasteet Suomessa

OpenAIRE

Ylimaula, Jukka

2014-01-01

Tämä opinnäytetyö tutki B2B-myynnin nykytilaa valituissa suomalaisissa yrityksissä. Tutkimuksen tavoite oli selvittää myyntijohdon mielestä B2B-myynnissä tärkeitä asioita ja hahmottaa tapaa, jolla organisaatio toimii yhteistyössä myynnissä. Näin teemojen pohjalta opinnäytetyö pyrki muodostamaan ajankuvan suomalaisesta B2B-myynnistä. Opinnäytetyö muodostuu teoriaosasta ja empiirisestä osasta. Teoreettinen osuus tutkii myyntiä sekä myyjän että ostajan näkökulmasta. Myös asiakassuhteita ja m...

ORM-based semantics of B2B transactions.

NARCIS (Netherlands)

Balsters, H.; van Blommestein, F.; Meersman, R; Herrero, P; Dillon, T

2009-01-01

After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely

Hotelzon's B2B content marketing plan

OpenAIRE

Nguyen, Trang

2015-01-01

This thesis follows a research-based structure. The objective of this research was to help the case company Hotelzon develop a practical business-to-business (B2B) content marketing plan to engage new customers. The research topic came up when the case company named Hotelzon started expanding its business to many other countries. Therefore, attracting new prospects has become a critical issue to B2B corporates in this online world and constantly changing business environment. The first pa...

A Model of B2B Exchanges

OpenAIRE

Gabor Fath; Miklos Sarvary

2001-01-01

B2B exchanges are revolutionizing the way businesses will buy and sell a variety of intermediary products and services. It is estimated that most of the roughly $7 trillion worth of business transactions are likely to go through these new institutions within the next decade. This paper tries to understand the economics governing the transactions within B2B exchanges and analyze their likely evolution over time. In doing so, we start by providing the rigorous definitions to a number of critica...

Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

Directory of Open Access Journals (Sweden)

Pierluigi Sabbatini

2001-06-01

Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.

Power engineering. Systems for energy conversion. Compact knowledge for study and profession. 4. upd. and enl. ed.; Energietechnik. Systeme zur Energieumwandlung. Kompaktwissen fuer Studium und Beruf

Energy Technology Data Exchange (ETDEWEB)

Zahoransky, Richard A.

2009-07-01

This textbook imparts to the reader a fundamental understanding for relations of energy conversion processes. It comprises the total spectra of energy engineering, starting with fundamentals of energy process engineering via description of operating power plants (all types) to energy distribution and - storage. Main topics are sustainable energy systems from renewable energy sources. combined systems (e.g. Gas/steam turbine power plants) and plants with cogeneration (e.g. modular cogeneration plants). A new chapter Kyoto-Protocol was created as a concept of emissions-free coal-fired power plants. A new wording for deregulation of energy markets was received. Numerous texts and graphs were been revised. Chapter 18 ''Deregulation of Energy Markets'' is newly revised. Due to its didactic concepts the book directs not only to students but also everybody, who is inerested into actual questions of energy engineering. (org./GL) [German] Dieses Lehrbuch vermittelt dem Leser ein grundlegendes Verstaendnis fuer die Zusammenhaenge der Energieumwandlungsprozesse. Es umfasst die gesamte Bandbreite der Energietechnik. Die Schwerpunkte reichen von nachhaltigen, erneuerbaren Energietechniken, Kombianlagen (z.B. Gas- und Dampfturbinen-Kraftwerke) ueber Anlagen mit Kraft-Waerme-Kaelte-Kopplung bis hin zum Kyoto-Protokoll. Die 4. Auflage beinhaltet erstmals Uebungsaufgaben mit ausfuehrlichen Loesungen zu den einzelnen Kapiteln. Mehrere Kapitel sind aktualisiert. Das Kapitel 18 ''Liberalisierung der Energiemaerkte'' ist neu gefasst. Aus dem Inhalt Energietechnische Grundlagen - Dampfkraftwerke - Kernkraftwerke - Gasturbinen - Kombinationskraftwerke - Stationaere Kolbenmotoren - Brennstoffzellen - Kraft-Waerme-Kaelte-Kopplung - Wasserkraft - Solartechnik - Windenergie - Biomasse - Geothermie - Energetische Muellverwertung - Energieverteilung und -speicherung - Liberalisierung der Energiemaerkte - Kyoto-Protokoll. (orig.)

Could Zb(10610) be a B*B-bar molecular state?

International Nuclear Information System (INIS)

Zhang Jianrong; Zhong Ming; Huang Mingqiu

2011-01-01

Assuming the newly observed structure Z b (10610) as a bottomonium-like molecular state B*B-bar, we calculate its mass in the framework of QCD sum rules. The numerical result is 10.54±0.22 GeV for B*B-bar, which coincide with the mass of Z b (10610). This consolidates the statement made by Belle Collaboration that the Z b (10610) resonance could be a B*B-bar molecular state.

OCA-B regulation of B-cell development and function.

Science.gov (United States)

Teitell, Michael A

2003-10-01

The transcriptional co-activator OCA-B [for Oct co-activator from B cells, also known as OBF-1 (OCT-binding factor-1) and Bob1] is not required for B-cell genesis but does regulate subsequent B-cell development and function. OCA-B deficient mice show strain-specific, partial blocks at multiple stages of B-cell maturation and a complete disruption of germinal center formation in all strains, causing humoral immune deficiency and susceptibility to infection. OCA-B probably exerts its effects through the regulation of octamer-motif controlled gene expression. The OCA-B gene encodes two proteins of distinct molecular weight, designated p34 and p35. The p34 isoform localizes in the nucleus, whereas the p35 isoform is myristoylated and is bound to the cytoplasmic membrane. p35 can traffic to the nucleus and probably activates octamer-dependent transcription, although this OCA-B isoform might regulate B cells through membrane-related signal transduction.

CP violation and B0-(B0)-bar mixing

International Nuclear Information System (INIS)

Aleksan, R.

1996-01-01

The status of CP violation and B 0 -(B 0 )-bar mixing is given and the subsequent constraints in the framework of the Standard Model are discussed. Recent result on CP violation in the kaon system and related topics are reviewed, including the status of T violation and the tests of the CPT symmetry. The results on B 0 -(B 0 )-bar mixing are presented followed by the studies on B d 0 -(B d 0 )-bar and B s 0 -(B s 0 )-bar oscillations. Finally, the prospects of progress on understanding CP violation are discussed in framework of the new projects expected to produce results at the turn of the century. (author)

B2B-myyntiprosessi : case: Yritys X

OpenAIRE

Lamppu, Samuli

2017-01-01

Opinnäytetyön aiheena on B2B-myyntiprosessi yrityksessä x. Työn tavoitteena on kartoittaa yrityksen B2B-myyntiprosessin nykytila, tunnistaa mahdolliset ongelma-alueet ja tehdä tämän perusteella ehdotukset toimenpiteistä prosessin parantamiseksi. Työ tehdään suomalaisen PK-yrityksen toimeksiannosta. Opinnäytetyön taustalla on oma urani yrityksen yritysmyynnissä, ja työni kautta tunnistamani haasteet sekä mahdollisuudet, joita hyödyntämällä yritys voisi kehittää myyntitoimintaansa. Yritykse...

Nanostructure characterization of Ni and B layers as artificial pinning centers in multilayered MgB2/Ni and MgB2/B superconducting thin films

International Nuclear Information System (INIS)

Sosiati, H.; Hata, S.; Doi, T.; Matsumoto, A.; Kitaguchi, H.; Nakashima, H.

2013-01-01

Highlights: ► Nanostructure characterization of Ni and B layers as artificial pinning centers (APCs). ► Relationship between nanostructure and J c property. ► Enhanced J c in parallel field by parallel APCs within the MgB 2 film. -- Abstract: Research on the MgB 2 /Ni and MgB 2 /B multilayer films fabricated by an electron beam (EB) evaporation technique have been extensively carried out. The critical current density, J c of MgB 2 /Ni and MgB 2 /B multilayer films in parallel fields has been suggested to be higher than that of monolayer MgB 2 film due to introducing the artificial pinning centers of nano-sized Ni and B layers. Nanostructure characterization of the artificial pinning centers in the multilayer films were examined by transmission electron microscopy (TEM) and scanning TEM (STEM-energy dispersive X-ray spectroscopy (STEM-EDS))–EDS to understand the mechanism of flux pinning. The growth of columnar MgB 2 grains along the film-thickness direction was recognized in the MgB 2 /Ni multilayer film, but not in the MgB 2 /B multilayer film. Nano-sized Ni layers were present as crystalline epitaxial layers which is interpreted that Ni atoms might be incorporated into the MgB 2 lattice to form (Mg,Ni)B 2 phase. On the other hand, nano-sized B layers were amorphous layers. Crystalline (Mg,Ni)B 2 layers worked more effectively than amorphous B-layers, providing higher flux-pinning force that resulted in higher J c of the MgB 2 /Ni multilayer film than the MgB 2 /B multilayer film

Corrections to the bag factor in B- anti B-mixing

Energy Technology Data Exchange (ETDEWEB)

Grozin, Andrey G. [BINP, Novosibirsk (Russian Federation); Klein, Rebecca; Mannel, Thomas; Pivovarov, Alexei A. [Universitaet Siegen (Germany)

2016-07-01

B- anti B-Mixing is parameterized by the matrix elements of local operators O{sub i}. For the computation of these matrix elements a bag factor B{sub i} can be introduced left angle anti B vertical stroke O{sub i} vertical stroke B right angle =B{sub i} left angle anti B vertical stroke O{sub i} vertical stroke B right angle {sup fac}, which is unity in naive factorization. Any deviation from unity describes the accuracy of the naive factorization prescription. Corrections to B{sub i} emerge from QCD radiative corrections and from nonperturbative contributions at order 1/m{sub b}. We present the current status of these corrections to B{sub i}.

The lactoferricin B-derived peptide, LfB17-34, induces melanogenesis in B16F10 cells.

Science.gov (United States)

Huang, Hsiu-Chin; Lin, Hsuan; Huang, Min-Chuan

2017-03-01

Lactoferricin B (LfcinB), a peptide of bovine lactoferrin (LfB), exhibits multiple biological functions, including antimicrobial, antiviral, antioxidant and immunomodulatory activities. However, the role of LfcinB-related peptides in melanogenesis remains unclear. In this study, a set of five LfcinB-related peptides was examined. We found that LfB17‑34, an 18-mer LfcinB-derived peptide, increased melanogenesis in B16F10 melanoma cells without significantly affecting cell viability. LfB17‑34 increased in vitro tyrosinase activity and melanin content in a dose-dependent manner. The results of RT-qPCR and western blot analyses showed that LfB17‑34 increased the mRNA and protein expression of tyrosinase and tyrosinase-related protein 1 (Trp1). Moreover, LfB17‑34 inhibited the phosphorylation of MAPK/Erk, but not p38 and Akt, and constitutively active MEK was able to reverse the LfB17-34-enhanced pigmentation, melanin content, and tyrosinase activity, suggesting a role of Erk signaling in the process of LfB17‑34-mediated pigmentation. Taken together, these results suggest that LfB17‑34 induces melanogenesis in B16F10 cells primarily through increased tyrosinase expression and activity and that LfB17‑34 could be further developed for the treatment of hypopigmentation disorders.

Applying conceptual design to B2B sales negotiations

DEFF Research Database (Denmark)

Illi, Mikko; Ylirisku, Salu

This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery...... on the ways in which design sense making artefacts may drive also B2B sales agents’ work....

Microstructural characterization of LaB6-ZrB2 eutectic composites

International Nuclear Information System (INIS)

Wang Shengchang; Wei, W.J.; Zhang Litong

2003-01-01

Detail microstructure of LaB 6 -ZrB 2 composites has been characterized by TEM and HRTEM. The directionally solidified ZrB 2 fibers in LaB 6 matrix near LaB 6 -ZrB 2 eutectics present at least three growing relationship systems. In addition to previous report of [001]LaB 6 / [0001]ZrB 2 relationship, [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . were identified. Different with [001]LaB 6 / [0001]ZrB 2 system, the interfaces of [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . show non-coherent and clean interfaces. There is neither glassy phase nor reaction products found at the interfaces (orig.)

Harnessing marketing automation for B2B content marketing

OpenAIRE

Järvinen, Joel; Taiminen, Heini

2016-01-01

The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

Production rate of $b\\overline{b}$ quark pairs from gluons and $b\\overline{b}b\\overline{b}$ events in hadronic Z decays

CERN Document Server

Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Boeriu, O.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Cammin, J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; de Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Glenzinski, D.; Goldberg, J.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Harin-Dirac, M.; Hauke, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lawson, I.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rembser, C.; Rick, H.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schmitt, S.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tarem, S.; Taylor, R.J.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.

2001-01-01

The rates are measured per hadronic Z decay for gluon splitting to bb(bar) quark pairs, g_bb, and of events containing two bb(bar) quark pairs, g_4b, using a sample of four-jet events selected from data collected with the OPAL detector. Events with an enhanced signal of gluon splitting to bb(bar) quarks are selected if two of the jets are close in phase-space and contain detached secondary vertices. For the event sample containing two bb(bar) quark pairs, three of the four jets are required to have a significantly detached secondary vertex. Information from the event topology is combined in a likelihood fit to extract the values of g_bb and g_4b, namely g_bb = (3.07 +- 0.53(stat) +- 0.97(syst))x10^-3 g_4b = (0.36 +- 0.17(stat) +- 0.27(syst))x10^-3

Measurements of the B0-anti-B0 Oscillation Frequency in Hadronic B Decays

Energy Technology Data Exchange (ETDEWEB)

Raven, Gerhard

2001-07-25

B{sup 0}{bar B}{sup 0} flavor oscillations have been studied in 20.7 fb{sup -1} of e{sup +}e{sup -} annihilation data collected in 1999 and 2000 with the BABAR detector at center-of-mass energies near the {Upsilon}(4S) resonance. The event sample consists of one B{sup 0} meson fully reconstructed in a hadronic decay mode, while the flavor of the recoiling B{sup 0} in the event is determined with a tagging algorithm that exploits the correlation between the flavor of the heavy quark and the charges of its decay products. By fitting the time development of the observed mixed and unmixed final states, the B{sup 0}{bar B}{sup 0} oscillation frequency, {Delta}m{sub d}, is determined to be 0.519 {+-} 0.020 {+-} 0.016 {Dirac_h} ps{sup -1}.

LHCb Results on Semileptonic B/B$_s$/$\\Lambda_b$ Decays

CERN Document Server

Bozzi, Concezio

2013-01-01

Studies of semileptonic decays of b hadrons with the LHCb experiment are reported. In particular, measurements of the b hadron production fractions at the LHC and Bs semileptonic decays in P-wave charmed mesons are presented. An outlook of the LHCb potential in measuring the CKM matrix elements Vub and Vcb, as well as decays involving taus, is given.

On b-connectedness and b-disconnectedness and their applications

Directory of Open Access Journals (Sweden)

A.A. El-Atik

2013-04-01

Full Text Available In this paper, by using b-open (=γ-open sets we study the concept of b-separated sets. With this concept we study the notion of b-connected sets and strongly b-connected sets. We give some properties of such concepts with some b-separation axioms and compact spaces. Finally, we construct a new topological space on a connected graph.

ORM-Based Semantics of B2B Transactions

Science.gov (United States)

Balsters, H.; van Blommestein, F.

After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely neglected by present implementations of standard EDI- or XML-messaging and by B2B webservice implementations. In this paper a precise model is given of the negotiation process. The requirements of a potential Buyer and the offer of a potential Seller are matched and, if the negotiation is successful, a contract is concluded. The negotiation process model is represented in ORM, extended with dynamic constraints. Our model may be implemented in the databases of the trading partners and in message- or service definitions.

Measurement of the mass splittings between the b bar bχb,J(1P) states

International Nuclear Information System (INIS)

Edwards, K.W.; Edwards, K.W.; Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L.; Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A.; Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F.; Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M.; Richichi, S.J.; Severini, H.; Skubic, P.; Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M.; Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H.; Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X.; Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J.; Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.

1999-01-01

We present new measurements of photon energies and branching fractions for the radiative transitions Υ(2S)→γχ b(J=0,1,2) (1P). The masses of the χ b states are determined from the measured radiative photon energies. The ratio of mass splittings between the χ b substates, r≡(M J=2 -M J=1 )/(M J=1 -M J=0 ), with M the χ b mass, provides information on the nature of the b bar b confining potential. We find r(1P)=0.542±0.022±0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P) b (1P) states than for the χ b (2P) states. copyright 1999 The American Physical Society

Search for Radiative Penguin Decays B+ --> ρ+ γ, B0 --> ρ0 γ, and B0 --> ω γ

International Nuclear Information System (INIS)

Aubert, B

2004-01-01

A search for the decays B --> ρ(770)γ and B 0 --> ω(782)γ is performed on a sample of 211 million Υ(4S) --> B(bar B) events collected by the BABAR detector at the PEP-II asymmetric-energy e + e - storage ring. No evidence for the decays is seen. The authors set the following limits on the individual branching fractions B(B + --> ρ + γ) -6 , B(B 0 --> ρ 0 γ) -6 , and B(B 0 --> ωγ) -6 at the 90% confidence level (C.L.). They use the quark model to limit the combined branching fraction (bar B)|B --> (ρ/ω)γ| -6 and constrain |V td |/|V ts | < 0.19 at the 90%. C.L

B decays

CERN Document Server

Stone, Sheldon

1992-01-01

The study of b quarks has now reached a stage where it is useful to review what has been learned so far and also to look at the implications of future studies. The most important observations thus far - measurement of the "B" lifetime, B 0 - B 0 mixing, and the observation of b? u transitions, as well as more mundane results on hadronic and semileptonic transitions - are described in detail by experimentalists who have been closely involved with the measurements. Theoretical progress in understanding b quark decays, including the mechanisms of hadronic and semileptonic decays, are described. S

EphrinB1/EphB3b Coordinate Bidirectional Epithelial-Mesenchymal Interactions Controlling Liver Morphogenesis and Laterality

DEFF Research Database (Denmark)

Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C

2016-01-01

Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...

Risk oriented analysis of the SNR-300

International Nuclear Information System (INIS)

Koeberlein, K.

1982-01-01

The Fact Finding Committee on 'Future Nuclear Power Policy' established by the 8th German Federal Parliament in its report of June 1980 among other items published the recommendation to commission a 'risk oriented analysis' of the SNR-300 in order to enable a pragmatic comparison to be made of the safety of the German prototype fast breeder reactor and a modern light water reactor (a Biblis B PWR). The Federal Minister for Research and Technology in August 1981 officially commissioned the Gesellschaft fuer Reaktorsicherheit (GRS) to conduct the study. Following a recommendation by the Fact Finding Committee, additional studies were performed also by a group of opponents of the breeder reactor. On the instigation of the group of opponents the delivery date of the study was altered several times and finally set at April 30, 1982. GRS submitted its report by this deadline. However, a joint report by the two groups could not be compiled, as had been requested by the client, because the contributions of the opponents were not made available until mid-May 1982 and then only as an 'interim report'. In summary, the GRS study indicates that the frequency and severity of major accidents is lower for the SNR-300 at the Kalkar site than for a PWR as covered in the German Nuclear Power Plant Risk Study. (orig.) [de

Computer system organization the B5700/B6700 series

CERN Document Server

Organick, Elliott I

1973-01-01

Computer System Organization: The B5700/B6700 Series focuses on the organization of the B5700/B6700 Series developed by Burroughs Corp. More specifically, it examines how computer systems can (or should) be organized to support, and hence make more efficient, the running of computer programs that evolve with characteristically similar information structures.Comprised of nine chapters, this book begins with a background on the development of the B5700/B6700 operating systems, paying particular attention to their hardware/software architecture. The discussion then turns to the block-structured p

Component Based System Framework for Dynamic B2B Interaction

NARCIS (Netherlands)

Hu jinmin, Jinmin; Grefen, P.W.P.J.

Business-to-Business (B2B) collaboration is becoming a pivotal way to bring today's enterprises to success in the dynamically changing e-business environment. Though many business-to-business protocols are developed to support B2B interaction, none are generally accepted. A B2B system should support

First observation of B(s)(0) --> D(s)(+/-)K(-/+) and measurement of the ratio of branching fractions B(B(s)(0) --> D(s)(+/-)K(-/+)/B(B(s)(0) --> D(s)(+)pi(-)).

Science.gov (United States)

Aaltonen, T; Adelman, J; Akimoto, T; Albrow, M G; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzurri, P; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Bednar, P; Beecher, D; Behari, S; Bellettini, G; Bellinger, J; Benjamin, D; Beretvas, A; Beringer, J; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Bridgeman, A; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Calancha, C; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavaliere, V; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Copic, K; Cordelli, M; Cortiana, G; Cox, D J; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lorenzo, G; Dell'Orso, M; Deluca, C; Demortier, L; Deng, J; Deninno, M; Derwent, P F; di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Elagin, A; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Genser, K; Gerberich, H; Gerdes, D; Gessler, A; Giagu, S; Giakoumopoulou, V; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; James, E; Jayatilaka, B; Jeon, E J; Jha, M K; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Keung, J; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Knuteson, B; Ko, B R; Koay, S A; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kreps, M; Kroll, J; Krop, D; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhr, T; Kulkarni, N P; Kurata, M; Kusakabe, Y; Kwang, S; Laasanen, A T; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, E; Lee, H S; Lee, S W; Leone, S; Lewis, J D; Lin, C S; Linacre, J; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, C; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lovas, L; Lu, R-S; Lucchesi, D; Lueck, J; Luci, C; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis-Katsikakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzione, A; Merkel, P; Mesropian, C; Miao, T; Miladinovic, N; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moggi, N; Moon, C S; Moore, R; Morello, M J; Morlok, J; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oakes, L; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Pianori, E; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Pueschel, E; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rodriguez, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, A; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shiraishi, S; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spreitzer, T; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thompson, G A; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Totaro, P; Tourneur, S; Tu, Y; Turini, N; Ukegawa, F; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner-Kuhr, J; Wagner, W; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Xie, S; Yagil, A; Yamamoto, K; Yamaoka, J; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zheng, Y; Zucchelli, S

2009-11-06

A combined mass and particle identification fit is used to make the first observation of the decay B(s)(0) --> D(s)(+/-)K(-/+) and measure the branching fraction of B(s)(0) --> D(s)(+/-)K(-/+) relative to B(s)(0) --> D(s)(+)pi(-). This analysis uses 1.2 fb(-1) integrated luminosity of pp collisions at square root(s) = 1.96 TeV collected with the CDF II detector at the Fermilab Tevatron collider. We observe a B(s)(0) --> D(s)(+/-)K(-/+) signal with a statistical significance of 8.1 sigma and measure B(B(s)(0) --> D(s)(+/-)K(-/+) /B(B(s)(0) --> D(s)(+)pi(-) 0.097+/-0.018(stat) +/- 0.009(syst).

Measurement of the ratio of branching fractions ${\\cal B}(B^0 \\to K^{\\ast 0} \\gamma)/{\\cal B}(B^0_s \\to \\phi \\gamma)$

CERN Document Server

Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2012-01-01

The ratio of branching fractions of the radiative $B$ decays $B^0\\to K^{*0}\\gamma$ and $B^0_s\\to \\phi\\gamma$ has been measured using $0.37\\,$fb$^{-1}$ of $pp$ collisions at a centre of mass energy of $\\sqrt{s}=7\\,$TeV, collected by the LHCb experiment. The value obtained is \\begin{equation} \\frac{{\\cal B}(B^0\\to K^{*0}\\gamma)}{{\\cal B}(B^0_s\\to \\phi\\gamma)} = 1.12 \\pm 0.08^{+0.06}_{-0.04}\\phantom{.}^{+0.09}_{-0.08},\

In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

Directory of Open Access Journals (Sweden)

Basić Zorica

2011-01-01

Full Text Available Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the characteristics of the process (saturability, reversibility and competitivness. Methods. The specific and sensitive HPLC method with fluorescent detector was used for determination of vitamins B1, B2 and B6. Analyte separation and detection were carried out by applying the reverse-phase method on column C18. An in vitro experiment was done by testing the influence of pH value (2 and 7, concentration of vitamin solution (1, 2 and 5 mg/L, the lenght of contact with zeolite (10-180 min and cation competitiveness on the exchange capacity, which is achieved by media and zeolite contact, as well as a possible vitamins desorption through changing pH value of the solution at 37°C. Jon competitiveness was examined by adding commercial feed mixture (grower with a defined content of the examined vitamines in zeolite solutions the pH = 2 and pH = 7. Results. Vitamins B1, B2 and B6 were stable in both pH=2 and pH = 7 solutions at 37°C, in the defined time intervals. In acid solution concentrations of vitamins significantly declined in the first 10 min, with no significant decline in further 30 min for all the three concentrations testch. In neutral solution, after the addition of 1% zeolite, decrease in vitamins concentrations was slightly lower than in acid solution, but also significant in the first 10 min of the contact with zeolite. It was found that zeolite, which adsorbed vitamins in acid solution, transferred in the neutral one released a significant quantity of adsorbed

Evidence for idiotypic- and antiidiotypic B-B cellular interaction with the use of cloned antiidiotypic B cell line.

Science.gov (United States)

Bitoh, S; Fujimoto, S; Yamamoto, H

1990-03-15

Immunization of BALB/c mice with MOPC104E myeloma protein induces antiidiotypic B lymphocytes that have Id-specific enhancing activity on antibody production. The B-B cell interaction was restricted to both Igh and class II MHC. However, anti-Thy-1 and C-treated splenic B cells were maintained for more than 1 y in a mixture of Con A-stimulated splenocyte culture supernatant and synthetic medium. In applying the long term culture method, we have established a cloned B cell line named B19-1d, B19-1d cells are specific to MOPC104E or J558 cross-reactive Id and they express surface mu, lambda but no Ly-1. B19-1d do not spontaneously secrete Ig but produce them upon stimulation with bacterial LPS. The effect of B19-1d cell line on idiotypic antibody production was tested. Addition of only 10 to 100 B19-1d cells into dextran-immune B cell culture greatly enhanced the Id+ antidextran antibody responses. On the contrary, the antidextran antibody production was suppressed by the higher doses of B19-1d cells. The effective cooperation between dextran-immune B cells and B19-1d cloned B cells was restricted to class II MHC. The role of idiotypic- and antiidiotypic B-B cell interaction in immune regulation and repertoire generation was suggested.

B2B Models for DoD Acquisition

Science.gov (United States)

2007-07-30

product design, demand forecasting, asset management, and sales and marketing plans 35 Proctor & Gamble’s Private Industrial Network SOURCE: Laudon... B2B Models for DoD Acquisition 30 July 2007 by Magdi N. Kamel, Associate Professor Graduate School of Operational & Information Sciences...number. 1. REPORT DATE 30 JUL 2007 2. REPORT TYPE 3. DATES COVERED 00-00-2007 to 00-00-2007 4. TITLE AND SUBTITLE B2B Models for DoD

B{sub c} → B{sub sJ} form factors and B{sub c} decays into B{sub sJ} in covariant light-front approach

Energy Technology Data Exchange (ETDEWEB)

Shi, Yu-Ji; Zhao, Zhen-Xing [Shanghai Jiao-Tong University, INPAC, Shanghai Key Laboratory for Particle Physics and Cosmology, Department of Physics and Astronomy, Shanghai (China); Wang, Wei [Shanghai Jiao-Tong University, INPAC, Shanghai Key Laboratory for Particle Physics and Cosmology, Department of Physics and Astronomy, Shanghai (China); Chinese Academy of Sciences, State Key Laboratory of Theoretical Physics, Institute of Theoretical Physics, Beijing (China)

2016-10-15

We suggest to study the B{sub s} and its excitations B{sub sJ} in the B{sub c} decays. We calculate the B{sub c} → B{sub sJ} and B{sub c} → B{sub J} form factors within the covariant light-front quark model, where the B{sub sJ} and B{sub J} denote an s-wave or p-wave anti bs and anti bd meson, respectively. The form factors at q{sup 2} = 0 are directly computed while their q{sup 2}-distributions are obtained by extrapolation. The derived form factors are then used to study semileptonic B{sub c} → (B{sub sJ}, B{sub J}) anti lν decays, and nonleptonic B{sub c} → B{sub sJ}π. Branching fractions and polarizations are predicted in the standard model. We find that the branching fractions are sizable and might be accessible at the LHC experiment and future high-energy e{sup +}e{sup -} colliders with a high luminosity at the Z-pole. The future experimental measurements are helpful to study the nonperturbative QCD dynamics in the presence of a heavy spectator and also of great value for the study of spectroscopy. (orig.)

On the safety of French nuclear power plants. Zur Sicherheit der franzoesischen Kernkraftwerke

Energy Technology Data Exchange (ETDEWEB)

Anon,

1990-04-01

An allegedly secret report by the inspector general for nuclear safety, of EDF, has recently been unearthed and published by the French weekly 'Le Canard Enchaine, and the response in France, and very soon after also in West Germany, has been a number of alarming reports and articles in the press. Readers in West Germany have been stirred up by press reports that made French nuclear power plants appear to be a herd of hazards, which of course again added fuel to the feeling of fear of nuclear power already existing in the population. A copy of the internal report in question was sent without any fuss upon request by the atw editorial office who was preparing the interview. The report is a sober account of the state and operating behaviour of French nuclear power plants, also stating weak points seen by the safety expert that need particular attention. Materials are a main aspect in this context, particularly the materials behaviour in steam raising units. The problems have been spotted, and are given due attention. (orig./HP).

Foxp1 controls mature B cell survival and the development of follicular and B-1 B cells

Science.gov (United States)

Patzelt, Thomas; Keppler, Selina J.; Gorka, Oliver; Thoene, Silvia; Wartewig, Tim; Reth, Michael; Förster, Irmgard; Lang, Roland; Buchner, Maike; Ruland, Jürgen

2018-01-01

The transcription factor Foxp1 is critical for early B cell development. Despite frequent deregulation of Foxp1 in B cell lymphoma, the physiological functions of Foxp1 in mature B cells remain unknown. Here, we used conditional gene targeting in the B cell lineage and report that Foxp1 disruption in developing and mature B cells results in reduced numbers and frequencies of follicular and B-1 B cells and in impaired antibody production upon T cell-independent immunization in vivo. Moreover, Foxp1-deficient B cells are impaired in survival even though they exhibit an increased capacity to proliferate. Transcriptional analysis identified defective expression of the prosurvival Bcl-2 family gene Bcl2l1 encoding Bcl-xl in Foxp1-deficient B cells, and we identified Foxp1 binding in the regulatory region of Bcl2l1. Transgenic overexpression of Bcl2 rescued the survival defect in Foxp1-deficient mature B cells in vivo and restored peripheral B cell numbers. Thus, our results identify Foxp1 as a physiological regulator of mature B cell survival mediated in part via the control of Bcl-xl expression and imply that this pathway might contribute to the pathogenic function of aberrant Foxp1 expression in lymphoma. PMID:29507226

Measurement of the decays B--> phiK and B--> phiK*.

Science.gov (United States)

Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Y; Lees, J P; Robbe, P; Tisserand, V; Palano, A; Chen, G P; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Reinertsen, P L; Stugu, B; Abbott, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Clark, A R; Fan, Q; Gill, M S; Gowdy, S J; Gritsan, A; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kluth, S; Kolomensky, Y G; Kral, J F; LeClerc, C; Levi, M E; Liu, T; Lynch, G; Meyer, A B; Momayezi, M; Oddone, P J; Perazzo, A; Pripstein, M; Roe, N A; Romosan, A; Ronan, M T; Shelkov, V G; Telnov, A V; Wenzel, W A; Bright-Thomas, P G; Harrison, T J; Hawkes, C M; Kirk, A; Knowles, D J; O'Neale, S W; Penny, R C; Watson, A T; Watson, N K; Deppermann, T; Koch, H; Krug, J; Kunze, M; Lewandowski, B; Peters, K; Schmuecker, H; Steinke, M; Andress, J C; Barlow, N R; Bhimji, W; Chevalier, N; Clark, P J; Cottingham, W N; De Groot, N; Dyce, N; Foster, B; Mass, A; McFall, J D; Wallom, D; Wilson, F F; Abe, K; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Camanzi, B; Jolly, S; McKemey, A K; Tinslay, J; Blinov, V E; Bukin, A D; Bukin, D A; Buzykaev, A R; Dubrovin, M S; Golubev, V B; Ivanchenko, V N; Korol, A A; Kravchenko, E A; Onuchin, A P; Salnikov, A A; Serednyakov, S I; Skovpen, Y I; Telnov, V I; Yushkov, A N; Lankford, A J; Mandelkern, M; McMahon, S; Stoker, D P; Ahsan, A; Arisaka, K; Buchanan, C; Chun, S; Branson, J G; MacFarlane, D B; Prell, S; Rahatlou, S; Raven, G; Sharma, V; Campagnari, C; Dahmes, B; Hart, P A; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Richman, J D; Verkerke, W; Witherell, M; Yellin, S; Beringer, J; Dorfan, D E; Eisner, A M; Frey, A; Grillo, A A; Grothe, M; Heusch, C A; Johnson, R P; Kroeger, W; Lockman, W S; Pulliam, T; Sadrozinski, H; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Metzler, S; Oyang, J; Porter, F C; Ryd, A; Samuel, A; Weaver, M; Yang, S; Zhu, R Y; Devmal, S; Geld, T L; Jayatilleke, S; Mancinelli, G; Meadows, B T; Sokoloff, M D; Bloom, P; Fahey, S; Ford, W T; Gaede, F; Johnson, D R; Michael, A K; Nauenberg, U; Olivas, A; Park, H; Rankin, P; Roy, J; Sen, S; Smith, J G; van Hoek, W C; Wagner, D L; Blouw, J; Harton, J L; Krishnamurthy, M; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Brandt, T; Brose, J; Colberg, T; Dahlinger, G; Dickopp, M; Dubitzky, R S; Maly, E; Müller-Pfefferkorn, R; Otto, S; Schubert, K R; Schwierz, R; Spaan, B; Wilden, L; Behr, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Ferrag, S; Roussot, E; T'Jampens, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Anjomshoaa, A; Bernet, R; Di Lodovico, F; Khan, A; Muheim, F; Playfer, S; Swain, J E; Falbo, M; Bozzi, C; Dittongo, S; Folegani, M; Piemontese, L; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Xie, Y; Zallo, A; Bagnasco, S; Buzzo, A; Contri, R; Crosetti, G; Fabbricatore, P; Farinon, S; Lo Vetere, M; Macri, M; Monge, M R; Musenich, R; Pallavicini, M; Parodi, R; Passaggio, S; Pastore, F C; Patrignani, C; Pia, M G; Priano, C; Robutti, E; Santroni, A; Morii, M; Bartoldus, R; Dignan, T; Hamilton, R; Mallik, U; Cochran, J; Crawley, H B; Fischer, P A; Lamsa, J; Meyer, W T; Rosenberg, E I; Benkebil, M; Grosdidier, G; Hast, C; Höcker, A; Lacker, H M; LePeltier, V; Lutz, A M; Plaszczynski, S; Schune, M H; Trincaz-Duvoid, S; Valassi, A; Wormser, G; Bionta, R M; Brigljevic, V; Fackler, O; Fujino, D; Lange, D J; Mugge, M; Shi, X; van Bibber, K; Wenaus, T J; Wright, D M; Wuest, C R; Carroll, M; Fry, J R; Gabathuler, E; Gamet, R; George, M; Kay, M; Payne, D J; Sloane, R J; Touramanis, C; Aspinwall, M L; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gunawardane, N J; Martin, R; Nash, J A; Sanders, P; Smith, D; Azzopardi, D E; Back, J J; Dixon, P; Harrison, P F; Potter, R J; Shorthouse, H W; Strother, P; Vidal, P B; Williams, M I; Cowan, G; George, S; Green, M G; Kurup, A; Marker, C E; McGrath, P; McMahon, T R; Ricciardi, S; Salvatore, F; Scott, I; Vaitsas, G; Brown, D; Davis, C L; Allison, J; Barlow, R J; Boyd, J T; Forti, A; Fullwood, J; Jackson, F; Lafferty, G D; Savvas, N; Simopoulos, E T; Weatherall, J H; Farbin, A; Jawahery, A; Lillard, V; Olsen, J; Roberts, D A; Schieck, J R; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Lin, C S; Moore, T B; Staengle, H; Willocq, S; Wittlin, J; Brau, B; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Britton, D I; Milek, M; Patel, P M; Trischuk, J; Lanni, F; Palombo, F; Bauer, J M; Booke, M; Cremaldi, L; Eschenburg, V; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Martin, J P; Nief, J Y; Seitz, R; Taras, P; Zacek, V; Nicholson, H; Sutton, C S; Cartaro, C; Cavallo, N; De Nardo, G; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; LoSecco, J M; Alsmiller, J R; Gabriel, T A; Handler, T; Brau, J; Frey, R; Iwasaki, M; Sinev, N B; Strom, D; Colecchia, F; Dal Corso, F; Dorigo, A; Galeazzi, F; Margoni, M; Michelon, G; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Torassa, E; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; De La Vaissière, C; Del Buono, L; Hamon, O; Le Diberder, F; Leruste, P; Lory, J; Roos, L; Stark, J; Versillé, S; Manfredi, P F; Re, V; Speziali, V; Frank, E D; Gladney, L; Guo, Q H; Panetta, J H; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Martinez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Simi, G; Triggiani, G; Walsh, J; Haire, M; Judd, D; Paick, K; Turnbull, L; Wagoner, D E; Albert, J; Bula, C; Lu, C; McDonald, K T; Miftakov, V; Schaffner, S F; Smith, A J; Tumanov, A; Varnes, E W; Cavoto, G; del Re, D; Faccini, R; Ferrarotto, F; Ferroni, F; Fratini, K; Lamanna, E; Leonardi, E; Mazzoni, M A; Morganti, S; Piredda, G; Safai Tehrani, F; Serra, M; Voena, C; Christ, S; Waldi, R; Adye, T; Franek, B; Geddes, N I; Gopal, G P; Xella, S M; Aleksan, R; De Domenico, G; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel De Monchenault, G; Kozanecki, W; Langer, M; London, G W; Mayer, B; Serfass, B; Vasseur, G; Yeche, C; Zito, M; Copty, N; Purohit, M V; Singh, H; Yumiceva, F X; Adam, I; Anthony, P L; Aston, D; Baird, K; Bartelt, J; Bloom, E; Boyarski, A M; Bulos, F; Calderini, G; Claus, R; Convery, M R; Coupal, D P; Coward, D H; Dorfan, J; Doser, M; Dunwoodie, W; Field, R C; Glanzman, T; Godfrey, G L; Grosso, P; Himel, T; Huffer, M E; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W; Luitz, S; Luth, V; Lynch, H L; Manzin, G; Marsiske, H; Menke, S; Messner, R; Moffeit, K C; Mount, R; Muller, D R; O'Grady, C P; Petrak, S; Quinn, H; Ratcliff, B N; Robertson, S H; Rochester, L S; Roodman, A; Schietinger, T; Schindler, R H; Schwiening, J; Serbo, V V; Snyder, A; Soha, A; Spanier, S M; Stahl, A; Stelzer, J; Su, D; Sullivan, M K; Talby, M; Tanaka, H A; Trunov, A; Va'vra, J; Wagner, S R; Weinstein, A J; Wisniewski, W J; Young, C C; Burchat, P R; Cheng, C H; Kirkby, D; Meyer, T I; Roat, C; De Silva, A; Henderson, R; Bugg, W; Cohn, H; Hart, E; Weidemann, A W; Benninger, T; Izen, J M; Kitayama, I; Lou, X C; Turcotte, M; Bianchi, F; Bona, M; Di Girolamo, B; Gamba, D; Smol, A; Zanin, D; Bosisio, L; Della Ricca, G; Lanceri, L; Pompili, A; Poropat, P; Prest, M; Vallazza, E; Vuagnin, G; Panvini, R S; Brown, C M; Kowalewski, R; Roney, J M; Band, H R; Charles, E; Dasu, S; Elmer, P; Hu, H; Johnson, J R; Liu, R; Nielsen, J; Orejudos, W; Pan, Y; Prepost, R; Scott, I J; Sekula, S J; von Wimmersperg-Toeller, J H; Wu, S L; Yu, Z; Zobering, H; Kordich, T M; Neal, H

2001-10-08

We have observed the decays B--> phiK and phiK(*) in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are B(B+--> phiK+) = (7.7(+1.6)(-1.4)+/-0.8)x10(-6), B(B0--> phiK0) = (8.1(+3.1)(-2.5)+/-0.8)x10(-6), B(B+--> phiK(*+)) = (9.7(+4.2)(-3.4)+/-1.7)x10(-6), and B(B0--> phiK(*0)) = (8.7(+2.5)(-2.1)+/-1.1)x10(-6). We also report the upper limit B(B+--> phipi(+))<1.4x10(-6) ( 90% C.L.).

Measurements of $B^{0}-\\overline{B}^{0}$ Mixing, $\\Gamma(Z^{0} \\to b\\overline{b}) / \\Gamma (Z^{0} \\to$ Hadrons) and Semileptonic Branching Ratios for $b$-Flavoured Hadrons in Hadronic $Z^{0}$ Decays

CERN Document Server

Akers, R J; Allison, J; Anderson, K J; Arcelli, S; Astbury, Alan; Axen, D A; Azuelos, Georges; Baines, J T M; Ball, A H; Banks, J; Barlow, R J; Barnett, S; Bartoldus, R; Batley, J Richard; Beaudoin, G; Beck, A; Beck, G A; Becker, J; Beeston, C; Behnke, T; Bell, K W; Bella, G; Bentkowski, P; Berlich, P; Bethke, Siegfried; Biebel, O; Bloodworth, Ian J; Bock, P; Boden, B; Bosch, H M; Boutemeur, M; Breuker, Horst; Bright-Thomas, P G; Brown, R M; Buijs, A; Burckhart, Helfried J; Burgard, C; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chu, S L; Clarke, P E L; Clayton, J C; Cohen, I; Conboy, J E; Cooper, M; Coupland, M; Cuffiani, M; Dado, S; Dallavalle, G M; De Jong, S; del Pozo, L A; Deng, H; Dieckmann, A; Dittmar, Michael; Dixit, M S; do Couto e Silva, E; Duboscq, J E; Duchovni, E; Duckeck, G; Duerdoth, I P; Dumas, D J P; Elcombe, P A; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fabbro, B; Fierro, M; Fincke-Keeler, Margret; Fischer, H M; Fong, D G; Foucher, M; Gaidot, A; Gary, J W; Gascon, J; Geddes, N I; Geich-Gimbel, C; Gensler, S W; Gentit, F X; Giacomelli, G; Giacomelli, R; Gibson, V; Gibson, W R; Gillies, James D; Goldberg, J; Gingrich, D M; Goodrick, M J; Gorn, W; Grandi, C; Grant, F C; Hagemann, J; Hanson, G G; Hansroul, M; Hargrove, C K; Harrison, P F; Hart, J; Hattersley, P M; Hauschild, M; Hawkes, C M; Heflin, E; Hemingway, Richard J; Herten, G; Heuer, R D; Hill, J C; Hillier, S J; Hilse, T; Hinshaw, D A; Hobbs, J D; Hobson, P R; Hochman, D; Homer, R James; Honma, A K; Hughes-Jones, R E; Humbert, R; Igo-Kemenes, P; Ihssen, H; Imrie, D C; Janissen, A C; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Jones, M; Jones, R W L; Jovanovic, P; Jui, C; Karlen, D A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; King, J; Kluth, S; Kobayashi, T; Koetke, D S; Kokott, T P; Komamiya, S; Kral, J F; Kowalewski, R V; Von Krogh, J; Kroll, J; Kyberd, P; Lafferty, G D; Lafoux, H; Lahmann, R; Lamarche, F; Lauber, J; Layter, J G; Leblanc, P; Lee, A M; Lefebvre, E; Lehto, M H; Lellouch, Daniel; Leroy, C; Letts, J; Levinson, L; Lloyd, S L; Loebinger, F K; Lorah, J M; Lorazo, B; Losty, Michael J; Lou, X C; Ludwig, J; Luig, A; Mannelli, M; Marcellini, S; Markus, C; Martin, A J; Martin, J P; Mashimo, T; Mättig, P; Maur, U; McKenna, J A; McMahon, T J; McNutt, J R; Meijers, F; Menszner, D; Merritt, F S; Mes, H; Michelini, Aldo; Middleton, R P; Mikenberg, G; Mildenberger, J L; Miller, D J; Mir, R; Mohr, W; Moisan, C; Montanari, A; Mori, T; Morii, M; Müller, U; Nellen, B; Nguyen, H H; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oram, C J; Oreglia, M J; Orito, S; Pansart, J P; Panzer-Steindel, B; Paschievici, P; Patrick, G N; Paz-Jaoshvili, N; Pearce, M J; Pfister, P; Pilcher, J E; Pinfold, James L; Pitman, D; Plane, D E; Poffenberger, P R; Poli, B; Pritchard, T W; Przysiezniak, H; Quast, G; Redmond, M W; Rees, D L; Richards, G E; Rison, M; Robins, S A; Robinson, D; Rollnik, A; Roney, J M; Ros, E; Rossberg, S; Rossi, A M; Rosvick, M; Routenburg, P; Runge, K; Runólfsson, O; Rust, D R; Sasaki, M; Sbarra, C; Schaile, A D; Schaile, O; Schappert, W; Scharf, F; Scharff-Hansen, P; Schenk, P; Schmitt, B; von der Schmitt, H; Schröder, M; Schwick, C; Schwiening, J; Scott, W G; Settles, M; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Skillman, A; Skuja, A; Smith, A M; Smith, T J; Snow, G A; Sobie, Randall J; Springer, R W; Sproston, M; Stahl, A; Stegmann, C; Stephens, K; Steuerer, J; Ströhmer, R; Strom, D; Takeda, H; Takeshita, T; Tarem, S; Tecchio, M; Teixeira-Dias, P; Tesch, N; Thomson, M A; Torrente-Lujan, E; Towers, S; Tranströmer, G; Tresilian, N J; Tsukamoto, T; Turner, M F; Van den Plas, D; Van Kooten, R; VanDalen, G J; Vasseur, G; Wagner, A; Wagner, D L; Wahl, C; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Weber, M; Weber, P; Wells, P S; Wermes, N; Whalley, M A; Wilkens, B; Wilson, G W; Wilson, J A; Winterer, V H; Wlodek, T; Wolf, G; Wotton, S A; Wyatt, T R; Yaari, R; Yeaman, A; Yekutieli, G; Yurko, M; Zeuner, W; Zorn, G T

1993-01-01

Measurements of $B^{0}-\\overline{B}^{0}$ Mixing, $\\Gamma(Z^{0} \\to b\\overline{b}) / \\Gamma (Z^{0} \\to$ Hadrons) and Semileptonic Branching Ratios for $b$-Flavoured Hadrons in Hadronic $Z^{0}$ Decays

Contextualized B2B Registries

OpenAIRE

Radetzki, U; Boniface, M.J.; Surridge, M.

2007-01-01

Abstract. Service discovery is a fundamental concept underpinning the move towards dynamic service-oriented business partnerships. The business process for integrating service discovery and underlying registry technologies into busi-ness relationships, procurement and project management functions has not been examined and hence existing Web Service registries lack capabilities required by business today. In this paper we present a novel contextualized B2B registry that supports dynamic regist...

Evaluation of immunogenicity and safety of Genevac B: A new recombinant hepatitis b vaccine in comparison with Engerix B and Shanvac B in healthy adults

Directory of Open Access Journals (Sweden)

Vijayakumar V

2004-01-01

Full Text Available PURPOSE: Genevac B, a new indigenous recombinant hepatitis B vaccine was evaluated for its immunogenicity and safety in comparison with Engerix B (Smithkline Beecham Biologicals, Belgium and Shanvac B (Shantha Biotechnics, India in healthy adult volunteers. METHODS: While 240 study subjects were included in the Genevac B group, 80 each were the subjects for Engerix B and Shanvac B. A three dose regimen of 0,1,2 months was adopted with 20 gm dosage uniformly in all the three groups. Vaccinees were assessed during prevaccination, followup and post vaccination periods for clinical, haematological, biochemical and immunological parameters for safety and immunogenicity. RESULTS: Successful follow-up in all parameters for four months could be achieved in 92.5% (222/240 for Genevac B study subjects and the same was 85% (68/80 and 80% (64/80 for Engerix B and Shanvac B respectively. While 100% seroconversion was observed in all the three groups, the rate of seroprotectivity was 99.5% by Genevac B, 98.5% by Engerix B and 98.4% for Shanvac B. However the difference was not statistically significant (p>0.05. The GMT values of anti HBs after one month of completion of the vaccination were 735.50, 718.23 and 662.20 mIU/mL respectively. No systemic reaction was either seen or reported by the volunteers during the vaccination process of Genevac B and other two vaccines. Clinical, haematological and biochemical safety parameters remained within normal limits throughout the study period. CONCLUSION: The study confirms that Genevac B, the new recombinant Hepatitis B vaccine has the acceptable international standards of safety and immunogenicity.

Seasonal behaviour of B0 and B1

International Nuclear Information System (INIS)

Mosert Gonzalez, M. de; Radicella, S.M.

1997-01-01

A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

Test and maintenance of the emergency power supply in the nuclear power plant Biblis

International Nuclear Information System (INIS)

Kotthoff, K.; Huren, H.

1986-01-01

Besides design and construction test and maintenance play an important role for the availability of the emergency power supply. As an example test and maintenance provided for the emergency power supply in a German 4-loop PWR will be described. In general one has to differentiate between test and maintenance performed during power operation of the plant and those carried out during the refuelling outage. For both periods of operation detailed information will be given including type, extent and frequency of test and maintenance work. The results of test and maintenance up to now will be discussed. (authors)

Test and maintenance of the emergency power supply in the nuclear power plant Biblis

Energy Technology Data Exchange (ETDEWEB)

Kotthoff, K. [Gesellschaft fuer Reaktorsicherheit - GRS mbH, Schwertnergasse 1, D-5000 Koeln 1, Cologne (Germany); Huren, H. [Rheinisch-Westfaelisches Elektrizitaetswerk AG, Betriebsverwaltung Biblis, Biblis (Germany)

1986-02-15

Besides design and construction test and maintenance play an important role for the availability of the emergency power supply. As an example test and maintenance provided for the emergency power supply in a German 4-loop PWR will be described. In general one has to differentiate between test and maintenance performed during power operation of the plant and those carried out during the refuelling outage. For both periods of operation detailed information will be given including type, extent and frequency of test and maintenance work. The results of test and maintenance up to now will be discussed. (authors)

Poemat Parmenidesa. Fragmenty B 9-17, B 19

Directory of Open Access Journals (Sweden)

Kazimierz Mrówka

2012-06-01

Full Text Available This is a new translation of the Fragments of Parmenides of Elea, the fifth century B.C. thinker. The text includes: a Greek poem with the fragments B 9-17, B 19, a critical apparatus which takes into consideration some new editions and a new English translation.

B2B Integration in Global Supply Chains

DEFF Research Database (Denmark)

Schubert, Petra; Legner, Christine

2011-01-01

The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...

Observation of the decay $B_c^+ \\to B_s^0 \\pi^+$

CERN Document Server

Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Cheung, S -F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

2013-01-01

The result of a search for the decay $B_c^+ \\to B_s^0 \\pi^+$ is presented, using the $B_s^0 \\to D_s^- \\pi^+$ and $B_s^0 \\to J/\\psi \\phi$ channels. The analysis is based on a data sample of pp collisions collected with the LHCb detector, corresponding to an integrated luminosity of 1 fb$^{-1}$ taken at a center-of-mass energy of 7 TeV, and 2 fb$^{-1}$ taken at 8 TeV. The decay $B_c^+ \\to B_s^0 \\pi^+$ is observed with significance in excess of five standard deviations independently in both decay channels. The measured product of the ratio of cross-sections and branching fraction is $\\sigma(B_c^+)/\\sigma(B_s^0) \\times \\mathcal{B}(B_c^+ \\to B_s^0 \\pi^+) = (2.37 \\pm 0.31 (\\text{stat}) \\pm 0.11 (\\text{syst}) ^{+0.17}_{-0.13} (\\tau_{B_c^+})) \\times 10^{-3}$ in the pseudorapidity range $2 < \\eta(B) < 5$, where the first uncertainty is statistical, the second is systematic and the third is due to the uncertainty on the $B_c^+$ lifetime. This is the first observation of a $B...

Measurement of the $\\bar{B}^{0}$ and $B^{-}$ Meson Lifetimes

CERN Document Server

Barate, R.; Ghez, Philippe; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Greening, T.C.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Halley, A.W.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Teixeira-Dias, P.; Thompson, A.S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Thomson, Evelyn J.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C.K.; Buck, P.G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Giehl, I.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Aleppo, M.; Ragusa, F.; Dietl, H.; Ganis, G.; Heister, A.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, Ph.; Jacholkowska, A.; Le Diberder, F.; Lefrancois, J.; Lutz, A.M.; Schune, M.H.; Veillet, J.J.; Videau, I.; Yuan, C.; Zerwas, D.; Bagliesi, Giuseppe; Boccali, T.; Calderini, G.; Ciulli, V.; Foa, L.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciaba, A.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Strong, J.A.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S.N.; Dann, J.H.; Johnson, R.P.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Rothberg, J.; Wasserbaech, S.; Armstrong, S.R.; Cranmer, K.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.

2000-01-01

The lifetimes of the B0 and B- mesons are measured using a sample of about four million hadronic Z decays collected from 1991 to 19 95 with the ALEPH detector at LEP. The data sample has been recently reprocessed, achieving a substantial improvement in the tracking performance. Semileptonic decays of B0 and B- mesons are partially reconstructed by identifying events containing a lepton with an associated D* or D0 meson. The proper time of the B meson is estimated from the measured decay length and the momentum of the D-lepton system. A fit to the proper time of 1880 D* l- and 2856 D0 l- candidates yields the following results: tau B0 = 1.518 +- 0.053 +- 0.034 ps, tau B- = 1.648 +- 0.049 +- 0.035 ps, tau B- / tau B0 = 1.085 +- 0.059 +- 0.018.

[Diagnosis for human parvovirus B19-polyarthritis: usefulness of empty particle B19.ELISA and B19-DNA.PCR].

Science.gov (United States)

Hatakeyama, Y; Ishii, K; Murai, C; Sugamura, K; Mitomo, N; Saitoh, T; Rikimaru, Y; Okazaki, T; Sasaki, T

1998-10-01

To evaluate the usefulness of new ELISA for human parvovirus B19 (B19) antibodies and PCR for the diagnosis of acute onset of B19 polyarthritis. We evaluated the reproducibility and sensitivity on the detection of anti-B19 antibody by ELISA using recombinant VP-1 and VP-2 (empty particle), and then studied for the prevalence of IgM and IgG B19 antibody in 125 samples for anti-B19 tests. The random study on anti-B19 antibody assay as well as PCR for B19-DNA was also performed in 130 cases with acute onset of arthritis excluding those with known origins, 224 with rheumatoid arthritis and 149 with other categories. The results by using B19-empty particle ELISA were reproducible and showed the assay was a sensitive way for clinical use. IgM anti-B19 antibodies were positive not only in all samples from erythema infectiosum, but also often in those from hemolytic anemia, pure red cell aplasia, fetal hydrops, hepatic injury, fever of unknown origin. Among 130 with acute onset of arthritis, 21 showed positive tests for IgM anti-B19 antibody and/or B19 DNA. On the other hand, 4 among 224 patients with rheumatoid arthritis were positive for IgM anti-B19 antibody, but all of 149 in control group were negative for IgM anti-B19 antibodies and for B19 DNA. Anti-B19 ELISA using B19-empty particle which has been introduced as a routine test system, is a useful tool for the diagnosis of acute onset of B19 arthritis. An additional examination using PCR for B19 DNA may contribute for understanding persistent B19 polyarthritis or reactivation of B19 infection.

Measurement of the Xi(-)(b) and Omega(-)(b) baryon lifetimes

NARCIS (Netherlands)

Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Onderwater, G.; Pellegrino, A.

2014-01-01

Using a data sample of pp collisions corresponding to an integrated luminosity of 3 fb(-1), the Xi(-)(b) and Omega(-)(b) baryons are reconstructed in the Xi(-)(b) -> J/psi Xi(-) and Omega(-)(b) -> J/psi Omega(-) decay modes and their lifetimes measured to be tau(Xi(-)(b)) = 1.55(-0.09)(+0.10) (stat)

Boosted Higgses from chromomagnetic $b$'s: $b\\bar{b}h$ at high luminosity

CERN Document Server

Bramante, Joseph; Lehman, Landon; Martin, Adam

2016-01-01

This paper examines detection prospects and constraints on the chromomagnetic dipole operator for the bottom quark. This operator has a flavor, chirality and Lorentz structure that is distinct from other dimension six operators considered in Higgs coupling studies. Its non-standard Lorentz structure bolsters boosted $b \\bar{b} h$ events, providing a rate independent signal of new physics. To date, we find this operator is unconstrained by $p p \\rightarrow h + {\\rm jets}$ and $pp \\rightarrow \\bar b b $ searches: for order-one couplings the permitted cutoff $\\Lambda$ for this operator can be as low as $\\Lambda \\sim 1~{\\rm TeV}$. We show how to improve this bound with collider cuts that allow a $b$-tagged Higgs plus dijet search in the Higgs to diphoton decay channel to exclude cutoffs as high as $\\sim 6~{\\rm TeV}$ at $2 \\sigma$ with 3 $\\text{ab}^{-1}$ of luminosity at the 14 TeV LHC. Cuts on the $p_T$ of the Higgs are key to this search, because the chromomagnetic dipole yields a non-standard fraction of booste...

Five years of partnership programme between German and East European nuclear power plant operators

International Nuclear Information System (INIS)

Kraemer, P.

1995-01-01

In a jointly adopted communique in August 1992 the regulations governing the partnerships were laid down. The following principles are given priority: bilateral exchange of operating experience on the basis of equal partnership; the knowledge gained from the exchange of experience is used to improve the operation and safety of the respective partner plant; the partnership programme is free from commercial interests and does not include transfer of funds. Since the establishment of the first partnership relations (Biblis) with an east european nuclear power plant (Balakowo) late in April 1990, a total of 126 reciprocal visits was paid, 82 of which to German nuclear power plants. The balance of the efforts made by German nuclear power plant operators to integrate east european nuclear plant operators can be considered positive. (orig./HP) [de

Investigation of the transfer of 90Sr, 137Cs, 60Co, and 54Mn from soil to plant, and of the main soil parameters that have influence on the transfer process

International Nuclear Information System (INIS)

Steffens, W.; Fuehr, F.; Mittelstaedt, W.; Klaes, J.; Foerstel, H.

1988-12-01

In lysimetric field experiments with 2 soil types most common in the Federal Republic of Germany the effects of a continuous contamination as well as of a temporary contamination of the soil caused by a possible accident were simulated to allow forecastings on the resorption of radionuclides by farm plants. Parallel pot experiments (8 kg of soil) in greenhouses and in the field and small pot experiments under reproducible climatic chamber conditions were to examine wether or not transfer data from laboratory and pot experiments can be applied to field conditions. In addition to this, soil types representative according to soil mapping were taken from the locations of the nuclear power plants Biblis and Stade, and their properties were determined. In large-scale comparative pot experiments the relative transfer factors were determined. (orig./DG) [de

The contribution of deontological Christian ethics to the contemporary human rights discourse

Directory of Open Access Journals (Sweden)

J. M. Vorster

2009-07-01

Full Text Available This article examines the possible role of a Christian deonto- logical ethics in the contemporary human rights debate. It concludes that a Christian deontological ethics in the Reformed tradition can be positively engaged in the human rights debate when Biblical theological topics are transposed into moral directives applicable to the current human rights concerns, such as religious extremism, femicide, ideologies of intolerance and ecocide. As an example of the applicability of a Christian deon- tological ethics from a reformed perspective, the following Bibli- cal topics are investigated: human dignity on the basis of the “imago dei”, creation and creational integrity, the kingdom of God and forgiveness. Furthermore, the article proposes that other concepts can be added to this list such as the Biblical idea of life, eschatology, covenant and holiness.

Bibliometrics, informetrics, scientometrics and other "Metric" in Brazil

Directory of Open Access Journals (Sweden)

Ruben Urbizagastegui

2016-09-01

Full Text Available http://dx.doi.org/10.5007/1518-2924.2016v21n47p51 Analyze the demographics of the published literature on "bibliometric studies" produced by Brazilian and foreign authors in Brazil from 1973 to 2012. Types of documents, journals and congresses most used to communicate the results of investigations are analyzed. The most productive authors were identified. 2,300 papers published until December 2012 by 3,320 authors were found. More common are papers published in academic journals (60% and papers presented at congresses and conferences (36.5%. Predominately, documents area published in Portuguese (87%. The journals with the largest number of published papers are Ciência da Informação, Scientometrics, Encontros Bibli and Perspectivas em Ciência da Informação.

God kemi B

DEFF Research Database (Denmark)

Johannesson, Anne Boie

God kemi B indeholder fire forløb: "Byg en bro", "Tyggegummi", "Hovedpinepiller" og "Konserveringsmidler", der virker som en inspirerende og elevaktiverende ramme omkring kemiundervisningen på B-niveau.......God kemi B indeholder fire forløb: "Byg en bro", "Tyggegummi", "Hovedpinepiller" og "Konserveringsmidler", der virker som en inspirerende og elevaktiverende ramme omkring kemiundervisningen på B-niveau....

Hepatitis B (HBV)

Science.gov (United States)

... Staying Safe Videos for Educators Search English Español Hepatitis B KidsHealth / For Teens / Hepatitis B What's in ... Prevented? Print en español Hepatitis B What Is Hepatitis B? Hepatitis B is an infection of the ...

Improved measurement of the B 0 and B + meson lifetimes

Science.gov (United States)

Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J. P.; Lucotte, A.; Minard, M. N.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Juste, A.; Martinez, M.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Cattaneo, M.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Palla, F.; Pater, J. R.; Pusztaszeri, J. F.; Ranjard, F.; Rensing, P.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Wildish, T.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rossignol, J. M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Rensch, B.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H. G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Abt, I.; Assmann, R.; Bauer, C.; Blum, W.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Jakobs, K.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H. G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J. F.; Heusse, Ph.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A. M.; Nikolic, I.; Park, H. J.; Park, I. C.; Schune, M. H.; Simion, S.; Veillet, J. J.; Videau, I.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Walsh, J.; Blair, G. A.; Bryant, L. M.; Cerutti, F.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J. F.; Roussarie, A.; Schuller, J. P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Büscher, V.; Cowan, G.; Grupen, C.; Lutters, G.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Bellantoni, L.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Harton, J. L.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I. J.; Sharma, V.; Walsh, A. M.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.

1996-03-01

The lifetimes of the B 0 and B + mesons have been measured with the Aleph detector at LEP, using approximately 3 million hadronic Z decays collected in the period 1991 1994. In the first of three methods, semileptonic decays of B 0 and B + mesons were partially reconstructed by identifying events containing a lepton with an associated D*- orbar D^0 meson. The second method used fully reconstructed B 0 and B + mesons. The third method, used to measure the B 0 lifetime, employed a partial reconstruction technique to identify B 0→ D*- π + X decays. The combined results are begin{gathered} tau _0 = 1.55 ± 0.06 ± 0.03 ps, \\ tau _ + = 1.58 ± 0.09 ± 0.03 ps, \\ tfrac{{tau _ + }}{{tau _0 }} = 1.03 ± 0.08 ± 0.02. \\ .

Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

Directory of Open Access Journals (Sweden)

Pierluigi Sabbatini

2012-04-01

Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.         JEL Codes: D23, L86Keywords: Cost, Transaction Costs, Transactions

Measurement of the $\\bar{B}^0-B^0$ and $\\bar{B}^0_s-B^0_s$ production asymmetries in $pp$ collisions at $\\sqrt{s}=7$ TeV

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-01-01

The $\\bar{B}^0-B^0$ and $\\bar{B}^0_s-B^0_s$ production asymmetries, $A_\\mathrm{P}(B^0)$ and $A_\\mathrm{P}(B^0_s)$, are measured by means of a time-dependent analysis of $B^0 \\to J/\\psi K^{*0}$, $B^0 \\to D^- \\pi^+$ and $B^0_s \\to D_s^- \\pi^+$ decays, using a data sample corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by LHCb in $pp$ collisions at a centre-of-mass energy of 7 TeV. The measurements are performed as a function of transverse momentum and pseudorapidity of the $B^0$ and $B^0_s$ mesons within the LHCb acceptance. The production asymmetries, integrated over $p_\\mathrm{T}$ and $\\eta$ in the range $4 < p_\\mathrm{T} < 30$ GeV/c and $2.5<\\eta<4.5$, are determined to be $A_\\mathrm{P}(B^0) = (-0.35 \\pm 0.76 \\pm 0.28)\\%$ and $A_\\mathrm{P}(B^0_s) = (1.09 \\pm 2.61 \\pm 0.66)\\%$, where the first uncertainties are statistical and the second systematic.

A measurement of the b bar b cross section at CDF

International Nuclear Information System (INIS)

Yu, I.

1994-08-01

We report a measurement of the b bar b cross section at CDF from the 1992--1993 run of the Tevatron Collider. Dimuon events from inclusive b → μ decays of b bar b pairs are used to obtain the cross section as a function of P T (b 1 ) and P T (b 2 ). The results are compared to the predictions of next-to-leading order QCD and are found to be consistent

Supply with the vitamins B1, B2 and B6 in carcinomas before and after radiotherapy

International Nuclear Information System (INIS)

Grimm, U.; Wulff, K.; Schmidt, W.

1983-01-01

In 108 breast cancer, 63 cervix carcinoma, 35 corpus carcinoma and 15 ovarial cancer patients the erythrocyte transketolase, gluthathione reductase and aspartate aminotransferase activity were determined as parameters for the supply with vitamin B 1 , B 2 and B 6 before and after radiotherapy. The effects of thiamine pyrophosphate determined in cancer patients were normal but the effects of flavin adenine dinucleotide and pyridoxal-5-phosphate were significantly increased compared to the controls. These results revealed radiation-induced disorders in the B 2 metabolism and tumor-induced disorders in the B 6 metabolism. Both disorders can be avoided by treatment with vitamin B complex. (author)

Managing Innovation Through Social Media in B2B SME-Context

DEFF Research Database (Denmark)

Lutz, Salla; Madsen, Svend Ole; Brink, Tove

2015-01-01

This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business mode...

Measurement of the decays B --> phi K and B --> K*

International Nuclear Information System (INIS)

Aubert, B.

2001-01-01

We have observed the decays B → phi K and phi K* in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are BF(B + → phi K + ) = (7.7 -1.4 +1.6 +/- 0.8) x 10 -6 , BF(B 0 → phi K 0 ) =(8.1 -2.5 +3.1 +/- 0.8) x 10 -6 , BF(B + → phi K* + ) = (9.7 -3.4 +4.2 +/- 1.7) x 10 -6 , and BF(B 0 → phi K* 0 ) = (8.6 -2.4 +2.8 +/- 1.1) x 10 -6 . We also report the upper limit BF(B + → phi pi + ) -6 (90 percent CL)

Observation of the Heavy Baryons Sigma b and Sigma b*.

Science.gov (United States)

Aaltonen, T; Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Cilijak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; DaRonco, S; Datta, M; D'Auria, S; Davies, T; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Dörr, C; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraan, A C; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis, A; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tesarek, R J; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuno, S; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vazquez, F; Velev, G; Vellidis, C; Veramendi, G; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

2007-11-16

We report an observation of new bottom baryons produced in pp collisions at the Tevatron. Using 1.1 fb(-1) of data collected by the CDF II detector, we observe four Lambda b 0 pi+/- resonances in the fully reconstructed decay mode Lambda b 0-->Lambda c + pi-, where Lambda c+-->pK* pi+. We interpret these states as the Sigma b(*)+/- baryons and measure the following masses: m Sigma b+=5807.8 -2.2 +2.0(stat.)+/-1.7(syst.) MeV/c2, m Sigma b- =5815.2+/-1.0(stat.)+/-1.7(syst.) MeV/c2, and m(Sigma b*)-m(Sigma b)=21.2-1.9 +2.0(stat.)-0.3+0.4(syst.) MeV/c2.

Measurement of the B+ and B0 meson lifetimes

International Nuclear Information System (INIS)

Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Done, J.P.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huston, J.; Huth, J.

1994-01-01

The lifetimes of the B + and B 0 mesons have been measured using fully reconstructed decays. In a sample of ∼49 600J/ψ→μ + μ - decays recorded with the Collider Detector at Fermilab, 148±16 B + and 121±16B 0 mesons have been reconstructed using the silicon vertex detector. Unbinned likelihood fits to the proper lifetime distributions of these B mesons give τ + =1.61±0.16 (stat)±0.05 (syst) ps, τ 0 =1.57±0.18 (stat) ±0.08 (syst) ps, and τ + /τ 0 =1.02±0.16 (stat) ±0.05 (syst)

The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)

Science.gov (United States)

Jacobson, Nathan S.; Myers, Dwight L.

2011-01-01

The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.

A Precise Measurement of the $B^{+}, B^{0}$ and Mean b-hadron Lifetime with the DELPHI Detector at LEP I

CERN Document Server

Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Hansen, J; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verbeure, F; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zinchenko, A I; Zupan, M

2004-01-01

Final results from the DELPHI Collaboration on the lifetime of B+ and B0 mesons and the mean b-hadron lifetime, are presented using the data collected at the Z0 peak in 1994 and 1995. Elaborate, inclusive, secondary vertexing methods have been employed to ensure a b-hadron reconstruction with good efficiency. To separate samples of B+ and B0 mesons, high performance neural network techniques are used that achieve very high purity signals. The results obtained are: tau_B+ = 1.624 +/- 0.014 (stat) +/- 0.018 (syst) ps tau_B0 = 1.531 +/- 0.021 (stat) +/- 0.031 (syst) ps tau_B+/tau_B0 = 1.060 +/- 0.021 (stat) +/- 0.024 (syst) and for the average b-hadron lifetime: tau_b = 1.570 +/- 0.005 (stat) +/- 0.008 (syst) ps.

On the possibility to detect the Higgs decay H → b anti b in the associated Z + b anti b production at the LHC

International Nuclear Information System (INIS)

Lipatov, A.V.; Zotov, N.P.

2015-01-01

We investigate the possibility to detect the scalar Higgs boson decay H → b anti b in the associated Z and b anti b production at the LHC using the k T -factorization QCD approach. Our consideration is based on the off-shell (i.e. depending on the transverse momenta of initial quarks and gluons) production amplitudes of q* anti q* → ZH → Zq' anti q', q* anti q* → Zq' anti q', and g*g* → Zq' anti q' partonic subprocesses supplemented with the Catani.Ciafoloni.Fiorani. Marchesini (CCFM) dynamics of parton densities in a proton. We argue that the H → b anti b signal could be observed at large transverse momenta near the Higgs boson peak despite the overwhelming QCD background, and we point out the important role of angular correlations between the produced Z boson and b-quarks. (orig.)

Scope of Internal Marketing in B2B Companies

OpenAIRE

Nigam, Niharika

2007-01-01

Abstract Previous studies have focused on "internal marketing" from services marketing perspective. There is, therefore, a great dearth of in-depth research on its application to other business types. This research attempts to find the scope of internal marketing in B2B companies. The purpose of this research is to closely examine the elements, their linkage, tools and applications of Internal marketing when applied to B2B settings. Internal marketing, the application of marketing managem...

Measurement of the mass splittings between the b{bar b}{chi}{sub b,J}(1P) states

Energy Technology Data Exchange (ETDEWEB)

Edwards, K.W.; Edwards, K.W. [Institute of Particle Physics (Canada); Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M. [Institute of Particle Physics (Canada); Sadoff, A.J. [Ithaca College, Ithaca, New York,14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L. [University of Kansas, Lawrence, Kansas, 66045 (United States); Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A. [University of Minnesota, Minneapolis, Minnesota, 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York, 12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio, 43210 (United States); Richichi, S.J.; Severini, H.; Skubic, P. [University of Oklahoma, Norman, Oklahoma, 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana, 47907 (United States); Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York, 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California, 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas, 75275 (United States); Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; and others

1999-02-01

We present new measurements of photon energies and branching fractions for the radiative transitions {Upsilon}(2S){r_arrow}{gamma}{chi}{sub b(J=0,1,2)}(1P). The masses of the {chi}{sub b} states are determined from the measured radiative photon energies. The ratio of mass splittings between the {chi}{sub b} substates, r{equivalent_to}(M{sub J=2}{minus}M{sub J=1})/(M{sub J=1}{minus}M{sub J=0}), with M the {chi}{sub b} mass, provides information on the nature of the b{bar b} confining potential. We find r(1P)=0.542{plus_minus}0.022{plus_minus}0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P){lt}r(2P); i.e., that this mass splitting ratio is smaller for the {chi}{sub b}(1P) states than for the {chi}{sub b}(2P) states. {copyright} {ital 1999} {ital The American Physical Society}

Haemophilia B

DEFF Research Database (Denmark)

Gater, Adam; Thomson, Thomas; Strandberg-Larsen, Martin

2011-01-01

-effectiveness of such interventions. Although a rare disease, as economic constraints for healthcare increase, generating further information regarding the key clinical, patient and economic outcomes associated with haemophilia B will be essential for supporting improvements in care for people with haemophilia B....... documenting the patient and economic burden associated with haemophilia B and current methods of disease management. Both the immediate and long-term clinical consequences of haemophilia B can have significant implications for patients in terms of functional limitations and diminished health-related quality...

B decays

CERN Document Server

Stone, Sheldon

1994-01-01

This book reviews the study of b quarks and also looks at the implications of future studies. The most important observations thus far - including measurement of the ""B"" lifetime and observations of b -> u transitions - as well as the more mundane results of hadronic and semileptonic transitions are described in detail by experimentalists who have been closely involved with the measurements. Theoretical progress in understanding b quark decays, including the mechanisms of hadronic and semileptonic decays, are described. Synthesizing the experimental and theoretical information, the authors d

Scale-up operations of CuSOB4B-NaB2BSOB4B electrolytic ...

African Journals Online (AJOL)

Scale-up techniques were established for an Inclined Cathode Electrochemical Cell (ICEC) for the removal of copper ions from a CuSOB4B-NaB2BSOB4B solution at reduced operation power consumption. The scale-up relationshi-ps were derived and applied in conjunction with scale-up factors. With a scale-up factor of 2, ...

Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

DEFF Research Database (Denmark)

Waskowska, A.; Gerward, L.; Staun Olsen, J.

2011-01-01

(4)GPa). No pressure-induced phase transformations are observed in any of the above borides up to about 20GPa. A continuous temperature-driven orthorhombic distortion is observed for HoB4 below 285K. Values of the thermal expansion coefficient are reported for ScB2 and HoB4 at 293, 200 and 100K...

Measurement of the $\\Xi_b^-$ and $\\Omega_b^-$ baryon lifetimes

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jezabek, Marek; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-01-01

Using a data sample of pp collisions corresponding to an integrated luminosity of $3~ \\rm fb^{-1}$, the $\\Xi_b^-$ and $\\Omega_b^-$ baryons are reconstructed in the $\\Xi_b^- \\rightarrow J/\\psi \\Xi^-$ and $\\Omega_b^- \\rightarrow J/\\psi \\Omega^-$ decay modes and their lifetimes measured to be $\\tau (\\Xi_b^-) = 1.55\\, ^{+0.10}_{-0.09}~{\\rm(stat)} \\pm 0.03\\,{\\rm(syst)}$ ps, $\\tau (\\Omega_b^-) = 1.54\\, ^{+0.26}_{-0.21}~{\\rm(stat)} \\pm 0.05\\,{\\rm(syst)}$ ps. These are the most precise determinations to date. Both measurements are in good agreement with previous experimental results and with theoretical predictions.

Search for the Radiative Decays B-> rho gamma and B->omega gamma

International Nuclear Information System (INIS)

Convery, Mark R

2003-01-01

A search for the exclusive radiative decays B → ρ(770)γ and B 0 → ω(782)γ is performed on a sample of about 84 million B(bar B) events collected by the BABAR detector at the PEP-II asymmetric-energy e + e - storage ring. No significant signal is seen in any of the channels. We set upper limits on the branching fractions Β of Β(B 0 → ρ 0 γ) -6 , Β(B + → ρ + γ) -6 , and Β(B 0 → ωγ) -6 at 90% confidence level (C.L.). Using the assumption that Λ(B → ργ) = Λ(B + → ρ + γ) = 2 x Λ(B 0 → ρ 0 γ), they find the combined limit Β(B → ργ) -6 , corresponding to Β(B → ργ)/Β(B → ργ)/Β(B → K*γ) < 0.047 at 90% C.L

Cosima B2B - Sales Automation for E-Procurement

OpenAIRE

Kießling, Werner (Prof. Dr.); Fischer, Stefan; Döring, Sven

2006-01-01

E-procurement is one of the fastest growing application areas for e-commerce. Though B2B transaction costs could be reduced recently by establishing XML based standards for electronic product catalogs and data interchange, B2B sales costs are still high due to the amount of human interaction. For the first time we present a fully automated electronic sales agent for e-procurement portals. The key technologies for this breakthrough are based on preferences modeled as strict partial orders, ena...

Absorption kinetics and action profiles of subcutaneously administered insulin analogues (AspB9GluB27, AspB10, AspB28) in healthy subjects.

Science.gov (United States)

Kang, S; Brange, J; Burch, A; Vølund, A; Owens, D R

1991-11-01

The subcutaneous absorption and resulting changes in plasma insulin or analogue, glucose, C-peptide, and blood intermediary metabolite concentrations after subcutaneous bolus injection of three soluble human insulin analogues (AspB9GluB27, monomeric; AspB28, mixture of monomers and dimers; and AspB10, dimeric) and soluble human insulin were evaluated. Fasting healthy male volunteers (n = 7) were studied on five occasions 1 wk apart randomly receiving 0.6 nmol.kg-1 s.c. 125I-labeled AspB10 or soluble human insulin (Novolin R, Novo, Copenhagen); 1st study and 0.6 nmol.kg-1 s.c. 125I-labeled AspB28, AspB9GluB27 or soluble human insulin (2nd study). Residual radioactivity at the injection site was measured over 8 h with frequent venous sampling for plasma immunoreactive insulin or analogue, glucose, C-peptide, and blood intermediary metabolite concentrations. The three analogues were absorbed 2-3 times faster than human insulin. The mean +/- SE time to 50% residual radioactivity was 94 +/- 6 min for AspB10 compared with 184 +/- 10 min for human insulin (P less than 0.001), 83 +/- 8 min for AspB28 (P less than 0.005), and 63 +/- 9 min for AspB9GluB27 (P less than 0.001) compared with 182 +/- 21 min for human insulin. delta Peak plasma insulin analogue levels were significantly higher after each analogue than after human insulin (P less than 0.005). With all three analogues, the mean hypoglycemic nadir occurred earlier at 61-65 min postinjection compared with 201-210 min for the reference human insulins (P less than 0.005). The magnitude of the hypoglycemic nadir was greater after AspB9GluB27 (P less than 0.05) and AspB28 (P less than 0.001) compared with human insulin. There was a significantly faster onset and offset of responses in C-peptide and intermediary metabolite levels after the analogues than after human insulin (P less than 0.05). The rapid absorption and biological actions of these analogues offer potential therapeutic advantages over the current short

Perinatal hepatitis B virus detection by hepatitis B virus-DNA analysis.

OpenAIRE

De Virgiliis, S; Frau, F; Sanna, G; Turco, M P; Figus, A L; Cornacchia, G; Cao, A

1985-01-01

Maternal transmission of hepatitis B virus infection in relation to the hepatitis B e antigen/antibody system and serum hepatitis B virus-DNA were evaluated. Results indicate that hepatitis B virus-DNA analysis can identify hepatitis B serum antigen positive mothers who may transmit infection to their offspring.

Hepatitis B Foundation

Science.gov (United States)

... worldwide 2 Billion People have been infected with Hepatitis B Worldwide The Hepatitis B Foundation is working ... of people living with hepatitis B. Learn About Hepatitis B in 11 Other Languages . Resource Video See ...

$Z_b(10650)$ and $Z_b(10610)$ states in a chiral quark model

OpenAIRE

Li, M. T.; Wang, W. L.; Dong, Y. B.; Zhang, Z. Y.

2012-01-01

We perform a systematic study of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ systems by using effective interaction in our chiral quark model. Our results show that the interactions of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ states are attractive, which consequently result in $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ bound states. The recent observed exotic-like hadrons of $Z_b(10610)$ and $Z_b(10650)$ are, therefore in our approach,...

High-resolution gamma spectroscopy with whole-body and partial-body counters. Experience, recommendations. Report; Hochaufloesende Gamma-Spektrometrie an Ganz- und Teilkoerperzaehlern. Erfahrungen, Empfehlungen. Bericht

Energy Technology Data Exchange (ETDEWEB)

Sahre, P. [comp.

1997-12-01

The application of high-resolution gamma spectroscopy with whole-body and partial-body counters shows a steadily rising upward trend over the last few years. This induced the ``Arbeitskreis Inkorporationsueberwachung`` of the association ``Fachverband fuer Strahlenschutz e.V.`` to organise a meeting for joint elaboration of a guide on recommended applications of this measuring technique, based on a review of existing experience and results. A key item on the agenda of the meeting was the comparative evaluation of the Ge semiconductor detector and the NaI solid scintillation detector. (orig./CB) [Deutsch] Der Einsatz der hochaufloesenden Gammaspektroskopie in Ganz- und Teilkoerperzaehlern hat in den letzten Jahren stetig zugenommen. Der ``Arbeitskreis Inkorporationsueberwachung`` des Fachverbandes fuer Strahlenschutz e.V. hat darum bisherige Erfahrungen zusammengetragen und Empfehlungen fuer den Einsatz dieser Messtechnik erarbeitet. Der Schwerpunkt der Tagung lag beim Vergleich von Germaniumhalbleiter- mit Natriumjodid-Festszintillationsdetektoren.Tl-Detektoren eignen sich v.a. beim Vorhandensein bekannter und zeitlich konstanter Nuklidvektoren (Kernkraftwerke, Nuklearmedizin). Bei unbekanntem bzw. variablem Nuklidvektor (Stoerfall, Unfall, Forschung) sollen Ge-Detektoren benutzt werden (orig./ABI)

Nuclear power: Hour of fog producers; Atomkraft: Stunde der Nebelwerfer

Energy Technology Data Exchange (ETDEWEB)

Rauner, M.; Schuh, H.

2004-03-04

Seven advanced nuclear power plants in Germany can withstand a frontal crash by a full-tanked Jumbo-Jet. But for five older plants even smaller planes can cause an hazard impossible to control. A fog generation around the power plants, favorized by operators and politicians, to camouflage this plants against terroristic flights is absurd because of the possibility of flight automation. However terrorists may attack reactors also from the ground, but how they can do is top secret. (GL) [German] Einem frontalen Aufprall eines voll getankten Jumbo-Jets mit hoher Geschwindigkeit koennen in Deutschland sieben moderne Kernkraftwerke standhalten. Bei fuenf aelteren Modellen kann dagegen selbst ein kleineres Flugzeug ein schwer beherrschbares Unglueck ausloesen. Obwohl Experten eine vorzeitige Schliessung solch alter Meiler fuer realistisch halten, ist die Verhandlungslage aufgrund ideologischer Einfluesse verfahren. Die von Betreibern und Politikern gern gepriesenen Nebelwerfer zur Tarnung der Kraftwerke sind wegen der Moeglichkeit des Instrumentenfluges sinnlos. Die beste Abwehr bieten vorgelagerte Schutzbauten aus Beton. Jedoch koennen Terroristen Reaktoren auch vom Boden aus gefaehrden, wie, ist natuerlich geheim.

Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

Energy Technology Data Exchange (ETDEWEB)

Peuser, M.M.

2008-07-01

On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

$b$-Tagging and Large Radius Jet Modelling in a $g\\rightarrow b\\bar{b}$ rich sample at ATLAS

CERN Document Server

Jiang, Zihao; The ATLAS collaboration

2016-01-01

Studies of b-tagging performance and jet properties in double b-tagged, large radius jets from sqrt(s)=8 TeV pp collisions recorded by the ATLAS detector at the LHC are presented. The double b-tag requirement yields a sample rich in high pT jets originating from the g->bb process. Using this sample, the performance of b-tagging and modelling of jet substructure variables at small b-quark angular separation is probed.

Evolution, development, and communication of branding in B2B markets

OpenAIRE

Seyedghorban, Zahra

2017-01-01

While, branding was traditionally viewed as having limited significance in business-to-business (B2B) markets, existing research not only acknowledges its existence, but emphasises its strategic importance in enhancing organisations’ competitive positions and financial performance. Given the fragmented research on B2B branding, there is a need to first provide a comprehensive review of B2B branding literature as a field of study by conducting a bibliometric investigation (Essay 1). The result...

B-cell-intrinsic hepatitis C virus expression leads to B-cell-lymphomagenesis and induction of NF-κB signalling.

Directory of Open Access Journals (Sweden)

Yuri Kasama

Full Text Available Hepatitis C virus (HCV infection leads to the development of hepatic diseases, as well as extrahepatic disorders such as B-cell non-Hodgkin's lymphoma (B-NHL. To reveal the molecular signalling pathways responsible for HCV-associated B-NHL development, we utilised transgenic (Tg mice that express the full-length HCV genome specifically in B cells and develop non-Hodgkin type B-cell lymphomas (BCLs. The gene expression profiles in B cells from BCL-developing HCV-Tg mice, from BCL-non-developing HCV-Tg mice, and from BCL-non-developing HCV-negative mice were analysed by genome-wide microarray. In BCLs from HCV-Tg mice, the expression of various genes was modified, and for some genes, expression was influenced by the gender of the animals. Markedly modified genes such as Fos, C3, LTβR, A20, NF-κB and miR-26b in BCLs were further characterised using specific assays. We propose that activation of both canonical and alternative NF-κB signalling pathways and down-regulation of miR-26b contribute to the development of HCV-associated B-NHL.

Hepatitis B Test

Science.gov (United States)

... Links Patient Resources For Health Professionals Subscribe Search Hepatitis B Testing Send Us Your Feedback Choose Topic At ... Known As HBV Tests Hep B anti-HBs Hepatitis B Surface Antibody HBsAg Hepatitis B Surface Antigen HBeAg ...

Direct Involvement of ombB, omaB and omcB Genes in Extracellular Reduction of Fe(III by Geobacter sulfurreducens PCA

Directory of Open Access Journals (Sweden)

Yimo eLiu

2015-10-01

Full Text Available The tandem gene clusters orfR-ombB-omaB-omcB and orfS-ombC-omaC-omcC of the metal-reducing bacterium Geobacter sulfurreducens PCA are responsible for trans-outer membrane electron transfer during extracellular reduction of Fe(III-citrate and ferrihydrite [a poorly crystalline Fe(III oxide]. Each gene cluster encodes a putative transcriptional factor (OrfR/OrfS, a porin-like outer-membrane protein (OmbB/OmbC, a periplasmic c-type cytochrome (c-Cyt, OmaB/OmaC and an outer-membrane c-Cyt (OmcB/OmcC. The individual roles of OmbB, OmaB and OmcB in extracellular reduction of Fe(III, however, have remained either uninvestigated or controversial. Here, we showed that replacements of ombB, omaB, omcB and ombB-omaB with an antibiotic gene in the presence of ombC-omaC-omcC had no impact on reduction of Fe(III-citrate by G. sulfurreducens PCA. Disruption of ombB, omaB, omcB and ombB-omaB in the absence of ombC-omaC-omcC, however, severely impaired the bacterial ability to reduce Fe(III-citrate as well as ferrihydrite. These results unequivocally demonstrate an overlapping role of ombB-omaB-omcB and ombC-omaC-omcC in extracellular Fe(III reduction by G. sulfurreducens PCA. Involvement of both ombB-omaB-omcB and ombC-omaC-omcC in extracellular Fe(III reduction reflects the importance of these trans-outer membrane protein complexes in the physiology of this bacterium. Moreover, the kinetics of Fe(III-citrate and ferrihydrite reduction by these mutants in the absence of ombC-omaC-omcC were nearly identical, which suggests that absence of any protein subunit eliminates function of OmaB/OmbB/OmcB protein complex. Finally, orfS was found to have a negative impact on the extracellular reduction of Fe(III-citrate and ferrihydrite in G. sulfurreducens PCA probably by serving as a transcriptional repressor.

Lattice dynamical and thermodynamical properties of ReB2, RuB2, and OsB2 compounds in the ReB2 structure

International Nuclear Information System (INIS)

Deligoz, E.; Colakoglu, K.; Ciftci, Y. O.

2012-01-01

Structural and lattice dynamical properties of ReB 2 , RuB 2 , and OsB 2 in the ReB 2 structure are studied in the framework of density functional theory within the generalized gradient approximation. The present results show that these compounds are dynamically stable for the considered structure. The temperature-dependent behaviors of thermodynamical properties such as internal energy, free energy, entropy, and heat capacity are also presented. The obtained results are in good agreement with the available experimental and theoretical data

Eμ/miR-125b transgenic mice develop lethal B-cell malignancies.

Science.gov (United States)

Enomoto, Y; Kitaura, J; Hatakeyama, K; Watanuki, J; Akasaka, T; Kato, N; Shimanuki, M; Nishimura, K; Takahashi, M; Taniwaki, M; Haferlach, C; Siebert, R; Dyer, M J S; Asou, N; Aburatani, H; Nakakuma, H; Kitamura, T; Sonoki, T

2011-12-01

MicroRNA-125b-1 (miR-125b-1) is a target of a chromosomal translocation t(11;14)(q24;q32) recurrently found in human B-cell precursor acute lymphoblastic leukemia (BCP-ALL). This translocation results in overexpression of miR-125b controlled by immunoglobulin heavy chain gene (IGH) regulatory elements. In addition, we found that six out of twenty-one BCP-ALL patients without t(11;14)(q24;q32) showed overexpression of miR-125b. Interestingly, four out of nine patients with BCR/ABL-positive BCP-ALL and one patient with B-cell lymphoid crisis that had progressed from chronic myelogenous leukemia overexpressed miR-125b. To examine the role of the deregulated expression of miR-125b in the development of B-cell tumor in vivo, we generated transgenic mice mimicking the t(11;14)(q24;q32) (Eμ/miR-125b-TG mice). Eμ/miR-125b-TG mice overexpressed miR-125b driven by IGH enhancer and promoter and developed IgM-negative or IgM-positive lethal B-cell malignancies with clonal proliferation. B cells obtained from the Eμ/miR-125b-TG mice were resistant to apoptosis induced by serum starvation. We identified Trp53inp1, a pro-apoptotic gene induced by cell stress, as a novel target gene of miR-125b in hematopoietic cells in vitro and in vivo. Our results provide direct evidence that miR-125b has important roles in the tumorigenesis of precursor B cells.

Getting started with Oracle SOA B2B Integration a hands-on tutorial

CERN Document Server

Bhatia, Krishnaprem; Perlovsky, Alan

2013-01-01

This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

Vitamin B6

Science.gov (United States)

... Consumer Datos en español Health Professional Other Resources Vitamin B6 Fact Sheet for Consumers Have a question? ... out more about vitamin B6? Disclaimer What is vitamin B6 and what does it do? Vitamin B6 ...

Vitamin B12

Science.gov (United States)

... Consumer Datos en español Health Professional Other Resources Vitamin B12 Fact Sheet for Consumers Have a question? ... out more about vitamin B12? Disclaimer What is vitamin B12 and what does it do? Vitamin B12 ...

Observations and modeling of the transiting exoplanets XO-2b, HAT-P-18b, and WASP-80b

Directory of Open Access Journals (Sweden)

Kjurkchieva Diana P.

2017-01-01

Full Text Available We present photometric observations and transit solutions of the exoplanets XO-2b, HAT-P-18b and WASP 80b. Our solution of the XO-2b transit gave system parameters whose values are close to those of the previous studies. The solutions of the new transits of HAT-P-18b and WASP 80b differ from the previous ones by bigger stellar and planet radii. We obtained new values of the target initial epochs corresponding to slightly different periods. Our investigation reaffirmed that small telescopes can be used successfully for the study of exoplanets orbiting stars brighter than 13 mag.

MFM study of NdFeB and NdFeB/Fe/NdFeB thin films

International Nuclear Information System (INIS)

Gouteff, P.C.; Folks, L.; Street, R.

1998-01-01

Domain structures of NdFeB thin films, ranging in thickness between 1500 and 29 nm, have been studied qualitatively by magnetic force microscopy (MFM). Samples were prepared using a range of sputtering conditions resulting in differences in properties such as texture, coercivity and magnetic saturation. MFM images of all the films showed extensive interaction domain structures, similar to those observed in nanocrystalline bulk NdFeB. An exchange-coupled NdFeB/Fe/NdFeB trilayer with layer thicknesses 18 nm/15 nm/18 nm, respectively, was also examined using MFM. (orig.)

Measurement of the ratio of branching fractions $B(B^0 \\to K^{\\ast 0} \\gamma) / B(B^0_s \\to \\phi \\gamma)$ and the direct $C\\!P$ asymmetry in $B^0 \\to K^{\\ast 0} \\gamma$

CERN Document Server

Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2013-01-01

The ratio of branching fractions of the radiative $B$ decays $B^0\\rightarrow K^{*0}\\gamma$ and $B^0_s\\rightarrow\\phi\\gamma$ has been measured using an integrated luminosity of $1.0\\mbox{fb}^{-1}$ of $pp$ collision data collected by the LHCb experiment at a centre-of-mass energy of $\\sqrt{s}=7\\mathrm{\\,Te\\kern -0.1em V}$. The value obtained is \\begin{equation*} \\frac{{\\cal B}(B^0\\rightarrow K^{*0}\\gamma)}{{\\cal B} (B^0_s\\rightarrow\\phi\\gamma)} = 1.23 \\pm 0.06\\mathrm{\\,(stat.)} \\pm 0.04\\mathrm{\\,(syst.)} \\pm 0.10\\,(f_s/f_d)\\,, \\end{equation*} where the first uncertainty is statistical, the second is the experimental systematic uncertainty and the third is associated with the ratio of fragmentation fractions $f_s/f_d$. Using the world average value for ${\\cal{B}}(B^0\\rightarrow K^{*0}\\gamma)$, the branching fraction ${\\cal{B}}(B^0_s\\rightarrow\\phi\\gamma)$ is measured to be $(3.5\\pm 0.4)\\times10^{-5}$. The direct CP asymmetry in $B^0\\rightarrow K^{*0}\\gamma$ decays has also been measured with the same data and f...

Agent-based services for B2B electronic commerce

Science.gov (United States)

Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

2000-12-01

The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

Search for the Standard Model Higgs Boson in ZH → μ+μ-b$\\bar{b}$ Production at DØ and Evidence for the H→ b$\\bar{b}$ Decay at the Tevatron

Energy Technology Data Exchange (ETDEWEB)

Yu, Jiaming [Univ. of Michigan, Ann Arbor, MI (United States)

2014-01-01

search for ZH → μ+μ-b$\\bar{b}$ is presented, using a Run 2 dataset with an integrated luminosity of 9.7 fb^-1 collected by the DØ detector. Selected events contain at least two reconstructed jets and a Z candidate reconstructed with two opposite-sign charged muons. Random forests of decision trees are trained to distinguish between signal and background events in two orthogonal b-tag samples. The ZH → μ+μ-b$\\bar{b}$b analysis is then combined with ZH → e+e-b$\\bar{b}$ analysis. For the combined results of ZH → ℓ+ℓ-b$\\bar{b}$b, no Higgs signal is observed, limits are set on the ZH cross-section BR(H→ b$\\bar{b}$) for different Higgs masses, from 90 to 150 GeV. For a Standard Model (SM) Higgs boson of mass 125 GeV, the observed cross-section limit is 7.1 times the SM cross-section with an expected sensitivity of 5.1 times the SM cross section. The result of ZH → ℓ+ℓ-b$\\bar{b}$b channel has been combined with searches in other Higgs decay channels at the Tevatron, which led to the first evidence of H → b$\\bar{b}$.

Limits on rare B decays B → μ+μ-K± and B → μ+μ-K*0

International Nuclear Information System (INIS)

Anway-Wiese, C.

1995-07-01

The authors report on a search for flavor-changing neutral current decays of B mesons B → μ + μ - K ± and B → μ + μ - K* 0 using data obtained in the Collider Detector at Fermilab (CDF) 1992--1993 data taking run. To reduce the amount of background in the data the authors use precise tracking information from the CDF silicon vertex detector to pinpoint the location of the decay vertex of the B candidate, and accept only events which have a large decay time. They compare this data to a B meson signal obtained in a similar fashion, but where the muon pairs originate from ψ decays, and calculate the relative branching ratios. In absence of any indication of flavor-changing neutral current decays they set an upper limits of BR(B → μ + μ - K ± ) -5 , and BR(B → μ + μ - K* 0 ) -5 at 90% confidence level, which are consistent with Standard Model expectations but leave little room for non-standard physics

Electronic structure of the boron fullerene B14 and its silicon derivatives B13Si(+), B13Si(-) and B12Si2: a rationalization using a cylinder model.

Science.gov (United States)

Van Duong, Long; Nguyen, Minh Tho

2016-06-29

Geometric and electronic structures of the boron cluster B14 and its silicon derivatives B13Si(+), B13Si(-), and B12Si2 were determined using DFT calculations (TPSSh/6-311+G(d)). The B12Si2 fullerene, which is formed by substituting two B atoms at two apex positions of the B14 fullerene by two Si atoms, was also found as the global minimum structure. We demonstrated that the electronic structure and orbital configuration of these small fullerenes can be predicted by the wavefunctions of a particle on a cylinder. The early appearance of high angular node MOs in B14 and B12Si2 can be understood by this simple model. Replacement of one B atom at a top position of B14 by one Si atom, followed by the addition or removal of one electron does not lead to a global minimum fullerene structure for the anion B13Si(-) and cation B13Si(+). The early appearance of the 5σ1 orbital in B13Si(+) causes a lower stability for the fullerene-type structure.

B2B Models for DoD Acquisition

National Research Council Canada - National Science Library

Kamel, Magdi N

2008-01-01

A central vision of B2B e-commerce is that of an electronic marketplace that would bring suppliers together with major buyers of goods and services for the purpose of conducting "frictionless commerce...

Decay rate ratios of Υ(5S)→B anti B reactions

International Nuclear Information System (INIS)

Hwang, Dae Sung; Son, Hyungsuk

2010-01-01

We calculate the decay rate ratios for OZI allowed decays of Υ(5S) to two B mesons by using the decay amplitudes which incorporate the wave function of the Υ(5S) state. We obtain the result that the branching ratio of the Υ(5S) decay to B s * anti B s * is much larger than the branching ratio to B s anti B s * or anti B s B s * , in good agreement with the recent experimental results of CLEO and BELLE. This agreement with the experimental results is made possible since the nodes of the Υ(5S) radial wave function induce the nodes of the decay amplitude. We find that the results for the Υ(5S) decays to B u (*) anti B u (*) or B d (*) anti B d (*) pairs are sensitive to the parameter values used for the potential between heavy quarks. (orig.)

Measurement of the masses of the $\\Xi_b^{-}$ and $\\Omega_b^{-}$

CERN Document Server

The LHCb Collaboration

2011-01-01

Preliminary measurements of the $\\Xi_b^{-}$ and $\\Omega_b^{-}$ masses are described. The decays of these bottom baryons with strangeness $\\Xi_b^{-}\\rightarrow J/\\psi \\Xi^{-}$ and $\\Omega_b^{-} \\rightarrow J/\\psi \\Omega^{-}$ are fully reconstructed. Using 0.62 fb$^{-1}$ of data collected with the LHCb detector at the LHC in 2011. \\begin{align}M (\\Xi_b^{-}) = 5796.5 \\pm 1.2 (stat) 1.2 (syst) MeV/c^2; \\\\ M(\\Omega_b^{-}) = 6050.3 \\pm 4.5 (stat) 2.2 (syst) MeV/c^2. \\\\ \\end{align}

Intrinsic Plasma Cell Differentiation Defects in B Cell Expansion with NF-κB and T Cell Anergy Patient B Cells

Directory of Open Access Journals (Sweden)

Swadhinya Arjunaraja

2017-08-01

Full Text Available B cell Expansion with NF-κB and T cell Anergy (BENTA disease is a novel B cell lymphoproliferative disorder caused by germline, gain-of-function mutations in the lymphocyte scaffolding protein CARD11, which drives constitutive NF-κB signaling. Despite dramatic polyclonal expansion of naive and immature B cells, BENTA patients also present with signs of primary immunodeficiency, including markedly reduced percentages of class-switched/memory B cells and poor humoral responses to certain vaccines. Using purified naive B cells from our BENTA patient cohort, here we show that BENTA B cells exhibit intrinsic defects in B cell differentiation. Despite a profound in vitro survival advantage relative to normal donor B cells, BENTA patient B cells were severely impaired in their ability to differentiate into short-lived IgDloCD38hi plasmablasts or CD138+ long-lived plasma cells in response to various stimuli. These defects corresponded with diminished IgG antibody production and correlated with poor induction of specific genes required for plasma cell commitment. These findings provide important mechanistic clues that help explain both B cell lymphocytosis and humoral immunodeficiency in BENTA disease.

Isothermal section of diagram of U-Mo-B and U-Re-B systems

International Nuclear Information System (INIS)

Val'ovka, I.P.; Kuz'ma, Yu.B.

1986-01-01

The methods of X-ray analysis are used to study the U-Mo-B and U-Re-B systems and to plot phase equilibrium diagrams at 1000 and 800 deg C, respectively. A formation of boride UMoB 4 (structure of the ThMoB 4 type) is confirmed in the U-Mo-B system and new compounds are found: U 2 MoB 6 (rhombic structure of the Y 2 ReB 6 type, a=0.9301(9), b=1.1434(11), c=0.3678(4) nm), ∼UMo 2 B 6 and ∼ UMo 4 B 4 with unknown structures. In the U-Re-B system besides previously known boride UReB 4 (the ThMoB 4 structure type), new ones are obtained: U 2 ReB 6 (Y 2 ReB 6 type, a=0.9373(9), b=1.1529(13), c0.3653(4) nm) and UReB 3 (hexagonal structure of the proper type, a=0.5083(1), c=0.5095(1) nm)

Variability in equatorial B0 and B1

International Nuclear Information System (INIS)

Adeniyi, J.O.; Radicella, S.M.

2002-01-01

Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

miR-200b mediates post-transcriptional repression of ZFHX1B

DEFF Research Database (Denmark)

Christoffersen, Nanna Rønbjerg; Silahtaroglu, Asli; Ørom, Ulf Lupo Andersson

2007-01-01

of E-cadherin. We show that Zfhx1b and miR-200b are regionally coexpressed in the adult mouse brain and that miR-200b represses the expression of Zfhx1b via multiple sequence elements present in the 3'-untranslated region. Overexpression of miR-200b leads to repression of endogenous ZFHX1B...

Measurement of the ratio of branching fractions $\\mathcal{B}(B_{c}^{+} \\to J/\\psi K^{+})/\\mathcal{B}(B_{c}^{+} \\to J/\\psi\\pi^{+})$

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

2016-09-27

The ratio of branching fractions $R_{K/\\pi} \\equiv \\mathcal{B}(B_{c}^{+} \\to J/\\psi K^{+})/\\mathcal{B}(B_{c}^{+} \\to J/\\psi\\pi^{+})$ is measured with $pp$ collision data collected by the LHCb experiment at centre-of-mass energies of 7 TeV and 8 TeV, corresponding to an integrated luminosity of 3${\\mbox{fb}^{-1}}$. It is found to be $ R_{K/\\pi} = 0.079\\pm0.007\\pm0.003$, where the first uncertainty is statistical and the second is systematic. This measurement is consistent with the previous LHCb result, while the uncertainties are significantly reduced.

Hepatitis B Vaccine

Science.gov (United States)

... a combination product containing Haemophilus influenzae type b, Hepatitis B Vaccine) ... combination product containing Diphtheria, Tetanus Toxoids, Acellular Pertussis, Hepatitis B, Polio Vaccine)

A Measurement of the Product Branching Ratio $f(b \\to \\Lambda_{b}).BR (\\Lambda_{b} \\to \\Lambda X)$ in $Z^{0}$ Decays

CERN Document Server

Abbiendi, G.; Alexander, G.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Darling, C.; Davis, R.; De Jong, S.; de Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hobson, P.R.; Hoch, M.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

1999-01-01

The product branching ratio, f(b->Lambda_b).BR(Lambda_b->Lambda X), where Lambda_b denotes any weakly-decaying b-baryon, has been measured using the OPAL detector at LEP. Lambda_b are selected by the presence of energetic Lambda particles in bottom events tagged by the presence of displaced secondary vertices. A fit to the momenta of the Lambda particles separates signal from B meson and fragmentation backgrounds. The measured product branching ratio is f(b->Lambda_b).BR(Lambda_b->Lambda X) = (2.67+-0.38(stat)+0.67-0.60(sy s))% Combined with a previous OPAL measurement, one obtains f(b->Lambda_b).BR(Lambda_b->Lambda X) = (3.50+-0.32(stat)+-0.35(sys ))%.

Inclusive B → Χsγ and B → Χsl+l- at the B factories

International Nuclear Information System (INIS)

Walsh, J.

2014-12-01

I report here recent measurements of observables from the inclusive decays B → Χ s γ and B → Χ s l + l - . Included are measurements of the branching fractions and CP asymmetries for both channels, as well as the forward-backward lepton asymmetry in inclusive B → Χ s l + l - decays, which is the first measurement of this quantity. (author)

High precision tracking and the measurement of B(Z → b bar b)/B(Z → hadrons) with the Mark II at the SLC

International Nuclear Information System (INIS)

Schumm, B.A.

1991-03-01

During the 1990 run of the Mark II at the SLC, the precision tracking system achieved a preliminary impact parameter resolution of 35.8 ± 1.3 μm for high momentum tracks, which is the quadrature sum of 25 ± 5 μm of intrinsic resolution smearing dominated by misalignments and other geometrical effects. A method is proposed by which this system can be used to measure B(Z → b rvec b/B(Z → hadrons)) with minimal systematic error. 6 refs., 3 figs

B physics at CDF

International Nuclear Information System (INIS)

Donati, S.

1998-09-01

B physics results from the CDF Collaboration based on data collected during the 1992-1996 Tevatron run are presented. In particular, we report the discovery of the B c meson in the semileptonic decay B c → J/ψlνX, updates of b hadrons lifetime measurements, with a description of the B s lifetime measurement, the B 0 d - anti B 0 d mixing results and the limits set on rare B decay branching ratios. Current results are used to extrapolate B physics prospects for the future high luminosity run II

Atmospheric Retrievals of HAT-P-16b and WASP-11b/HAT-P-10b

Science.gov (United States)

McIntyre, Kathleen; Harrington, Joseph; Challener, Ryan; Lenius, Maria; Hartman, Joel D.; Bakos, Gaspar A.; Blecic, Jasmina; Cubillos, Patricio E.; Cameron, Andrew

2018-01-01

We report Bayesian atmospheric retrievals performed on the exoplanets HAT-P-16b and WASP-11b/HAT-P-10b. HAT-P-16b is a hot (equilibrium temperature 1626 ± 40 K, assuming zero Bond albedo and efficient energy redistribution), 4.19 ± 0.09 Jupiter-mass exoplanet orbiting an F8 star every 2.775960 ± 0.000003 days (Buchhave et al 2010). WASP-11b/HAT-P-10b is a cooler (1020 ± 17 K), 0.487 ± 0.018 Jupiter-mass exoplanet orbiting a K3 star every 3.7224747 ± 0.0000065 days (Bakos et al. 2009, co-discovered by West et al. 2008). We observed secondary eclipses of both planets using the 3.6 μm and 4.5 μm channels of the Spitzer Space Telescope's Infrared Array Camera (program ID 60003). We applied our Photometry for Orbits, Eclipses, and Transits (POET) code to produce normalized eclipse light curves, and our Bayesian Atmospheric Radiative Transfer (BART) code to constrain the temperature-pressure profiles and atmospheric molecular abundances of the two planets. Spitzer is operated by the Jet Propulsion Laboratory, California Institute of Technology, under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NNX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.

Interface interaction in the B4C/(Fe-B-C) system

International Nuclear Information System (INIS)

Aizenshtein, M.; Mizrahi, I.; Froumin, N.; Hayun, S.; Dariel, M.P.; Frage, N.

2008-01-01

The wetting behavior in the B 4 C/(Fe-C-B) system was investigated in order to clarify the role of Fe additions on the sinterability of B 4 C. Iron and its alloys with C and B react with the boron carbide substrate and form a reaction zone consisting of a fine mixture of FeB and graphite. The apparent contact angles are relatively low for the alloys with a moderate concentration of the boron and carbon and allow liquid phase sintering to occur in the B 4 C-Fe mixtures. A dilatometric study of the sintering kinetics confirms that liquid phase sintering actually takes place and leads to improved mass transfer. A thermodynamic analysis of the ternary Fe-B-C system allows accounting for the experimental observations

Docking of B-cell epitope antigen to specific hepatitis B antibody

Indian Academy of Sciences (India)

The interaction of pres1 region of hepatitis B virus B-cell epitope antigen with specific hepatitis B neutralizing monoclonal antibody was examined by docking study. We modelled the 3D complex structure of B-cell epitope antigen residues CTTPAQGNSMFPSCCCTKPTDGNCY by homology modelling and docked it with the ...

The phosphorylation specificity of B-RAF(WT), B-RAF(D594V), B-RAF(V600E) and B-RAF(K601E) kinases: An in silico study

DEFF Research Database (Denmark)

Fratev, Filip Filipov; Jonsdottir, Svava Osk

2010-01-01

Phosphorylation of the B-RAF kinase is an essential process in tumour induction and maintenance in several cancers. Herein the phosphorylation specificity of the activation segment of the wild type B-RAF kinase and the B-RAF(D594V), B-RAF(V600E) and B-RAF(K601E) mutants was examined by molecular ...

EBI2 overexpression in mice leads to B1 B-cell expansion and chronic lymphocytic leukemia-like B-cell malignancies.

Science.gov (United States)

Niss Arfelt, Kristine; Barington, Line; Benned-Jensen, Tau; Kubale, Valentina; Kovalchuk, Alexander L; Daugvilaite, Viktorija; Christensen, Jan Pravsgaard; Thomsen, Allan Randrup; Egerod, Kristoffer L; Bassi, Maria R; Spiess, Katja; Schwartz, Thue W; Wang, Hongsheng; Morse, Herbert C; Holst, Peter J; Rosenkilde, Mette M

2017-02-16

Human and mouse chronic lymphocytic leukemia (CLL) develops from CD5 + B cells that in mice and macaques are known to define the distinct B1a B-cell lineage. B1a cells are characterized by lack of germinal center (GC) development, and the B1a cell population is increased in mice with reduced GC formation. As a major mediator of follicular B-cell migration, the G protein-coupled receptor Epstein-Barr virus-induced gene 2 ( EBI2 or GPR183 ) directs B-cell migration in the lymphoid follicles in response to its endogenous ligands, oxysterols. Thus, upregulation of EBI2 drives the B cells toward the extrafollicular area, whereas downregulation is essential for GC formation. We therefore speculated whether increased expression of EBI2 would lead to an expanded B1 cell subset and, ultimately, progression to CLL. Here, we demonstrate that B-cell-targeted expression of human EBI2 (hEBI2) in mice reduces GC-dependent immune responses, reduces total immunoglobulin M (IgM) and IgG levels, and leads to increased proliferation and upregulation of cellular oncogenes. Furthermore, hEBI2 overexpression leads to an abnormally expanded CD5 + B1a B-cell subset (present as early as 4 days after birth), late-onset lymphoid cancer development, and premature death. These findings are highly similar to those observed in CLL patients and identify EBI2 as a promoter of B-cell malignancies.

In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

OpenAIRE

Basić Zorica; Kilibarda Vesna; Dobrić Silva; Resanović Radmila

2011-01-01

Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the chara...

Extinct type of human parvovirus B19 persists in tonsillar B cells

OpenAIRE

Pyöriä, Lari; Toppinen, Mari; Mantyla, Elina; Hedman, Lea; Aaltonen, Leena-Maija; Vihinen-Ranta, Maija; Ilmarinen, Taru; Soderlund-Venermo, Maria; Hedman, Klaus; Perdomo, Maria

2017-01-01

Parvovirus B19 (B19V) DNA persists lifelong in human tissues, but the cell type harbouring it remains unclear. We here explore B19V DNA distribution in B, T and monocyte cell lineages of recently excised tonsillar tissues from 77 individuals with an age range of 2?69 years. We show that B19V DNA is most frequent and abundant among B cells, and within them we find a B19V genotype that vanished from circulation >40 years ago. Since re-infection or re-activation are unlikely with this virus type...

Measurement of e+e- → b bar b forward-backward charge asymmetry

International Nuclear Information System (INIS)

Lim Jit Ning.

1990-01-01

This dissertation describes the measurement of the forward-backward charge symmetry, A b , for e + e - → b bar b at TRISTAN by the e + e - → b bar b to the theoretical QED cross section for e + e - →μ + μ - is also obtained. A b is an effect of the weak-electromagnetic interference. The measurement of A b is therefore is the only e + e - collider in the world to explore the center-of-mass energy region of 50 GeV to 62 GeV, where the effects of weak-electromagnetic interference becomes maximum. T he data were collected between June 1987 and July 1989 with a total integrated luminosity of 33.3 pb -1 and center-of-mass energies ranging from 52 GeV to 61.8 GeV. Multihadronic events with a muon were used for the analysis. The measured values were A b = -82 ± 0.25 (stat) ± 0.14(syst.) and R b = 0.47 ± 0.12 ± 0.12 at an average center-of-mass energy of 57.2 GeV. These results were consistent with the standard model electroweak theory predictions of A b = -0.58 and R b = 0.56 at this energy. The measurement of the charge asymmetry is used to set on B 0 -bar B 0 of χ < 0.20 at the 90% confidence level

A full-potential linear-muffin-tin-orbital molecular-dynamics study of B{sub 7}, B{sub 10} and B{sub 13} clusters

Energy Technology Data Exchange (ETDEWEB)

Cao Peilin Cao; Zhao Wei; Li Baoxing; Song Bin; Zhou Xuyan [Department of Physics and State Key Laboratory of Silicon Material, Zhejiang University, Hangzhou, Zhejiang (China)

2001-06-04

The structures of B{sub 7}, B{sub 10} and B{sub 13} boron clusters are studied using the full-potential linear-muffin-tin-orbital molecular-dynamics method. Seven stable structures for B{sub 7} and fifteen for B{sub 10} have been obtained. C{sub 2h}-B{sub 10} is the most stable among the 15 structures, but C{sub 2v}-B{sub 10} is not stable. For B{sub 13}, three degenerate ground-state structures have been found. The potential surface near C{sub 2v}-B{sub 7} (ground state) and D{sub 6h}-B{sub 7} is very flat. As a fundamental unit in constructing bigger clusters, C{sub 2v}-B{sub 7} will change its form easily. The most stable structures for B{sub 7}, B{sub 10} and B{sub 13} clusters are two-dimensional (quasi-) planar clusters, rather than the three-dimensional ones. General speaking, these clusters obey the 'Aufbau principle'. (author)

Selection of operations staff, qualifications and experience

International Nuclear Information System (INIS)

Gutmann, H.

1977-01-01

Requirements and suggestions have been made by authorities and various organisations in a number of countries which define necessary experience and training for the various groups of nuclear power plant personnel. For two countries, the USA and the FRG, a comparison has been made which shows that there is only a slight deviation, taking into account the different education systems. With the example of the Biblis nuclear power plant the training on the job is described. Especially the production or operation department is looked at in more detail. The training is split up into several parts: a general part, such as nuclear physics, reactor physics and engineering, reactor safety, radiation protection and so on and a plant related part, such as arrangement and mode of operation of the plant under normal and accident conditions, license conditions and so on. (orig.) [de

Defending the Concept of Time in the Hebrew Bible

DEFF Research Database (Denmark)

Bundvad, Mette

2014-01-01

Due to the scarcity of reflection on time as an independent subject in the Hebrew Bible, there has been a scholarly tendency to consider biblical time conception more limited than our own, perhaps even nonexistent. This article confronts the scholarly skepticism regarding the ability of the bibli......Due to the scarcity of reflection on time as an independent subject in the Hebrew Bible, there has been a scholarly tendency to consider biblical time conception more limited than our own, perhaps even nonexistent. This article confronts the scholarly skepticism regarding the ability...... of the biblical authors to think about time, defending the presence of time conceptualization in the Hebrew Bible. In the article I discuss central research contributions to the subject of biblical time, in particular Sacha Stern’s thesis that the concept of time is entirely absent from the Hebrew Bible and from...

Measurement of the $e^+ e^- \\to Z \\to b\\overline{b}$ forward-backward asymmetry and the $B^{0}\\overline{B}^0$ mixing parameter using prompt leptons

CERN Document Server

Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; Easo, S; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Gratta, Giorgio; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Mount, R; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

1999-01-01

The time-integrated $\\mathrm{B}^{0}\\bar{\\mathrm{B}}^{0}$ mixing parameter and the forward-backward charge asymmetry in the process $\\mathrm{e}^{+}\\mathrm{e}^{-} \\rightarrow \\mathrm{b}\\bar{\\mathrm{b}}$ are measured in hadronic \\Z events containing prompt muons or electrons, collected by the L3 experiment in the years 1990 to 1995. The total sample of 3.3 million hadronic $\\mathrm{Z}$ events with a mean centre-of-mass energy of 91.26 GeV yields: \\begin{eqnarray*} \\mbox{$A_{\\mathrm{FB}}^{\\mathrm{b} }$} & = & 0.0960 \\pm 0.0066(stat.) \\pm 0.0033(sys.) \\,, \\\\ %corel-6 \\mbox{$\\chi_{\\mathrm{b}}$} & = & 0.1192 \\pm 0.0068(stat.) \\pm 0.0051(sys.) \\,. % \\end{eqnarray*} %%% %%% %%% %%% This asymmetry measurement together with measurements at energies away from the $\\mathrm{Z}$ pole energy yield a pole asymmetry and corresponding effective electroweak mixing angle of: \\begin{eqnarray*} \\mbox{$A_{\\mathrm{FB}}^{0,\\mathrm{b}}$} & = & 0.1015 \\pm 0.0064(stat.) \\pm 0.0035(sys.) \\,, \\\\ %corel-6.nb \\mbox{$\\...

Creating Competitive Advantage by Rethinking B2B Software Pricing

OpenAIRE

Adelstrand, Carl; Brostedt, Emil

2016-01-01

The choice of pricing model for software products is a complex procedure due to the different characteristics compared to physical products. This thesis investigates and compares software pricing models in a B2B setting, and describes how KAM plays a role in executing a pricing model. The research has been conducted as an opportunist case study on Adebro, a technology company in the B2B sector. The thesis have come to the following conclusions, with data from interviews and literature: Perpet...

WARM SPITZER PHOTOMETRY OF THREE HOT JUPITERS: HAT-P-3b, HAT-P-4b AND HAT-P-12b

Energy Technology Data Exchange (ETDEWEB)

Todorov, Kamen O. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Department of Astronomy, University of Maryland at College Park, College Park, MD 20742 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Lewis, Nikole K. [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)

2013-06-20

We present Warm Spitzer/IRAC secondary eclipse time series photometry of three short-period transiting exoplanets, HAT-P-3b, HAT-P-4b and HAT-P-12b, in both the available 3.6 and 4.5 {mu}m bands. HAT-P-3b and HAT-P-4b are Jupiter-mass objects orbiting an early K and an early G dwarf star, respectively. For HAT-P-3b we find eclipse depths of 0.112%+0.015%-0.030% (3.6 micron) and 0.094%+0.016%-0.009% (4.5 {mu}m). The HAT-P-4b values are 0.142%+0.014%-0.016% (3.6 micron) and 0.122%+0.012%-0.014% 4.5 {mu}m). The two planets' photometry is consistent with inefficient heat redistribution from their day to night sides (and low albedos), but it is inconclusive about possible temperature inversions in their atmospheres. HAT-P-12b is a Saturn-mass planet and is one of the coolest planets ever observed during secondary eclipse, along with the hot Neptune GJ 436b and the hot Saturn WASP-29b. We are able to place 3{sigma} upper limits on the secondary eclipse depth of HAT-P-12b in both wavelengths: <0.042% (3.6 {mu}m) and <0.085% (4.5 {mu}m). We discuss these results in the context of the Spitzer secondary eclipse measurements of GJ 436b and WASP-29b. It is possible that we do not detect the eclipses of HAT-P-12b due to high eccentricity, but find that weak planetary emission in these wavelengths is a more likely explanation. We place 3{sigma} upper limits on the |e cos {omega}| quantity (where e is eccentricity and {omega} is the argument of periapsis) for HAT-P-3b (<0.0081) and HAT-P-4b (<0.0042), based on the secondary eclipse timings.

Compare the Difference of B-cell Epitopes of EgAgB1 and EgAgB3 Proteins Selected through Bioinformatic Analysis

Science.gov (United States)

An, Mengting; Zhang, Fengbo; Zhu, Yuejie; Zhao, Xiao; Ding, Jianbing

2018-01-01

Cystic echinococcosis, as a zoonosis, seriously endangers humans and animals, so early diagnosis of this disease is particularly important. Therefore, this study is to predict B-cell epitopes of EgAgB1 and EgAgB3 proteins by bioinformatics software. B-cell epitopes of EgAgB1 and EgAgB3 proteins are predicted using DNAStar and IEDB software. The results suggest that there are two potential B-cell epitopes in EgAgB1, which located in the 8-15 and 31-37 amino acid residue segments. And two potential B-cell epitopes in EgAgB2, located in the 20∼27 and 47∼53 amino acid residue segments. This study predicted the B-cell epitopes of EgAgB1 and EgAgB3 proteins, which laid the foundation for the early diagnosis of Cystic echinococcosis.

On the B*'→B transition

International Nuclear Information System (INIS)

Blossier, Benoit; Gerardin, Antoine

2013-04-01

We present a first N f =2 lattice estimate of the hadronic coupling g 12 which parametrises the strong decay of a radially excited B * meson into the ground state B meson at zero recoil. We work in the static limit of Heavy Quark Effective Theory (HQET) and solve a Generalised Eigenvalue Problem (GEVP), which is necessary for the extraction of excited state properties. After an extrapolation to the continuum limit and a check of the pion mass dependence, we obtain g 12 =-0.17(4).

Hepatitis B - children

Science.gov (United States)

... B children; HBV children; Pregnancy - hepatitis B children; Maternal transmission - hepatitis B children ... growth and development. Regular monitoring plays an important role in managing the disease in children. You should ...

To be or not B2B?

CERN Document Server

Symons, L J

2001-01-01

La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

Super B Factories

Indian Academy of Sciences (India)

B factory; CP violation; B meson; supersymmetry. PACS Nos 11.30.Hv; 11.30.Pb; 12.15.Hh; 12.15.Mm; 13.20.He; 13.20.Fc;. 13.35.Dx; 14.65.Fy. 1. Introduction. The two asymmetric B factories, PEP-II and KEK-B, and their companion detec- tors, BABAR and Belle, have produced a wealth of flavor physics results, subjecting.

B implanted at room temperature in crystalline Si: B defect formation and dissolution

International Nuclear Information System (INIS)

Romano, L.; Piro, A.M.; Mirabella, S.; Grimaldi, M.G.

2005-01-01

The B lattice location of B implanted into crystalline Si at room temperature has been investigated using the nuclear reaction 11 B(p,α) 8 Be induced by 650 keV proton beam and channelling analyses. The angular scans along the and axes indicate the formation of a particular B complex with B atoms non-randomly located. The same defect has been observed also for B doped Si where the B atoms, initially substitutional and electrically active, have been displaced as consequence of the interaction with the point defects generated by proton irradiation. The angular scans were compatible with the B-B pairs aligned along the axis predicted by theoretical calculations. The thermal evolution in the 400-950 deg. C range of the B complexes has been inferred both by B lattice location measurements and electrical activation. At low temperature (<700 deg. C) only 10% of the total B dose is active and a significant increase of randomly located B occurs. A significant electrical activation consistent with the concentration of substitutional B occurs at temperature higher than 800 deg. C. The data are interpreted in terms of a formation and dissolution of the B complexes

Evidence for the strangeness-changing weak decay $\\Xi_b^-\\to\\Lambda_b^0\\pi^-$

CERN Document Server

Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavorima; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zucchelli, Stefano

2015-12-11

Using a $pp$ collision data sample corresponding to an integrated luminosity of 3.0~fb$^{-1}$, collected by the LHCb detector, we present the first search for the strangeness-changing weak decay $\\Xi_b^-\\to\\Lambda_b^0\\pi^-$. No $b$ hadron decay of this type has been seen before. A signal for this decay, corresponding to a significance of 3.2 standard deviations, is reported. The relative rate is measured to be ${{f_{\\Xi_b^-}}\\over{f_{\\Lambda_b^0}}}{\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-) = (5.7\\pm1.8^{+0.8}_{-0.9})\\times10^{-4}$, where $f_{\\Xi_b^-}$ and $f_{\\Lambda_b^0}$ are the $b\\to\\Xi_b^-$ and $b\\to\\Lambda_b^0$ fragmentation fractions, and ${\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-)$ is the branching fraction. Assuming $f_{\\Xi_b^-}/f_{\\Lambda_b^0}$ is bounded between 0.1 and 0.3, the branching fraction ${\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-)$ would lie in the range from $(0.57\\pm0.21)\\%$ to $(0.19\\pm0.07)\\%$.

Adhesive and Cohesive Strength in FeB/Fe2B Systems

Science.gov (United States)

Meneses-Amador, A.; Blancas-Pérez, D.; Corpus-Mejía, R.; Rodríguez-Castro, G. A.; Martínez-Trinidad, J.; Jiménez-Tinoco, L. F.

2018-05-01

In this work, FeB/Fe2B systems were evaluated by the scratch test. The powder-pack boriding process was performed on the surface of AISI M2 steel. The mechanical parameters, such as yield stress and Young's modulus of the boride layer, were obtained by the instrumented indentation technique. Residual stresses produced on the boride layer were estimated by using the x-ray diffraction (XRD) technique. The scratch test was performed in order to evaluate the cohesive/adhesive strength of the FeB/Fe2B coating. In addition, a numerical evaluation of the scratch test on boride layers was performed by the finite element method. Maximum principal stresses were related to the failure mechanisms observed by the experimental scratch test. Shear stresses at the interfaces of the FeB/Fe2B/substrate system were also evaluated. Finally, the results obtained provide essential information about the effect of the layer thickness, the residual stresses, and the resilience modulus on the cohesive/adhesive strength in FeB/Fe2B systems.

Study of orbitally excited $B$ mesons and evidence for a new $B\\pi$ resonance

CERN Document Server

Aaltonen, Timo Antero; Amidei, Dante E; Anastassov, Anton Iankov; Annovi, Alberto; Antos, Jaroslav; Apollinari, Giorgio; Appel, Jeffrey A; Arisawa, Tetsuo; Artikov, Akram Muzafarovich; Asaadi, Jonathan A; Ashmanskas, William Joseph; Auerbach, Benjamin; Aurisano, Adam J; Azfar, Farrukh A; Badgett, William Farris; Bae, Taegil; Barbaro-Galtieri, Angela; Barnes, Virgil E; Barnett, Bruce Arnold; Barria, Patrizia; Bartos, Pavol; Bauce, Matteo; Bedeschi, Franco; Behari, Satyajit; Bellettini, Giorgio; Bellinger, James Nugent; Benjamin, Douglas P; Beretvas, Andrew F; Bhatti, Anwar Ahmad; Bland, Karen Renee; Blumenfeld, Barry J; Bocci, Andrea; Bodek, Arie; Bortoletto, Daniela; Boudreau, Joseph Francis; Boveia, Antonio; Brigliadori, Luca; Bromberg, Carl Michael; Brucken, Erik; Budagov, Ioulian A; Budd, Howard Scott; Burkett, Kevin Alan; Busetto, Giovanni; Bussey, Peter John; Butti, Pierfrancesco; Buzatu, Adrian; Calamba, Aristotle; Camarda, Stefano; Campanelli, Mario; Canelli, Florencia; Carls, Benjamin; Carlsmith, Duncan L; Carosi, Roberto; Carrillo Moreno, Salvador; Casal Larana, Bruno; Casarsa, Massimo; Castro, Andrea; Catastini, Pierluigi; Cauz, Diego; Cavaliere, Viviana; Cavalli-Sforza, Matteo; Cerri, Alessandro; Cerrito, Lucio; Chen, Yen-Chu; Chertok, Maxwell Benjamin; Chiarelli, Giorgio; Chlachidze, Gouram; Cho, Kihyeon; Chokheli, Davit; Clark, Allan Geoffrey; Clarke, Christopher Joseph; Convery, Mary Elizabeth; Conway, John Stephen; Corbo, Matteo; Cordelli, Marco; Cox, Charles Alexander; Cox, David Jeremy; Cremonesi, Matteo; Cruz Alonso, Daniel; Cuevas Maestro, Javier; Culbertson, Raymond Lloyd; D'Ascenzo, Nicola; Datta, Mousumi; de Barbaro, Pawel; Demortier, Luc M; Marchese, Luigi; Deninno, Maria Maddalena; Devoto, Francesco; D'Errico, Maria; Di Canto, Angelo; Di Ruzza, Benedetto; Dittmann, Jay Richard; D'Onofrio, Monica; Donati, Simone; Dorigo, Mirco; Driutti, Anna; Ebina, Koji; Edgar, Ryan Christopher; Elagin, Andrey L; Erbacher, Robin D; Errede, Steven Michael; Esham, Benjamin; Farrington, Sinead Marie; Feindt, Michael; Fernández Ramos, Juan Pablo; Field, Richard D; Flanagan, Gene U; Forrest, Robert David; Franklin, Melissa EB; Freeman, John Christian; Frisch, Henry J; Funakoshi, Yujiro; Galloni, Camilla; Garfinkel, Arthur F; Garosi, Paola; Gerberich, Heather Kay; Gerchtein, Elena A; Giagu, Stefano; Giakoumopoulou, Viktoria Athina; Gibson, Karen Ruth; Ginsburg, Camille Marie; Giokaris, Nikos D; Giromini, Paolo; Giurgiu, Gavril A; Glagolev, Vladimir; Glenzinski, Douglas Andrew; Gold, Michael S; Goldin, Daniel; Golossanov, Alexander; Gomez, Gervasio; Gomez-Ceballos, Guillelmo; Goncharov, Maxim T; González López, Oscar; Gorelov, Igor V; Goshaw, Alfred T; Goulianos, Konstantin A; Gramellini, Elena; Grinstein, Sebastian; Grosso-Pilcher, Carla; Group, Robert Craig; Barreiro Guimaraes da Costa, Joao; Hahn, Stephen R; Han, Ji-Yeon; Happacher, Fabio; Hara, Kazuhiko; Hare, Matthew Frederick; Harr, Robert Francis; Harrington-Taber, Timothy; Hatakeyama, Kenichi; Hays, Christopher Paul; Heinrich, Joel G; Herndon, Matthew Fairbanks; Hocker, James Andrew; Hong, Ziqing; Hopkins, Walter Howard; Hou, Suen Ray; Hughes, Richard Edward; Husemann, Ulrich; Hussein, Mohammad; Huston, Joey Walter; Introzzi, Gianluca; Iori, Maurizio; Ivanov, Andrew Gennadievich; James, Eric B; Jang, Dongwook; Jayatilaka, Bodhitha Anjalike; Jeon, Eun-Ju; Jindariani, Sergo Robert; Jones, Matthew T; Joo, Kyung Kwang; Jun, Soon Yung; Junk, Thomas R; Kambeitz, Manuel; Kamon, Teruki; Karchin, Paul Edmund; Kasmi, Azeddine; Kato, Yukihiro; Ketchum, Wesley Robert; Keung, Justin Kien; Kilminster, Benjamin John; Kim, DongHee; Kim, Hyunsoo; Kim, Jieun; Kim, Min Jeong; Kim, Soo Bong; Kim, Shin-Hong; Kim, Young-Kee; Kim, Young-Jin; Kimura, Naoki; Kirby, Michael H; Knoepfel, Kyle James; Kondo, Kunitaka; Kong, Dae Jung; Konigsberg, Jacobo; Kotwal, Ashutosh Vijay; Kreps, Michal; Kroll, IJoseph; Kruse, Mark Charles; Kuhr, Thomas; Kurata, Masakazu; Laasanen, Alvin Toivo; Lammel, Stephan; Lancaster, Mark; Lannon, Kevin Patrick; Latino, Giuseppe; Heck, Martin; Lee, Hyun Su; Lee, Jaison; Leo, Sabato; Leone, Sandra; Lewis, Jonathan D; Limosani, Antonio; Lipeles, Elliot David; Lister, Alison; Liu, Hao; Liu, Qiuguang; Liu, Tiehui Ted; Lockwitz, Sarah E; Loginov, Andrey Borisovich; Lucà, Alessandra; Lucchesi, Donatella; Lueck, Jan; Lujan, Paul Joseph; Lukens, Patrick Thomas; Lungu, Gheorghe; Lys, Jeremy E; Lysak, Roman; Madrak, Robyn Leigh; Maestro, Paolo; Malik, Sarah Alam; Manca, Giulia; Manousakis-Katsikakis, Arkadios; Margaroli, Fabrizio; Marino, Christopher Phillip; Martínez-Perez, Mario; Matera, Keith; Mattson, Mark Edward; Mazzacane, Anna; Mazzanti, Paolo; McNulty, Ronan; Mehta, Andrew; Mehtala, Petteri; Mesropian, Christina; Miao, Ting; Mietlicki, David John; Mitra, Ankush; Miyake, Hideki; Moed, Shulamit; Moggi, Niccolo; Moon, Chang-Seong; Moore, Ronald Scott; Morello, Michael Joseph; Mukherjee, Aseet; Muller, Thomas; Murat, Pavel A; Mussini, Manuel; Nachtman, Jane Marie; Nagai, Yoshikazu; Naganoma, Junji; Nakano, Itsuo; Napier, Austin; Nett, Jason Michael; Neu, Christopher Carl; Nigmanov, Turgun S; Nodulman, Lawrence J; Noh, Seoyoung; Norniella Francisco, Olga; Oakes, Louise Beth; Oh, Seog Hwan; Oh, Young-do; Oksuzian, Iuri Artur; Okusawa, Toru; Orava, Risto Olavi; Ortolan, Lorenzo; Pagliarone, Carmine Elvezio; Palencia, Jose Enrique; Palni, Prabhakar; Papadimitriou, Vaia; Parker, William Chesluk; Pauletta, Giovanni; Paulini, Manfred; Paus, Christoph Maria Ernst; Phillips, Thomas J; Piacentino, Giovanni M; Pianori, Elisabetta; Pilot, Justin Robert; Pitts, Kevin T; Plager, Charles; Pondrom, Lee G; Poprocki, Stephen; Potamianos, Karolos Jozef; Prokoshin, Fedor; Pranko, Aliaksandr Pavlovich; Ptohos, Fotios K; Punzi, Giovanni; Ranjan, Niharika; Redondo Fernández, Ignacio; Renton, Peter B; Rescigno, Marco; Rimondi, Franco; Ristori, Luciano; Robson, Aidan; Rodriguez, Tatiana Isabel; Rolli, Simona; Ronzani, Manfredi; Roser, Robert Martin; Rosner, Jonathan L; Ruffini, Fabrizio; Ruiz Jimeno, Alberto; Russ, James S; Rusu, Vadim Liviu; Sakumoto, Willis Kazuo; Sakurai, Yuki; Santi, Lorenzo; Sato, Koji; Saveliev, Valeri; Savoy-Navarro, Aurore; Schlabach, Philip; Schmidt, Eugene E; Schwarz, Thomas A; Scodellaro, Luca; Scuri, Fabrizio; Seidel, Sally C; Seiya, Yoshihiro; Semenov, Alexei; Sforza, Federico; Shalhout, Shalhout Zaki; Shears, Tara G; Shepard, Paul F; Shimojima, Makoto; Shochet, Melvyn J; Tecker-Shreyber, Irina; Simonenko, Alexander V; Sliwa, Krzysztof Jan; Smith, John Rodgers; Snider, Frederick Douglas; Sorin, Maria Veronica; Song, Hao; Stancari, Michelle Dawn; St Denis, Richard Dante; Stentz, Dale James; Strologas, John; Sudo, Yuji; Sukhanov, Alexander I; Suslov, Igor M; Takemasa, Ken-ichi; Takeuchi, Yuji; Tang, Jian; Tecchio, Monica; Teng, Ping-Kun; Thom, Julia; Thomson, Evelyn Jean; Thukral, Vaikunth; Toback, David A; Tokar, Stanislav; Tollefson, Kirsten Anne; Tomura, Tomonobu; Tonelli, Diego; Torre, Stefano; Torretta, Donatella; Totaro, Pierluigi; Trovato, Marco; Ukegawa, Fumihiko; Uozumi, Satoru; Vázquez-Valencia, Elsa Fabiola; Velev, Gueorgui; Vellidis, Konstantinos; Vernieri, Caterina; Vidal Marono, Miguel; Vilar Cortabitarte, Rocio; Vizán Garcia, Jesus Manuel; Vogel, Marcelo; Volpi, Guido; Wagner, Peter; Wallny, Rainer S; Wang, Song-Ming; Waters, David S; Wester, William Carl; Whiteson, Daniel O; Wicklund, Arthur Barry; Wilbur, Scott; Williams, Hugh H; Wilson, Jonathan Samuel; Wilson, Peter James; Winer, Brian L; Wittich, Peter; Wolbers, Stephen A; Wolfe, Homer; Wright, Thomas Roland; Wu, Xin; Wu, Zhenbin; Yamamoto, Kazuhiro; Yamato, Daisuke; Yang, Tingjun; Yang, Un-Ki; Yang, Yu Chul; Yao, Wei-Ming; Yeh, Gong Ping; Yi, Kai; Yoh, John; Yorita, Kohei; Yoshida, Takuo; Yu, Geum Bong; Yu, Intae; Zanetti, Anna Maria; Zeng, Yu; Zhou, Chen; Zucchelli, Stefano

2014-07-28

Using the full CDF Run II data sample, we report evidence for a new resonance, which we refer to as B(5970), found simultaneously in the $B^0\\pi^+$ and $B^+\\pi^-$ mass distributions with a significance of 4.4 standard deviations. We further report the first study of resonances consistent with orbitally excited $B^{+}$ mesons and an updated measurement of the properties of orbitally excited $B^0$ and $B_s^0$ mesons. Using samples of approximately 8400 $B^{**0}$, 3300 $B^{**+}$, 1350 $B^{**0}_s$, 2600 $B(5970)^0$, and 1400 $B(5970)^+$ decays, we measure the masses and widths of all states, as well as the product of the relative production rate of $B_1$ and $B_2^*$ states times the branching fraction into a $B^{0,+}$ meson and a charged particle. Furthermore, we measure the branching fraction of the $B_{s2}^{*0} \\rightarrow B^{*+} K^-$ decay relative to the $B_{s2}^{*0} \\rightarrow B^{+} K^-$ decay, the production rate times the branching fraction of the B(5970) state relative to the $B_{2}^{*0,+}$ state, and th...

Evidence for the Strangeness-Changing Weak Decay Ξ_{b}^{-}→Λ_{b}^{0}π^{-}.

Science.gov (United States)

Aaij, R; Abellán Beteta, C; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; d'Argent, P; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Bel, L J; Bellee, V; Belloli, N; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bertolin, A; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borisyak, M; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cavallero, G; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Demmer, M; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Ruscio, F; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Färber, C; Farley, N; Farry, S; Fay, R; Ferguson, D; Fernandez Albor, V; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fohl, K; Fol, P; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Humair, T; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kecke, M; Kelsey, M; Kenyon, I R; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Manning, P; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurin, B; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A B; Mountain, R; Muheim, F; Müller, D; Müller, J; Müller, K; Müller, V; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, C J G; Osorio Rodrigues, B; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Pappenheimer, C; Parker, W; Parkes, C; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Piucci, A; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redi, F; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, E; Smith, I T; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefkova, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Todd, J; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Trabelsi, K; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Volkov, V; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wyllie, K; Xie, Y; Xu, Z; Yang, Z; Yu, J; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zucchelli, S

2015-12-11

Using a pp collision data sample corresponding to an integrated luminosity of 3.0  fb^{-1}, collected by the LHCb detector, we present the first search for the strangeness-changing weak decay Ξ_{b}^{-}→Λ_{b}^{0}π^{-}. No b hadron decay of this type has been seen before. A signal for this decay, corresponding to a significance of 3.2 standard deviations, is reported. The relative rate is measured to be f_{Ξ_{b}^{-}}/f_{Λ_{b}^{0}}B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-})=(5.7±1.8_{-0.9}^{+0.8})×10^{-4},where f_{Ξ_{b}^{-}} and f_{Λ_{b}^{0}} are the b→Ξ_{b}^{-} and b→Λ_{b}^{0} fragmentation fractions, and B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-}) is the branching fraction. Assuming f_{Ξ_{b}^{-}}/f_{Λ_{b}^{0}} is bounded between 0.1 and 0.3, the branching fraction B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-}) would lie in the range from (0.57±0.21)% to (0.19±0.07)%.

SPIN–ORBIT ALIGNMENT FOR THREE TRANSITING HOT JUPITERS: WASP-103b, WASP-87b, and WASP-66b

Energy Technology Data Exchange (ETDEWEB)

Addison, B. C.; Tinney, C. G.; Wright, D. J. [Exoplanetary Science Group, School of Physics, University of New South Wales, Sydney, NSW 2052 (Australia); Bayliss, D., E-mail: baddison2005@gmail.com [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia)

2016-05-20

We have measured the sky-projected spin–orbit alignments for three transiting hot Jupiters, WASP-103b, WASP-87b, and WASP-66b, using spectroscopic measurements of the Rossiter–McLaughlin effect, with the CYCLOPS2 optical fiber bundle system feeding the UCLES spectrograph on the Anglo-Australian Telescope. The resulting sky-projected spin–orbit angles of λ = 3° ± 33°, λ = −8° ± 11°, and λ = −4° ± 22° for WASP-103b, WASP-87b, and WASP-66b, respectively, suggest that these three planets are likely on nearly aligned orbits with respect to their host star’s spin axis. WASP-103 is a particularly interesting system as its orbital distance is only 20% larger than its host star’s Roche radius and the planet likely experiences strong tidal effects. WASP-87 and WASP-66 are hot ( T {sub eff} = 6450 ± 120 K and T {sub eff} = 6600 ± 150 K, respectively) mid-F stars, making them similar to the majority of stars hosting planets on high-obliquity orbits. Moderate spin–orbit misalignments for WASP-103b and WASP-66b are consistent with our data, but polar and retrograde orbits are not favored for these systems.

SPIN–ORBIT ALIGNMENT FOR THREE TRANSITING HOT JUPITERS: WASP-103b, WASP-87b, and WASP-66b

International Nuclear Information System (INIS)

Addison, B. C.; Tinney, C. G.; Wright, D. J.; Bayliss, D.

2016-01-01

We have measured the sky-projected spin–orbit alignments for three transiting hot Jupiters, WASP-103b, WASP-87b, and WASP-66b, using spectroscopic measurements of the Rossiter–McLaughlin effect, with the CYCLOPS2 optical fiber bundle system feeding the UCLES spectrograph on the Anglo-Australian Telescope. The resulting sky-projected spin–orbit angles of λ = 3° ± 33°, λ = −8° ± 11°, and λ = −4° ± 22° for WASP-103b, WASP-87b, and WASP-66b, respectively, suggest that these three planets are likely on nearly aligned orbits with respect to their host star’s spin axis. WASP-103 is a particularly interesting system as its orbital distance is only 20% larger than its host star’s Roche radius and the planet likely experiences strong tidal effects. WASP-87 and WASP-66 are hot ( T eff = 6450 ± 120 K and T eff = 6600 ± 150 K, respectively) mid-F stars, making them similar to the majority of stars hosting planets on high-obliquity orbits. Moderate spin–orbit misalignments for WASP-103b and WASP-66b are consistent with our data, but polar and retrograde orbits are not favored for these systems.

Double-parton scattering effects in D0B+ and B+B+ meson-meson pair production in proton-proton collisions at the LHC

Science.gov (United States)

Maciuła, Rafał; Szczurek, Antoni

2018-05-01

We extend our previous studies of double-parton scattering (DPS) to simultaneous production of c c ¯ and b b ¯ and production of two pairs of b b ¯. The calculation is performed within a factorized ansatz. Each parton scattering is calculated within the kT-factorization approach. The hadronization is done with the help of fragmentation functions. Production of D mesons in our framework was tested in our previous works. Here, we present our predictions for B mesons. A good agreement is achieved with the LHCb data. We present our results for c c ¯b b ¯ and b b ¯b b ¯ final states. For completeness, we compare results for double- and single-parton scattering (SPS). As for the c c ¯c c ¯ final state, the DPS dominates over the SPS, especially for small transverse momenta. We present several distributions and integrated cross sections with realistic cuts for simultaneous production of D0B+ and B+B+, suggesting future experimental studies at the LHC.

Evaluation of synergistic antimicrobial effect of vitamins (A, B1, B2, B6, B12, C, D, E and K) with antibiotics against resistant bacterial strains.

Science.gov (United States)

Shahzad, Shakeel; Ashraf, M Adnan; Sajid, M; Shahzad, Aqeel; Rafique, Azhar; Mahmood, M Shahid

2018-02-02

Multiple drug resistant super bugs of Acinetobacter baumannii and methicillin-resistant Staphylococcus aureus (MRSA) are becoming challenge for healthcare professionals. In this study, vitamins were evaluated for synergistic activity with the antibiotics. Synergistic effect between antibiotic and stock solutions of vitamins is evaluated by using Kirby-Bauer disc diffusion assay. Distilled water and propylene glycol were used as solvent for water soluble vitamins and fat-soluble vitamins respectively. The final concentration of 10mg/ml of each water-soluble vitamin B1 (Thiamine), B2 (Riboflavin), B6 (Pyridoxine) B12 (Methylcobalamin), C (Ascorbic acid) and 0.1mg/ml of each fat soluble vitamin A (retinol), D (cholecalciferol) E (αTocopherol) K (Menadione) were used with the antibiotics. The results depicted that vitamin K and E have better synergistic activity with piperacillin-tazobactam, imipenem and doripenem antibiotics against A. baumannii. While vitamin B1, B2 and B12 showed remarkable synergistic activity with linezolid against MRSA. Vitamin B1 was further tested to have better synergism with antibiotics oxacillin, tetracycline, rifampicin and linezolid against MRSA. The fat-soluble vitamins E and K were good in synergism against Gram negative A. baumannii while water soluble vitamins as B1, B2 and B12 were effective against MRSA but not against A. baumannii. This synergistic action of vitamins with the antibiotics can be used as a tool to treat multiple drug resistant super bugs with further evaluation at molecular level. Copyright © 2018 International Society for Chemotherapy of Infection and Cancer. Published by Elsevier Ltd. All rights reserved.

B2B-uutiskirjeen visuaalisen ilmeen kehitys — Case Tamtron Solutions Oy

OpenAIRE

Salo, Sari

2014-01-01

Opinnäytetyön tarkoituksena oli kehittää Tamtron Solutions Oy:n uutiskirjeelle uusi visuaalinen ilme. Yrityksen lähettämästä uutiskirjeestä yritysasiakkaille puhutaan B2B-uutiskirjeenä. Tamtron Solutions Oy halusi B2B-uutiskirjeen avulla tehostaa markkinointia, kasvattaa myyntiä ja luoda uusia asiakassuhteita. Yritys halusi toteuttaa markkinointikampanjan B2B-uutiskirjeen muodossa rakennusalan yrityksille. Yritys valitsi kampanjan kohderyhmäksi rakennusalan yritykset, koska lakimuutos rakennu...

KWL Lingen nuclear plant. Technical annual report 2016; KWL Kernkraftwerk Lingen. Technischer Jahresbericht 2016

Energy Technology Data Exchange (ETDEWEB)

NONE

2017-07-01

The technical annual report 2016 for KWL (Lingen nuclear plant) covers the following sections: dismantling project management and operation, monitoring and clearance; waste management, technical qualification, security and safety, central tasks; licensing and supervision procedures, operational data, radiation monitoring, radioactive materials, in-service inspections.

Impact of external grid disturbances on nuclear power plants; Rueckwirkungen von Netzstoerungen auf Kernkraftwerke

Energy Technology Data Exchange (ETDEWEB)

Arains, Robert; Arnold, Simone; Brueck, Benjamin; Mueller, Christian; Quester, Claudia; Sommer, Dagmar

2017-06-15

The electrical design of nuclear power plants and the reliability of their electrical power supply including the offsite power supply are of high importance for the safe operation of the plants. The operating experience of recent years has shown that disturbances in the external grid can have impact on the electrical equipment of nuclear power plants. In the course of this project, possible causes and types of grid disturbances were identified. Based on these, scenarios of grid disturbances were developed. In order to investigate the impact of the developed scenarios of grid disturbances on the electrical equipment of nuclear power plants, the auxiliary power supply of a German pressurized water reactor of type Konvoi was simulated using the simulation tool NEPLAN. On the basis of the results of the analyses, it was identified whether there are possible measures to prevent the spread of grid disturbances in the plants which have not been implemented in the nuclear power plants today.

How has IT impacted the B2B sales process?

OpenAIRE

Bjørnstad, Julia Jemli

2017-01-01

B2B sales role plays a major role in driving the economy, and this industry has been experiencing major changes over the year with the advances in technology which allow for more cost savings and driving for more efficient ways of conducting sales operations. The objective of this exploratory qualitative research paper was to raise interest in the role technology plays in the B2B sales process today from the salesperson’s view point. It was further partly built on previous rese...

The formation of AlB2 in an Al-B master alloy

International Nuclear Information System (INIS)

Wang Xiaoming

2005-01-01

The formation of borides in an Al-3 wt.%B master alloy, produced via chemical reactions of KBF 4 and aluminium has been investigated. The chemical reactions produce boron, which dissolves into molten aluminium and subsequently forms aluminium borides. Backscattered electron imaging (BEI) of the Al-3 wt.%B master alloy under a scanning electron microscope (SEM) revealed the presence of two types of phases that contain different levels of boron. Combined with X-ray diffraction (XRD) results, the two types of phases are identified as AlB 2 on AlB 12 . This gives a direct evidence for a peritectic reaction of AlB 12 and aluminium, which produces AlB 2 . The thermodynamic properties of the reactions that may be involved are examined, and the presence of AlB 12 phase in the master alloy explained. The observed microstructure is explained according to the peritectic reaction in an Al-B phase diagram. The stability of AlB 2 and AlB 12 at lower temperature than 975 deg. C is clarified

Measurement of the decays B->phi K and B->phi K*

Energy Technology Data Exchange (ETDEWEB)

MacFarlane, David B

2001-07-25

The authors have observed the decays B {yields} {phi}K and {phi} K* in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are {beta}(B{sup +} {yields} {phi}K{sup +}) = (7.7{sub -1.4}{sup +1.6} {+-} 0.8) x 10{sup -6}, {Beta}(B{sup 0} {yields} {phi}K{sup 0}) = (8.1{sub -2.5}{sup + 3.1} {+-} 0.8) x 10{sup -6}, {Beta}(B{sup +} {yields} {phi}K*{sup +}) = (9.7{sub -3.4}{sup +4.2} {+-} 1.7) x 10{sup -6}, and {Beta}(B{sup 0} {yields} {phi}K*{sup 0}) = (8.6 {sub -2.4}{sup +2.8} {+-} 1.1) x 10{sup -6}. We also report the upper limit {Beta}(B{sup +} {yields} {phi}{pi}{sup +}) < 1.4 s 10{sup -6} (90% CL).

Histatin 5 binds to Porphyromonas gingivalis hemagglutinin B (HagB) and alters HagB-induced chemokine responses

Science.gov (United States)

Borgwardt, Derek S.; Martin, Aaron D.; van Hemert, Jonathan R.; Yang, Jianyi; Fischer, Carol L.; Recker, Erica N.; Nair, Prashant R.; Vidva, Robinson; Chandrashekaraiah, Shwetha; Progulske-Fox, Ann; Drake, David; Cavanaugh, Joseph E.; Vali, Shireen; Zhang, Yang; Brogden, Kim A.

2014-01-01

Histatins are human salivary gland peptides with anti-microbial and anti-inflammatory activities. In this study, we hypothesized that histatin 5 binds to Porphyromonas gingivalis hemagglutinin B (HagB) and attenuates HagB-induced chemokine responses in human myeloid dendritic cells. Histatin 5 bound to immobilized HagB in a surface plasmon resonance (SPR) spectroscopy-based biosensor system. SPR spectroscopy kinetic and equilibrium analyses, protein microarray studies, and I-TASSER structural modeling studies all demonstrated two histatin 5 binding sites on HagB. One site had a stronger affinity with a KD1 of 1.9 μM and one site had a weaker affinity with a KD2 of 60.0 μM. Binding has biological implications and predictive modeling studies and exposure of dendritic cells both demonstrated that 20.0 μM histatin 5 attenuated (p < 0.05) 0.02 μM HagB-induced CCL3/MIP-1α, CCL4/MIP-1β, and TNFα responses. Thus histatin 5 is capable of attenuating chemokine responses, which may help control oral inflammation.

Hepatitis B immunisation for newborn infants of hepatitis B surface antigen-positive mothers

DEFF Research Database (Denmark)

Lee, C; Gong, Yanzhang; Brok, J

2006-01-01

Hepatitis B vaccine and hepatitis B immunoglobulin are considered for newborn infants of HBsAg-positive mothers to prevent hepatitis B infection.......Hepatitis B vaccine and hepatitis B immunoglobulin are considered for newborn infants of HBsAg-positive mothers to prevent hepatitis B infection....

Porcine arterivirus activates the NF-κB pathway through IκB degradation

International Nuclear Information System (INIS)

Lee, Sang-Myeong; Kleiboeker, Steven B.

2005-01-01

Nuclear factor-kappaB (NF-κB) is a critical regulator of innate and adaptive immune function as well as cell proliferation and survival. The present study demonstrated for the first time that a virus belonging to the Arteriviridae family activates NF-κB in MARC-145 cells and alveolar macrophages. In porcine reproductive and respiratory syndrome virus (PRRSV)-infected cells, NF-κB activation was characterized by translocation of NF-κB from the cytoplasm to the nucleus, increased DNA binding activity, and NF-κB-regulated gene expression. NF-κB activation was increased as PRRSV infection progressed and in a viral dose-dependent manner. UV-inactivation of PRRSV significantly reduced the level of NF-κB activation. Degradation of IκB protein was detected late in PRRSV infection, and overexpression of the dominant negative form of IκBα (IκBαDN) significantly suppressed NF-κB activation induced by PRRSV. However, IκBαDN did not affect viral replication and viral cytopathic effect. PRRSV infection induced oxidative stress in cells by generating reactive oxygen species (ROS), and antioxidants inhibited NF-κB DNA binding activity in PRRSV-infected cells, suggesting ROS as a mechanism by which NF-κB was activated by PRRSV infection. Moreover, NF-κB-dependent expression of matrix metalloproteinase (MMP)-2 and MMP-9 was observed in PRRSV-infected cells, an observation which implies that NF-κB activation is a biologically significant aspect of PRRSV pathogenesis. The results presented here provide a basis for understanding molecular pathways of pathology and immune evasion associated with disease caused by PRRSV

Hepatitis B hos børn

DEFF Research Database (Denmark)

Christensen, Vibeke Brix; Nordly, Sannie Brit; Kjær, Mette

2014-01-01

Chronic hepatitis B (HBV) infection is seen in 400 million persons worldwide. HBV is transmitted vertically or horizontally by infected blood and body fluids. An effective vaccine exists. Most children develop a chronic HBV infection if infected early in life. They are often in an immune-tolerant......Chronic hepatitis B (HBV) infection is seen in 400 million persons worldwide. HBV is transmitted vertically or horizontally by infected blood and body fluids. An effective vaccine exists. Most children develop a chronic HBV infection if infected early in life. They are often in an immune...

Blood group genotyping for Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b) with microarray beads.

Science.gov (United States)

Karpasitou, Katerina; Drago, Francesca; Crespiatico, Loretta; Paccapelo, Cinzia; Truglio, Francesca; Frison, Sara; Scalamogna, Mario; Poli, Francesca

2008-03-01

Traditionally, blood group typing has been performed with serologic techniques, the classical method being the hemagglutination test. Serotyping, however, may present important limitations such as scarce availability of rare antisera, typing of recently transfused patients, and those with a positive direct antiglobulin test. Consequently, serologic tests are being complemented with molecular methods. The aim of this study was to develop a low-cost, high-throughput method for large-scale genotyping of red blood cells (RBCs). Single-nucleotide polymorphisms associated with some clinically important blood group antigens, as well as with certain rare blood antigens, were evaluated: Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b). Polymerase chain reaction (PCR)-amplified targets were detected by direct hybridization to microspheres coupled to allele-specific oligonucleotides. Cutoff values for each genotype were established with phenotyped and/or genotyped samples. The method was validated with a blind panel of 92 blood donor samples. The results were fully concordant with those provided by hemagglutination assays and/or sequence-specific primer (SSP)-PCR. The method was subsequently evaluated with approximately 800 blood donor and patient samples. This study presents a flexible, quick, and economical method for complete genotyping of large donor cohorts for RBC alleles.

A case for hidden b anti b tetraquarks based on e+e- → b anti b cross sections between √(s) = 10.54 and 11.20 GeV

International Nuclear Information System (INIS)

Ali, Ahmed; Hambrock, Christian; Ahmed, Ishtiaq; Aslam, M. Jamil

2009-11-01

We study the spectroscopy and dominant decays of the bottomonium-like tetraquarks (bound diquarks-antidiquarks), focusing on the lowest lying P-wave [bq][anti b anti q] states Y [bq] (with q=u,d), having J PC =1 -- . To search for them, we analyse the BABAR data obtained during an energy scan of the e + e - →b anti b cross section in the range of √(s)=10.54 to 11.20 GeV. We find that these data are consistent with the presence of an additional b anti b state Y [bq] with a mass of 10.90 GeV and a width of about 30 MeV apart from the Υ(5S) and Υ(6S) resonances. A closeup of the energy region around the Y [bq] -mass may resolve this state in terms of the two mass eigenstates, Y [b,l] and Y [b,h] , with a mass difference, estimated as about 6 MeV. We tentatively identify the state Y [bq] (10900) from the R b -scan with the state Y b (10890) observed by BELLE in the process e + e - →Y b (10890)→Υ(1S,2S)π + π - due to their proximity in masses and decay widths. (orig.)

B physics at LEP

International Nuclear Information System (INIS)

Kowalewski, R.V.

1993-01-01

The experiments at LEP now dominate the world average b hadron lifetime, and have measured individual lifetimes for the pseudo-scalar B mesons and for b baryons with precisions of 15-20%. Measurements of the average mixing parameter [χ] at LEP suggest substantial B s mixing. Flavor oscillations have been observed directly for the B d , and searches for B s oscillations are underway. Some exclusive B decays have been reconstructed, and the mass of the B s has been measured. Most analyses are statistics limited, so further improvements can be expected as the data sample increases

LHCb; Measurement of the forward-central $b \\bar{b}$ production asymmetry

CERN Multimedia

Salustino Guimarães, V

2013-01-01

CDF and D0 collaborations results suggests that the top-quark forward-backward production asymmetry is much larger than the Standard Model (SM) predictions. Measuring the $b \\bar{b}$ asymmetry production would provide constraint on the flavor structure of any model that attempts to explain the CDF and D0 results. A measurement of the forward-central (FC) $b\\bar{b}$ production asymmetry is presented based on the LHCb data collected in 2011 at $\\sqrt{s}$ = 7 TeV corresponding to an integrated luminosity of 1.0 fb$^{-1}$ using selected events that have two identified $b$ jets, one of which is flavor tagged by one muon with high momentum. The FC asymmetry is defined as \\begin{align} A^{b \\bar{b}}_{FC}=\\frac{N(\\Delta y > 0)-N(\\Delta y 0)+N(\\Delta y 100$ GeV the expected asymmetry is about $\\cal{O}$(0.1 %) where gluon fusion which has no asymmetry is less dominant at high mass.

First observation of the $B_{s2}^\\ast(5840)^0 \\to B^{\\ast+} K^-$ and studies of excited $B^0_s$ mesons

CERN Document Server

INSPIRE-00258707; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2013-04-09

Properties of the orbitally excited (L=1) $B_s$ states are studied using 1.0 fb$^{-1}$ of pp collisions at $\\sqrt{s} =7$ TeV collected with the LHCb detector. The first observation of the $B_{s2}^*(5840)^0$ meson decaying to $B^{*+} K^-$ is reported, and the corresponding branching fraction measured relative to the $B^+ K^-$ decay mode. The $B_{s1}(5830)^0 \\to B^{*+} K^-$ decay is observed as well. The width of the $B_{s2}^*(5840)^0$ state is measured for the first time and the masses of the two states are determined with the highest precision to date. The observation of the $B_{s2}^*(5840)^0 \\to B^{*+} K^-$ decay favours the spin-parity assignment $J^P = 2^+$ for the $B_{s2}^*(5840)^0$ meson. In addition, the most precise measurement of the mass difference $m(B^{*+})-m(B^+) = 45.01 \\pm 0.30 (stat) \\pm 0.23 (syst)$ MeV/$c^2$ is obtained.

Substantial photovoltaic response and morphology tuning in benzo[1,2-b:6,5-b']dithiophene (bBDT) molecular donors.

Science.gov (United States)

Harschneck, Tobias; Zhou, Nanjia; Manley, Eric F; Lou, Sylvia J; Yu, Xinge; Butler, Melanie R; Timalsina, Amod; Turrisi, Riccardo; Ratner, Mark A; Chen, Lin X; Chang, Robert P H; Facchetti, Antonio; Marks, Tobin J

2014-04-21

The influence of solubilizing substituents on the photovoltaic performance and thin-film blend morphology of new benzo[1,2-b:6,5-b']dithiophene (bBDT) based small molecule donor semiconductors is investigated. Solar cells based on bBDT(TDPP)2-PC71BM with two different types of side chains exhibit high power conversion efficiencies, up to 5.53%.

On the critical success factors for B2B e-marketplace

Directory of Open Access Journals (Sweden)

Sareh Ahmad Khan Beige

2015-01-01

Full Text Available Advancement of network technology, quick growth of Internet and Internet based solutions lead many firms to apply online processes as well as electronic businesses. Internet based B2B E-C requires applying Internet and affiliated technologies for exchanging products, services and information. Implementation of business to business (B2B requires long-term commitment of organizations. Carrying out research in this field is regarded as very important issue for recognizing effective factors on successful implementation and execution of B2B and determining current status of organization. This research deals with studying effective critical factors on successful implementation and execution of B2B. Factors are recognized through studying literature review and IT experts. Then, through case study (studying a vehicle manufacturing firm and by using analytical network process (ANP, the importance of factor and their rank are determined. The factors that are regarded at this research are including: culture, commitment and support of senior management, government support, purposes, organizational strategies, trust, partial advantage and technical infrastructure. Results of research show that support and commitment of senior management are the highest priority factors.

Boosted $H\\rightarrow b \\bar{b}$ Tagger in Run II

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00394595; The ATLAS collaboration

2016-01-01

Many searches for Higgs bosons decaying to b quark pairs benefit from the increased Run II centre of mass energy by exploiting the large transverse momentum (boosted) Higgs boson regime, where the two b-jets are merged into one large radius jet. ATLAS uses a boosted $H \\rightarrow b\\bar{b}$ tagger algorithm to separate Higgs signal from background processes (QCD, W and Z bosons, top quarks). The tagger takes as input a large R=1.0 jet with calibrated pseudorapidity, energy and mass scale. It employs b-tagging, Higgs candidate mass, and substructure information. The performance of several operating points in Higgs boson signal, QCD and $t\\bar{t}$ all-hadronic backgrounds are presented. Systematic uncertainties are evaluated so that this tagger can be used in analyses.

KANDUNGAN VITAMIN B6, B9, B12 DAN E BEBERAPA JENIS DAGING, TELUR, IKAN DAN UDANG LAUT DI BOGOR DAN SEKITARNYA (VITAMIN B6, B9, B12 AND E CONTENT OF SEVERAL TYPES OF MEATS, EGGS, FISHES AND MARINE SHRIMPS IN BOGOR AND SURROUNDING AREAS

Directory of Open Access Journals (Sweden)

Heru Yuniati

2012-06-01

Full Text Available ABSTRACT Food Composition Table (DKBM in Indonesia has not mentioned all types of nutrients available in the food, particularly vitamin B6, B9 (folic acid, B12, and vitamin E. Therefore this study aimed to analyze the content of vitamin B6, B9 (folic acid, B12, and vitamin E in several types of meat, eggs, fish and marine shrimps consumed in Bogor and surrounding areas. Vitamin B6, B9, B12, and vitamin E from three kinds of meat (chicken, beef, lamb, two types of eggs (chicken, duck, and four species of fish (snapper, bloating, carp and tuna and crayfish are analyzed using High-Performance Liquid Chromatography (HPLC. The samples used are raw and taken from three locations in Bogor and surrounding areas. Fishes, meats and eggs contain high levels of folic acid, however the amount of folic acid content in meat varies depending on which part of meat the samples are taken, types of organ, and the fat content of the meat. The folic acid content in chicken wings is different with those in thigh. In fatty mutton the folic acid is higher than in those lean meat, and in yolk is higher than those in egg white. Vitamin E content of snapper is the highest amongs other types of fishes (6.54 µg/100 g.Chicken eggs contain a higher amount of vitamin E than duck eggs, while the yolk contains ahigher amount of vitamin E than those egg white. Keywords: animal foods, vitamin B6, vitamin B9 (folic Acid, vitamin B12, vitamin E   ABSTRAK Daftar Komposisi Bahan Makanan (DKBM yang ada di Indonesia belum memuat semua jenis zat gizi dalam makanan, khususnya vitamin B6, B9 (asam folat, B12 dan vitamin E. Menganalisis kandungan vitamin B6, B9 (asam folat, B12, dan vitamin E dalam beberapa jenis daging, telur, ikan dan udang laut yang dikonsumsi masyarakat di Bogor dan sekitarnya. Kandungan vitamin B6, B9, B12 dan vitamin E dari tiga jenis daging (ayam, sapi, kambing, dua jenis telur (ayam, itik, serta empat jenis ikan (kakap, kembung, mas, tongkol dan udang laut

Simultaneous high performance liquid chromatographic analysis of vitamins B1, B2 and B6 in royal jelly

Directory of Open Access Journals (Sweden)

Presoto Ana Elisa F

2004-01-01

Full Text Available Royal jelly is used as a food supplement, popularly known as rich in B vitamins. The present work has two objectives: firstly, to apply simultaneous quantitative determination by High Performance Liquid Chromatography of thiamin (vitamin B1, riboflavin (vitamin B2 and pyridoxine (vitamin B6 and secondly to compare the obtained data with the Dietary Reference Intake (DRI values. The values obtained showed no thiamin, a range from 20 to 171 ng g-1 of riboflavin and from 408 to 2 188 ng g-1 of pyridoxine in royal jelly. According to the Food and Nutrition Board (2000, the DRI of these vitamins varies from 0.2-1.4 mg for thiamin; 0.3-1.6 mg for riboflavin and 0.1-2.0 mg for pyridoxine, depending on age and sex. According to these recommendations, royal jelly is not a good source of vitamins B1, B2 or B6 as these vitamins appear only on order of ng g-1. The proposed method can be used in routine analysis for royal jelly, having the advantage of being simple, fast and reliable.

HLA-B*14

DEFF Research Database (Denmark)

Leitman, Ellen M.; Willberg, Christian B.; Tsai, Ming Han

2017-01-01

Immune control of human immunodeficiency virus type 1 (HIV) infection is typically associated with effective Gag-specific CD8+ T-cell responses. We here focus on HLA-B*14, which protects against HIV disease progression, but the immunodominant HLA-B*14-restricted anti-HIV response is Env specific...... higher functional avidity (P associated protection against HIV disease progression...... is significantly greater for HLA-B*14:02 than for HLA-B*14:01, consistent with the superior antiviral efficacy of the HLA-B*14-EL9 response. Thus, although Gag-specific CD8+ T-cell responses may usually have greater anti-HIV efficacy, factors independent of protein specificity, including functional avidity...

Measurement of b anti b correlations at the CERN p anti p collider

International Nuclear Information System (INIS)

Albajar, C.; Ankoviak, K.; Bartha, S.; Bezaguet, A.; Boehrer, A.; Bos, K.; Buchanan, C.; Buschbeck, B.; Castilla-Valdez, H.; Cennini, P.; Cittolin, S.; Clayton, E.; Cline, D.; Caughlan, J.A.; Dau, D.; Daum, C.; Della Negra, M.; Demoulin, M.; Denegri, D.; Dibon, H.; Dorenbosch, J.; Dowell, J.D.; Eggert, K.; Eisenhandler, E.; Ellis, N.; Evans, H.; Faissner, H.; Fensome, I.F.; Fortson, L.; Garvey, J.; Geiser, A. Givernaud, A.; Gonidec, A.; Gonzalez, B.; Gronberg, J.; Holthuizen, D.J.; Jank, W.; Jorat, G.; Kalmus, P.I.P.; Karimaeki, V.; Kenyon, I.; Kinnunen, R.; Krammer, M.; Lammel, S.; Landon, M.P.J.; Lemoigne, Y.; Levegruen, S.; Lipa, P.; Markou, C.; Markytan, M.; Maurin, G.; McMahon, S.; Merlo, J.P.; Meyer, T.; Moers, T.; Mohammadi, M.; Morsch, A.; Moulin, A.; Norton, A.; Otwinowski, S.; Pancheri, G.; Pietarinen, E.; Pimiae, M.; Placci, A.; Porte, J.P.; Priem, R.; Prosi, R.; Radermacher, E.; Rauschkolb, M.; Reithler, H.; Revol, J.P.; Robinson, D.; Rubbia, C.; Samyn, D.; Schinzel, D.; Schleichert, R.; Schroeder, M.; Seez, C.; Shah, T.P.; Sphicas, P.; Sumorok, K.; Szoncso, F.; Tan, C.H.; Taurok, A.; Taylor, L.; Tether, S.; Teykal, H.; Thompson, G.; Tuchscherer, H.; Tuominiemi, J.; Van de Guchte, W.; Van Dijk, A.; Vargas, M.; Virdee, T.S.; Schlippe, W. von; Vuillemin, V.; Wacker, K.; Wagner, H.; Walzel, G.; Wulz, C.E.; Zotto, P.; NIKHEF-H, Amsterdam; Birmingham Univ.; CERN, Geneva; Helsinki Univ.; Kiel Univ.; Blackett Lab., Imperial Coll., London; Queen Mary and Westfield Coll., London; MIT, Cambridge, MA; Rutherford Appleton Lab., Chilton; DPHPE/SEPh, CEN Saclay, Gif-sur-Yvette; California Univ., Los Angeles, CA; Oesterreichische Akademie der Wissenschaften, Vienna

1994-01-01

We report on measurements of correlated b anti b production in p anti p at √s=630 GeV, using dimuon data to tag both the b and anti b quarks. Starting from an inclusive dimuon sample we obtain improved cross-sections for single inclusive beauty production and confirm our earlier results on B 0 - anti B 0 mixing. From a study of b anti b correlations we derive explicit cross-sections for semi-differential b anti b production. We compare the measured cross-sections and correlations to OMIKRON (α s 3 ) QCD predictions and find good quantitative agreement. From the measured angular distributions we establish a sizeable contribution from higher order QCD processes with a significance of about seven standard deviations. A large nonperturbative contribution to these higher order corrections is excluded. (orig.)

Hepatitis B

Science.gov (United States)

... B Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For Veterans and the Public Veterans ... in their blood (sometimes referred to as the hepatitis B viral load) and an unusually high level of a ...

Limits on rare B decays B implies μ+μ-K± and B implies μ+μ- K*

International Nuclear Information System (INIS)

Anway-Wiese, C.

1995-01-01

We report on a search for flavor-changing neutral current decays of B mesons into γγK * and γγK± using data obtained in the Collider Detector at Fermilab (CDF) 1992 endash 1993 data taking run. To reduce the amount of background in our data we use precise tracking information from the CDF silicon vertex detector to pinpoint the location of the decay vertex of the B candidate, and accept only events which have a large decay time.We compare this data to a B meson signal obtained in a similar fashion, but where the muon pairs originate from ψ decays, and calculate the relative branching ratios. In the absence of any indication of flavor-changing neutral current decays we set an upper limits of BR(B implies μμK ± ) much-gt 3.5x10 -5 , and BR(B implies μμK * )much-gt 5.1x10 -5 at 90% confidence level, which are consistent with Standard Model expectations but leave little room for non-standard physics. copyright 1995 American Institute of Physics

Properties of Weakly-decaying Bottom Baryons, Ξb- and (Omega)b-, at CDF

International Nuclear Information System (INIS)

Behari, Satyajit

2009-01-01

We present properties of weakly decaying bottom baryons, Ξ b - and (Omega) b - , using 4.2 fb -1 of data from p(bar p) collisions at √s = 1.96 TeVf, and recorded with the Collider Detector at Fermilab. They report the observation of the (Omega) b - through the decay chain (Omega) b - → J/ψω - , where J/ψ → μ + μ - , (Omega) - → ΛK - , and Λ → pπ - . Significance of the observed signal is estimated to be 5.5 Gaussian standard deviations. The (Omega) b - mass and lifetime are measured to be 6054.4 ± 6.8(stat.) ± 0.9(syst.) MeV/c 2 and 1.13 -0.40 +0.53 (stat.) ± 0.02(syst). ps, respectively. In addition, the mass and lifetime of the Ξ b - baryon are measured to be 5790.9 ± 2.6(stat.) ± 0.8(syst.) MeV/c 2 and 1.56 -0.25 +0.27 (stat.) ± 0.02(syst.) ps, respectively. Under the assumption that the Ξ b - and (Omega) b - are produced with similar kinematic distributions as the Λ b 0 baryon, we measure σ(Ξ b - )Β(Ξ b - ) → J/ψ(Ξ - )/σ(Λ b 0 )Β(Λ b 0 → J/ψ Λ) = 0.167 -0.025 +0.037 (stat.) ± 0.012(syst.) and σ(ω b - )Β((Omega) b - J/ψ (Omega) - )/σ(Λ b 0 )Β(Λ b 0 ) → J/ψ Λ = 0.045 0.012 +0.017 (stat.) ± 0.004(syst.) for baryons produced with transverse momentum in the range of 6-20 GeV/c

Clinical Trial Assessing the Efficacy of Gabapentin Plus B Complex (B1/B12 versus Pregabalin for Treating Painful Diabetic Neuropathy

Directory of Open Access Journals (Sweden)

Alberto Mimenza Alvarado

2016-01-01

Full Text Available Introduction. Painful diabetic neuropathy (PDN is a prevalent and impairing disorder. The objective of this study was to show the efficacy and safety of gabapentin (GBP plus complex B vitamins: thiamine (B1 and cyanocobalamine (B12 compared to pregabalin in patients with moderate to severe intensity PDN. Method. Multicenter, randomized, blind study. Two hundred and seventy patients were evaluated, 147 with GBP/B1/B12 and 123 with PGB, with a 7/10 pain intensity on the Visual Analog Scale (VAS. Five visits (12 weeks were scheduled. The GBP/B1 (100 mg/B12 (20 mg group started with 300 mg at visit 1 to 3600 mg at visit 5. The PGB group started with 75 mg/d at visit 1 to 600 mg/d at visit 5. Different safety and efficacy scales were applied, as well as adverse event assessment. Results. Both drugs showed reduction of pain intensity, without significant statistical difference (P=0.900. In the GBP/B1/B12 group, an improvement of at least 30% on VAS correlated to a 900 mg/d dose, compared with PGB 300 mg/d. Likewise, occurrence of vertigo was lower in the GBP/B1-B12 group, with a significant statistical difference, P=0.014. Conclusions. Our study shows that GPB/B1-B12 combination is as effective as PGB. Nonetheless, pain intensity reduction is achieved with 50% of the minimum required gabapentin dose alone (800 to 1600 mg/d in classic NDD trials. Less vertigo and dizziness occurrence was also observed in the GBP/B1/B12 group. This trial is registered with ClinicalTrials.gov NCT01364298.

"Send & Hold" Clinical Decision Support Rules improvement to reduce unnecessary testing of vitamins A, E, K, B1, B2, B3, B6 and C.

Science.gov (United States)

Rodriguez-Borja, Enrique; Corchon-Peyrallo, Africa; Barba-Serrano, Esther; Villalba Martínez, Celia; Carratala Calvo, Arturo

2018-02-03

We assessed the impact of several "send & hold" clinical decision support rules (CDSRs) within the electronical request system for vitamins A, E, K, B1, B2, B3, B6 and C for all outpatients at a large health department. When ordered through electronical request, providers (except for all our primary care physicians who worked as a non-intervention control group) were always asked to answer several compulsory questions regarding main indication, symptomatology, suspected diagnosis, vitamin active treatments, etc., for each vitamin test using a drop-down list format. After samples arrival, tests were later put on hold internally by our laboratory information system (LIS) until review for their appropriateness was made by two staff pathologists according to the provided answers and LIS records (i.e. "send & hold"). The number of tests for each analyte was compared between the 10-month period before and after CDSRs implementation in both groups. After implementation, vitamins test volumes decreased by 40% for vitamin A, 29% for vitamin E, 42% for vitamin K, 37% for vitamin B1, 85% for vitamin B2, 68% for vitamin B3, 65% for vitamin B6 and 59% for vitamin C (all p values 0.03 or lower except for vitamin B3), whereas in control group, the majority increased or remained stable. In patients with rejected vitamins, no new requests and/or adverse clinical outcome comments due to this fact were identified. "Send & hold" CDSRs are a promising informatics tool that can support in utilization management and enhance the pathologist's leadership role as tests specialist.

Animal experiments and clinical studies on the role of the vitamins B1, B2, and B6 in radiation protection

International Nuclear Information System (INIS)

Schmidt, W.; Wulff, K.; Grimm, U.

1988-01-01

The effects of ionizing radiation on erythrocytic transketolase, glutathion reductase, and aspartate-aminotransferase activities with and without addition of coenzymes were studied in 152 Wistar rats, six beagles, and 225 carcinoma patients, as a measure for vitamin B 1 , B 2 , and B 6 supplies. Examinations of 108 patients with mammary carcinoma and 117 patients with cervical, corpus, and ovarian carcinomas were undertaken prior to, during, and after termination of radiotherapy. Two check-up series were run, the first without vitamin B complex therapy, and the second with three daily applications of one dragee each, beginning on the first day of irradiation. The TPP effects recorded indicated no impairment of vitamin B 1 supply. FAD and PLP effects, on the other hand, were significantly increased, which suggested B 2 and B 6 deficits. Vitamin B 2 metabolism was causally impaired by radiation, while the disordes in vitamin B 6 metabolism were attributed to tumour-related causes. The results obtained revealed that both types of disorders can be avoided by prophylactic vitamin B complex treatment. (author)

B2B-verkkokaupan markkinointiviestintäsuunnitelma

OpenAIRE

Luoma, Hanna

2015-01-01

Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

Electronic Commerce in Tourism in China: B2B or B2C?

Science.gov (United States)

Li, Hongxiu; Suomi, Reima

E-commerce has significantly changed the distribution channels of travel products in the world including China. Online channels are growing important in travel service distribution. In China tourism industry has been developed rapidly with the economic development, more and more international travel service providers are trying to expand their Chinese market through the Internet. This paper sheds lights on the e-commerce development models in China for international travel service providers. It explores the current e-tourism in China from the three different participants in the value chain in tourism industry - consumer, travel agent and travel service provider. The paper also identifies the barriers in B2C arena in international outbound travel market, and discusses the possible approaches for international travel service providers to develop their e-commerce in the huge Chinese market. The results in this study reveal that international travel service providers should focus on B2B model to expand their electronic market in China. B2C development in tourism largely depends on the change of Chinese customers' behavior and the change of international tourism regulations. The findings of the study are expected to assist international travel service providers to understand current e-tourism in China and to support their planning for future e-commerce development in China.

Measurement of $A^{b}_{FB}$ using Inclusive $b$-hadron Decays

CERN Document Server

Heister, A.; Barate, R.; De Bonis, I.; Decamp, D.; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; De Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Greening, T.C.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schneider, O.; Tejessy, W.; Teubert, F.; Tournefier, E.; Ward, J.; Ajaltouni, Z.; Badaud, F.; Falvard, A.; Gay, P.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Spagnolo, P.; Halley, A.W.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Thompson, A.S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C.K.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Pearson, M.R.; Robertson, N.A.; Giehl, I.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Aleppo, M.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Lefrancois, J.; Veillet, J.J.; Videau, I.; Yuan, C.; Bagliesi, Giuseppe; Boccali, T.; Calderini, G.; Foa, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Misiejuk, A.; Strong, J.A.; Teixeira-Dias, P.; Von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Konstantinidis, N.; Litke, A.M.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Ngac, A.; Prange, G.; Sieler, U.; Giannini, G.; Rothberg, J.; Armstrong, S.R.; Cranmer, K.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.

2001-01-01

Based on a sample of four million events collected by ALEPH from 1991 to 1995, a measurement of the forward-backward asymmetry in Z -> b-barb decays using inclusive final states is presented. High-performance tagging of b-barb events in a wide angular range is achieved using neural network techniques. An optimal hemisphere charge estimator is built by merging primary and secondary vertex information, leading kaon identification and jet charge in a neural network. The average charge asymmetry, the flavour tagging efficiencies and mean b-hemisphere charges are measured from data and used to extract the pole b asymmetry in the Standard Model A^{0,b}_{FB} = 0.1009 +- 0.0027 (stat) +- 0.0015 (syst) , corresponding to a value of the effective weak mixing angle of sin^2(theta_W^{eff}) = 0.23193 +- 0.00056.

Understand B-type stars

Science.gov (United States)

1982-01-01

When observations of B stars made from space are added to observations made from the ground and the total body of observational information is confronted with theoretical expectations about B stars, it is clear that nonthermal phenomena occur in the atmospheres of B stars. The nature of these phenomena and what they imply about the physical state of a B star and how a B star evolves are examined using knowledge of the spectrum of a B star as a key to obtaining an understanding of what a B star is like. Three approaches to modeling stellar structure (atmospheres) are considered, the characteristic properties of a mantle, and B stars and evolution are discussed.

29 CFR Appendix B to Subpart B of... - Reprint of U.S. Coast Guard Regulations Referenced in Subpart B, for Determination of Coast Guard...

Science.gov (United States)

2010-07-01

... Subpart B, for Determination of Coast Guard Authorized Persons B Appendix B to Subpart B of Part 1915... Enclosed Spaces and Other Dangerous Atmospheres in Shipyard Employment Pt. 1915, Subpt. B, App. B Appendix B to Subpart B of Part 1915—Reprint of U.S. Coast Guard Regulations Referenced in Subpart B, for...

EBI2 overexpression in mice leads to B1 B cell expansion and chronic lymphocytic leukemia-(CLL)-like B cell malignancies

DEFF Research Database (Denmark)

Niss Arfelt, Kristine; Barington, Line; Benned-Jensen, Tau

2017-01-01

-targeted expression of human EBI2 in mice reduces germinal center-dependent immune responses, reduces total IgM and IgG levels, and leads to increased proliferation and upregulation of cellular oncogenes. Furthermore, hEBI2 overexpression leads to an abnormally expanded CD5+ B1a B cell subset present as early as 4......Human and mouse chronic lymphocytic leukemia (CLL) develop from CD5+ B cells that in mice and macaques are known to define the distinct B1a B cell lineage. B1a cells are characterized by lack of germinal center development and the B1a cell population is increased in mice with reduced germinal...... cells towards the extrafollicular area, whereas downregulation is essential for germinal center formation. We therefore speculated whether increased expression of EBI2 would lead to an expanded B1 cell subset and, ultimately, progression to chronic lymphocytic leukemia. Here we demonstrate that B cell...

Bismuth-boron multiple bonding in BiB_2O"- and Bi_2B"-

International Nuclear Information System (INIS)

Jian, Tian; Cheung, Ling Fung; Chen, Teng-Teng; Wang, Lai-Sheng

2017-01-01

Despite its electron deficiency, boron is versatile in forming multiple bonds. Transition-metal-boron double bonding is known, but boron-metal triple bonds have been elusive. Two bismuth boron cluster anions, BiB_2O"- and Bi_2B"-, containing triple and double B-Bi bonds are presented. The BiB_2O"- and Bi_2B"- clusters are produced by laser vaporization of a mixed B/Bi target and characterized by photoelectron spectroscopy and ab initio calculations. Well-resolved photoelectron spectra are obtained and interpreted with the help of ab initio calculations, which show that both species are linear. Chemical bonding analyses reveal that Bi forms triple and double bonds with boron in BiB_2O"- ([Bi≡B-B≡O]"-) and Bi_2B"- ([Bi=B=Bi]"-), respectively. The Bi-B double and triple bond strengths are calculated to be 3.21 and 4.70 eV, respectively. This is the first experimental observation of Bi-B double and triple bonds, opening the door to design main-group metal-boron complexes with multiple bonding. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Investigation of the Decay of Orbitally-Excited B Mesons and First Measurement of the Branching Ratio $BR(B^{*}_{J} \\rightarrow B^{*}\\pi(X))$

CERN Document Server

Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Benelli, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Cammin, J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; de Roeck, A.; de Wolf, E.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Glenzinski, D.; Goldberg, J.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauke, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lawson, I.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rembser, C.; Renkel, P.; Rick, H.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Stumpf, L.; Surrow, B.; Talbot, S.D.; Tarem, S.; Taylor, R.J.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Toya, D.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Vachon, B.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.

2002-01-01

From about 4 million hadronic Z decays recorded by the OPAL detector on and near to the Z resonance, we select a sample of more than 570000 inclusively reconstructed B mesons. Orbitally-excited mesons B*J are reconstructed using Bpi+- combinations. Independently, B* mesons are reconstructed using the decay B* -> Bgamma. The selected B* candidates are used to obtain samples enriched or depleted in the decay B*J -> B*pi+-(X), where (X) refers to decay modes with or without additional accompanying decay particles. From the number of signal candidates in the Bpi+- mass spectra of these two samples, we perform the first measurement of the branching ratio of orbitally-excited B mesons decaying into B*pi(X): BR(B*J ->B*pi(X)) = 0.85 +0.36-0.37 +- 0.12, where the first error is statistical and the second systematic. If B*J decay modes other than single pion transitions can be neglected the measured ratio corresponds to the branching ratio BR(B*J->B*pi). In the framework of Heavy Quark Symmetry, a simultaneous fit to ...

USING UML SCENARIOS IN B2B SYSTEMS

Directory of Open Access Journals (Sweden)

A. Jakimi

2010-05-01

Full Text Available Scenarios has become a popular technique for requirements elicitation and specification building. Since scenarios capture only partial descriptions of the system behavior, an approach for scenario composition and/or integration is needed to produce more complete specifications. The Unified Modeling Language (UML, which has become a standard notation for object-oriented modeling, provides a suitable framework for scenario acquisition using Use Case diagrams and Sequence or Collaboration diagrams. In this paper, we suggest an algorithmic and tool support for composing and integrating scenarios that are represented in form of sequence diagrams. We suggest four operators (;: sequential operator, ||: concurrent operator, ?: conditional operator and  * :iteration operator to compose a set of scenarios that describe a use case of a given system. In this paper, we suggest also to apply the scenario approach to B2B systems (Business to Business. We propose to develop B2B systems as a three activities process deriving formal specifications and code skeletons from UML scenarios. Activities of this proposed process are generally automatic and are supported by a set of developed algorithms and tools.

Usability perspective on social media sites' adoption in the B2B context

OpenAIRE

Lacka, Ewelina; Chong, Alain

2016-01-01

While social media sites have been successfully adopted and used in the B2C context, they are perceived to be irrelevant in B2B marketing. This is due to marketers' perception of poor usability of these sites in the B2B sector. This study investigates the usability of social media sites when adopted for B2B marketing purposes in the one of world's largest social media market: China. Specifically, by extending the Technology Acceptance Model with Nielsen's Model of Attributes of System Accepta...

WARM SPITZER OBSERVATIONS OF THREE HOT EXOPLANETS: XO-4b, HAT-P-6b, AND HAT-P-8b

Energy Technology Data Exchange (ETDEWEB)

Todorov, Kamen O. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Planetary Systems Laboratory, NASA' s Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 05844 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P.; Lewis, Nikole K. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)

2012-02-10

We analyze Warm Spitzer/Infrared Array Camera observations of the secondary eclipses of three planets, XO-4b, HAT-P-6b, and HAT-P-8b. We measure secondary eclipse amplitudes at 3.6 {mu}m and 4.5 {mu}m for each target. XO-4b exhibits a stronger eclipse depth at 4.5 {mu}m than at 3.6 {mu}m, which is consistent with the presence of a temperature inversion. HAT-P-8b shows a stronger eclipse amplitude at 3.6 {mu}m and is best described by models without a temperature inversion. The eclipse depths of HAT-P-6b can be fitted with models with a small or no temperature inversion. We consider our results in the context of a postulated relationship between stellar activity and temperature inversion and a relationship between irradiation level and planet dayside temperature, as discussed by Knutson et al. and Cowan and Agol, respectively. Our results are consistent with these hypotheses, but do not significantly strengthen them. To measure accurate secondary eclipse central phases, we require accurate ephemerides. We obtain primary transit observations and supplement them with publicly available observations to update the orbital ephemerides of the three planets. Based on the secondary eclipse timing, we set upper boundaries for ecos ({omega}) for HAT-P-6b, HAT-P-8b, and XO-4b and find that the values are consistent with circular orbits.

Yeast-recombinant hepatitis B vaccine: efficacy with hepatitis B immune globulin in prevention of perinatal hepatitis B virus transmission

International Nuclear Information System (INIS)

Stevens, C.E.; Taylor, P.E.; Tong, M.J.; Toy, P.T.; Vyas, G.N.; Nair, P.V.; Weissman, J.Y.; Krugman, S.

1987-01-01

A yeast-recombinant hepatitis B vaccine was licensed recently by the Food and Drug administration and is now available. To assess the efficacy of the yeast-recombinant vaccine, the authors administered the vaccine in combination with hepatitis B immune globulin to high-risk newborns. If infants whose mothers were positive for both hepatitis B surface antigen and the e antigen receive no immunoprophylaxis, 70% to 90% become infected with the virus, and almost all become chronic carriers. Among infants in this study who received hepatitis B immune globulin at birth and three 5- + g doses of yeast-recombinant hepatitis B vaccine, only 4.8% became chronic carriers, a better than 90% level of protection and a rate that is comparable with that seen with immune globulin and plasma-derived hepatitis B vaccine. Hepatitis surface antigen and antibodies were detected by radioimmunoassay. These data suggest that, in this high-risk setting, the yeast-recombinant vaccine is as effective as the plasma-derived vaccine in preventing hepatitis B virus infection and the chronic carrier state

Efeitos da suplementação de b-hidroxi-b-metilbutirato sobre a força e a hipertrofia Effects of b-hydroxy-b-methylbutyrate supplementation on strength and hypertrophy

Directory of Open Access Journals (Sweden)

Thiago da Silveira Alvares

2008-02-01

Full Text Available O b-hidroxi-b-metilbutirato é um metabólito da leucina estudado devido aos seus efeitos anticatabólicos e possíveis implicações sobre os ganhos de força e massa muscular associados ao treinamento contra-resistência (conhecido como musculação. O objetivo deste trabalho foi revisar a literatura referente à suplementação de b-hidroxi-b-metilbutirato e os seus efeitos sobre força e hipertrofia em adultos jovens e idosos iniciantes ou treinados em treinamento contra-resistência. Estudos em indivíduos iniciando um programa de treinamento contra-resistência sugerem que a suplementação diária de 1,5 a 3,0g de b-hidroxi-b-metilbutirato pode trazer benefício ergogênico durante as primeiras quatro ou cinco semanas. Entretanto, à medida que o programa de treinamento evolui, tais efeitos não permanecem e os ganhos de força e massa muscular são proporcionados apenas pelo treinamento contra-resistência. Em indivíduos treinados, os resultados parecem não ser os mesmos, uma vez que, desde o início da suplementação, o b-hidroxi-b-metilbutirato não demonstra qualquer benefício adicional aos induzidos pelo treinamento contra-resistência. Alguns efeitos do b-hidroxi-b-metilbutirato na redução do colesterol total e lipoproteína de baixa densidade também foram observados, porém, devido às poucas evidências, não há recomendações para tal finalidade. Nenhum efeito adverso da suplementação foi observado, sendo, aparentemente, segura, contudo a maioria dos estudos foi realizada em curto prazo (menos de 4 semanas e em indivíduos destreinados. Assim, mais estudos são necessários para esclarecer o mecanismo fisiológico por meio do qual o b-hidroxi-b-metilbutirato exerce seus efeitos anticatabólicos em destreinados e para observar possíveis efeitos adversos.b-hydroxy-b-methylbutyrate is a leucine metabolite studied for its anticatabolic effects and potential benefits on strength and muscle mass gains associated with

Neutron diffraction studies on GdB6 and TbB6 powders

International Nuclear Information System (INIS)

Luca, S.E.; Amara, M.; Galera, R.M.; Givord, F.; Granovsky, S.; Isnard, O.; Beneu, B.

2004-01-01

We report here the first powder neutron diffraction study of GdB 6 and TbB 6 . GdB 6 and TbB 6 order antiferromagnetically at 15 and 21 K, respectively. In both compounds the transition at T N is of the first order. Moreover GdB 6 presents a second spontaneous magnetic transition at T * =8 K. The present study shows that, in both compounds, the magnetic propagation vectors belong to the star and that the direction of the magnetic moment is perpendicular to the ((1)/(2)) component of the wave-vector in GdB 6 , while in TbB 6 the moment is parallel to it. The deduced low-temperature values of the magnetic moments agree with those of the respective rare-earth trivalent ions

Interface interaction in the B{sub 4}C/(Fe-B-C) system

Energy Technology Data Exchange (ETDEWEB)

Aizenshtein, M. [Department of Material Engineering, Ben-Gurion University, P.O. Box 653, Beer-Sheva 84105 (Israel); NRC-Negev, P.O. Box 9001, Beer-Sheva 84190 (Israel); Mizrahi, I.; Froumin, N.; Hayun, S.; Dariel, M.P. [Department of Material Engineering, Ben-Gurion University, P.O. Box 653, Beer-Sheva 84105 (Israel); Frage, N. [Department of Material Engineering, Ben-Gurion University, P.O. Box 653, Beer-Sheva 84105 (Israel)], E-mail: nfrage@bgu.ac.il

2008-11-15

The wetting behavior in the B{sub 4}C/(Fe-C-B) system was investigated in order to clarify the role of Fe additions on the sinterability of B{sub 4}C. Iron and its alloys with C and B react with the boron carbide substrate and form a reaction zone consisting of a fine mixture of FeB and graphite. The apparent contact angles are relatively low for the alloys with a moderate concentration of the boron and carbon and allow liquid phase sintering to occur in the B{sub 4}C-Fe mixtures. A dilatometric study of the sintering kinetics confirms that liquid phase sintering actually takes place and leads to improved mass transfer. A thermodynamic analysis of the ternary Fe-B-C system allows accounting for the experimental observations.

Drivers of relationships affecting B2B firms in an e-commerce environment

Directory of Open Access Journals (Sweden)

Irene Samanta

2014-09-01

Full Text Available The advent of the internet has created numerous opportunities for B2B marketing professionals to enhance current marketing practices, including electronic relationships. However, the investigation of e-relationships and the factors that influence e-relationships in an internet environment is scant. Further, there appears to be no investigation of this phenomenon within the context of Greek B2B Medium-sized firms (MSF. Τhe research problem investigated in this research is: “Which drivers in B2B e-commerce use affect inter-firm relationships in medium-sized B2B firms?”. A framework for B2B e-commerce relationships in a changing and globalized environment was synthesised and integrated with the literature about relationship marketing to arrive at the following research issues: “How do relationship marketing drivers affect the management of B2B e-relationships?”. An explanatory quantitative research approach was used and quantitative data was collected from B2B firms in Greece, which represents a case of e-commerce progress during the last six years. Regarding social exchange, some important differences emerge where cooperation between B2B e-commerce firms is concerned. Suppliers engaged in electronic commerce are more committed and oriented to a long-term relationship than buyers, based on both previous and current experience with them. Confidence in the relationships, consistency and honesty with their obligations and the exchange of reliable, trustworthy information and advisory services between firms are important factors in the development and establishment of their e-relationships. The main contribution of this research is the development of a theoretical framework for e-relationships in medium-sized Β2Β firms. That framework is the first rigorously researched step towards understanding the importance of these powerful streams of relationship drivers in total, and the business activity of e-marketing and electronic relationships.

A study of B0- anti B0 mixing using the ARGUS Detector

International Nuclear Information System (INIS)

Tzamariudaki, E.

1995-02-01

Using the ARGUS detector at the e + e - storage ring DORIS II at DESY, a study of the decay anti B 0 →D *+ l - anti νhas been performed by exploiting a partial D *+ reconstruction technique. The branching ratio was determined to be (4.4±0.3±0.3)% for this mode, and for the higher excited D * (J) states Br( anti B 0 →D (J) *+ l - anti ν)=(2.5±0.6±0.5)%. Furthermore, the inclusive D *+ branching ratio in B decays was measured by fully reconstructing D *+ candidates. Using a tagged subset of this sample of B 0 meson decays in the mode anti B 0 →D *+ l - anti ν, B d 0 anti B d 0 oscillations have been studied. For this purpose two tagging techniques have been applied: the standard method of using fast leptons, and a new technique which makes use of kaons to tag the b flavour content. Combining the values obtained by these two methods, the B 0 anti B 0 mixing parameter χ d , used to denote the strength of the oscillations, was determined to be χ d =0.165±0.057. In addition, using fully reconstructed D *+ candidates, a third study of the B 0 anti B 0 mixing parameter was carried out by investigating D *+ K ± correlations. The mixing measurements obtained using kaons to tag the B meson flavour employ this technique for the first time. Future CP violation measurements at B Factories will place critical reliance on this method. Finally, using the extracted value for the mixing parameter χ d , the CKM matrix element V td was determined and the B s 0 anti B s 0 mixing parameter χ s was obtained. (orig.)

Granzyme B mediated function of Parvovirus B19-specific CD4+ T cells

Science.gov (United States)

Kumar, Arun; Perdomo, Maria F; Kantele, Anu; Hedman, Lea; Hedman, Klaus; Franssila, Rauli

2015-01-01

A novel conception of CD4+ T cells with cytolytic potential (CD4+ CTL) is emerging. These cells appear to have a part in controlling malignancies and chronic infections. Human parvovirus B19 can cause a persistent infection, yet no data exist on the presence of B19-specific CD4+ CTLs. Such cells could have a role in the pathogenesis of some autoimmune disorders reported to be associated with B19. We explored the cytolytic potential of human parvovirus B19-specific T cells by stimulating peripheral blood mononuclear cell (PBMC) with recombinant B19-VP2 virus-like particles. The cytolytic potential was determined by enzyme immunoassay-based quantitation of granzyme B (GrB) and perforin from the tissue culture supernatants, by intracellular cytokine staining (ICS) and by detecting direct cytotoxicity. GrB and perforin responses with the B19 antigen were readily detectable in B19-seropositive individuals. T-cell depletion, HLA blocking and ICS experiments showed GrB and perforin to be secreted by CD4+ T cells. CD4+ T cells with strong GrB responses were found to exhibit direct cytotoxicity. As anticipated, ICS of B19-specific CD4+ T cells showed expected co-expression of GrB, perforin and interferon gamma (IFN-γ). Unexpectedly, also a strong co-expression of GrB and interleukin 17 (IL-17) was detected. These cells expressed natural killer (NK) cell surface marker CD56, together with the CD4 surface marker. To our knowledge, this is the first report on virus-specific CD4+ CTLs co-expressing CD56 antigen. Our results suggest a role for CD4+ CTL in B19 immunity. Such cells could function within both immune regulation and triggering of autoimmune phenomena such as systemic lupus erythematosus (SLE) or rheumatoid arthritis. PMID:26246896

Anaphase B

Directory of Open Access Journals (Sweden)

Jonathan M. Scholey

2016-12-01

Full Text Available Anaphase B spindle elongation is characterized by the sliding apart of overlapping antiparallel interpolar (ip microtubules (MTs as the two opposite spindle poles separate, pulling along disjoined sister chromatids, thereby contributing to chromosome segregation and the propagation of all cellular life. The major biochemical “modules” that cooperate to mediate pole–pole separation include: (i midzone pushing or (ii braking by MT crosslinkers, such as kinesin-5 motors, which facilitate or restrict the outward sliding of antiparallel interpolar MTs (ipMTs; (iii cortical pulling by disassembling astral MTs (aMTs and/or dynein motors that pull aMTs outwards; (iv ipMT plus end dynamics, notably net polymerization; and (v ipMT minus end depolymerization manifest as poleward flux. The differential combination of these modules in different cell types produces diversity in the anaphase B mechanism. Combinations of antagonist modules can create a force balance that maintains the dynamic pre-anaphase B spindle at constant length. Tipping such a force balance at anaphase B onset can initiate and control the rate of spindle elongation. The activities of the basic motor filament components of the anaphase B machinery are controlled by a network of non-motor MT-associated proteins (MAPs, for example the key MT cross-linker, Ase1p/PRC1, and various cell-cycle kinases, phosphatases, and proteases. This review focuses on the molecular mechanisms of anaphase B spindle elongation in eukaryotic cells and briefly mentions bacterial DNA segregation systems that operate by spindle elongation.

B cells and B cell products-helping to restore cellular immunity?

OpenAIRE

Cascalho, Marilia; Platt, Jeffrey L.

2006-01-01

T cells that provide vital protection against tumors, viruses and intracellular bacteria are thought to develop independently of B cells. However, recent discoveries suggest that development of T cells depends on B cells. One way B cells promote T cell development is by providing diverse peptides that may promote positive selection of thymocytes. Diverse peptides and B cells help in diversification of the T cell receptor repertoire and may decrease cross-reactivity in the mature T cell compar...

B Physics at tevatron and the B Factories

International Nuclear Information System (INIS)

Paus, C.

2004-01-01

The following contribution is in no way a complete summary of the physics of b hadrons but merely a selection of some key topics which the author considered exemplary to explain the essence of B physics to beginners in the field. The main emphasis has been put on electroweak decays of b hadrons which in one form or another contain information about the Cabibbo-Kobayashi-Maskawa matrix. The elements of this matrix define the coupling strength of the various quark pairs to the W boson. The coupling strengths cannot be predicted but have to be measured and are thus input parameters to the Standard Model of Particle Physics. Furthermore the CKM matrix is the mechanism which implements CP violation in the Standard Model. The phenomenon of CP violation and the CKM matrix are enjoying quite some attention since there are indications that something is not right in the Standard Model. This contribution discusses the most prominent measurements in the field of B physics which are presently performed or prepared at the Tevatron and the B factories. The experimental setup in terms of the accelerators and the experiments is described in the beginning. The differences between e+e- and pp machines and the corresponding detector designs are discussed in detail. In the next step the analysis tools are developed step by step by describing the measurements which make use of them. (Author) 39 refs

Macrophage and Galleria mellonella infection models reflect the virulence of naturally occurring isolates of B. pseudomallei, B. thailandensis and B. oklahomensis

Directory of Open Access Journals (Sweden)

Michell Stephen L

2011-01-01

Full Text Available Abstract Background Burkholderia pseudomallei is the causative agent of melioidosis, a tropical disease of humans with a variable and often fatal outcome. In murine models of infection, different strains exhibit varying degrees of virulence. In contrast, two related species, B. thailandensis and B. oklahomensis, are highly attenuated in mice. Our aim was to determine whether virulence in mice is reflected in macrophage or wax moth larvae (Galleria mellonella infection models. Results B. pseudomallei strains 576 and K96243, which have low median lethal dose (MLD values in mice, were able to replicate and induce cellular damage in macrophages and caused rapid death of G. mellonella. In contrast, B. pseudomallei strain 708a, which is attenuated in mice, showed reduced replication in macrophages, negligible cellular damage and was avirulent in G. mellonella larvae. B. thailandensis isolates were less virulent than B. pseudomallei in all of the models tested. However, we did record strain dependent differences. B. oklahomensis isolates were the least virulent isolates. They showed minimal ability to replicate in macrophages, were unable to evoke actin-based motility or to form multinucleated giant cells and were markedly attenuated in G. mellonella compared to B. thailandensis. Conclusions We have shown that the alternative infection models tested here, namely macrophages and Galleria mellonella, are able to distinguish between strains of B. pseudomallei, B. thailandensis and B. oklahomensis and that these differences reflect the observed virulence in murine infection models. Our results indicate that B. oklahomensis is the least pathogenic of the species investigated. They also show a correlation between isolates of B. thailandensis associated with human infection and virulence in macrophage and Galleria infection models.

ENDF/B format

International Nuclear Information System (INIS)

Khalil, M.A.; Lemmel, H.D.

1986-09-01

This document is a brief user's description of the format of ENDF/B. This format, originally designed for the US Evaluated Nuclear Data File, is recommended for international use. This summary is an aid to customers of the IAEA Nuclear Data Section when receiving data retrievals in ENDF/B format. For more detailed information the report BNL-NCS-50496 (ENDF 102) should be consulted. An Appendix to the present document gives a summary of the format differences between ENDF/B-4 and ENDF/B-5. (author)

B Karthick

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education. B Karthick. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 12 December 2008 pp 1141-1145 General Article. Lotus-Inspired Nanotechnology Applications · B Karthick Ramesh Maheshwari · More Details Fulltext PDF ...

B physics at SLD

International Nuclear Information System (INIS)

Willocq, S.

1997-06-01

The authors review recent B physics results obtained in polarized e + e - interactions at the SLC by the SLD experiment. The excellent 3-D vertexing capabilities of SLD are exploited to extract precise B + and B d 0 lifetimes, as well as measurements of the time evolution of B d 0 - (anti B d 0 ) mixing

Parvovirus B19.

Science.gov (United States)

Landry, Marie Louise

2016-06-01

Primary parvovirus B19 infection is an infrequent, but serious and treatable, cause of chronic anemia in immunocompromised hosts. Many compromised hosts have preexisting antibody to B19 and are not at risk. However, upon primary infection, some patients may be able to mount a sufficient immune response to terminate active parvovirus B19 infection of erythroid precursors. The most common consequence of B19 infection in the compromised host is pure red-cell aplasia, resulting in chronic or recurrent anemia with reticulocytopenia. Anemia persists until neutralizing antibody is either produced by the host or passively administered. Parvovirus B19 should be suspected in compromised hosts with unexplained or severe anemia and reticulocytopenia, or when bone-marrow examination shows either giant pronormoblasts or absence of red-cell precursors. Diagnosis is established by detection of B19 DNA in serum in the absence of IgG antibody to B19. In some cases, IgG antibody is detected but is not neutralizing. Anti-B19 IgM may or may not be present. Therapy includes any or all of the following: red-cell transfusion, adjustment in medications to restore or improve the patient's immune system, and administration of intravenous immunoglobulin (IVIG). Following treatment, patients should be closely monitored, especially if immunosuppression is unchanged or increased. Should hematocrit trend downward and parvovirus DNA trend upward, the therapeutic options above should be revisited. In a few instances, monthly maintenance IVIG may be indicated. Caregivers should be aware that B19 variants, though rarely encountered, can be missed or under-quantitated by some real-time polymerase-chain reaction methods.

B physics at LEP

International Nuclear Information System (INIS)

Kowalewski, R.V.; Rizzo, G.; Stocchi, A.

1995-01-01

LEP has contributed substantially to our knowledge of B hadrons. Results will be presented on the lifetimes of weakly decaying B hadrons and on BB oscillations; in each case the LEP results are the most precise measurements of these quantities. The first observations of orbitally excited beauty mesons and of Σ b and Σ b * baryons, obtained during the past year, will be reviewed. Recent measurements of charmonium production in B decays and searches for B c will also be presented. (orig.)

Enterocin B3A-B3B produced by LAB collected from infant faeces: potential utilization in the food industry for Listeria monocytogenes biofilm management.

Science.gov (United States)

Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel

2017-02-01

Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.

Measurement of the $B_{d}^{0} - \\overline{B}_{d}^{0}$ oscillation frequency

CERN Document Server

Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Leggett, C; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Rind, O; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schneegans, M; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Vlachos, S; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F

1998-01-01

Time-dependent ${\\mathrm{B^{0}}\\mbox{-}\\bar{\\mathrm{B}} ^{0}}$ mixing is studied using about two million hadronic Z decays registered by L3 in 1994 and 1995. For this study three techniques are used. Tagging of the b-quark charge at decay time is performed by identifying leptons from semileptonic B decays. The flavour of the b quark at production time is determined from the charge of the lepton in the opposite hemisphere or by using a jet-charge technique. The proper time of the B-particle decay is obtained by reconstructing the production and decay vertices or by a measurement of the lepton impact parameter. The combined result for the frequency of ${\\mathrm{B_d^0}}$ meson oscillations is \\begin{displaymath} {\\Delta m_d} = 0.444 \\pm 0.040 \\ \\mathrm{ps}^{-1}. \\end{displaymath} \\end{abstract} \\end{document}

Social media as a support tool for B2B communication

OpenAIRE

Thapa Magar, Chandani

2016-01-01

This research was commissioned by Oulu University of Applied Sciences and a Finnish tech company Uros Ltd. As social media adoption is growing steadily in the contemporary consumer marketing, not many cases can be found where Social Media has been successfully adopted and used in a B2B scenario. Thus, it has remained as a reserved matter for many B2B companies, which still follow the tried-and-true business principles polished through traditional marketing. This research paper aims to enhanc...

Measurement of the overlineB0 and B- meson lifetimes

Science.gov (United States)

Buskulic, D.; Decamp, D.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Mours, B.; Pietrzyk, B.; Alemany, R.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Maggi, M.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bauerdick, L. A. T.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Lusiani, A.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; El Fellous, R.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Efthymiopoulos, I.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Mermikides, M.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Belk, A. T.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Dugeay, S.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Nash, J.; Payne, D. G.; Phillips, M. J.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Aubert, J.-J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Rotscheidt, H.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; Denis, R. St.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bosisio, L.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Focardi, E.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Edwards, M.; Fisher, S. M.; Jones, T. J.; Norton, P. R.; Salmon, D. P.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Perrier, F.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Carney, R. E.; Cartwright, S.; Combley, F.; Hatfield, F.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, L.; Chen, W.; Cinabro, D.; Conway, J. S.; Cowen, D. F.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Jared, R. C.; Leclaire, B. W.; Lishka, C.; Pan, Y. B.; Pater, J. R.; Saadi, Y.; Sharma, V.; Schmitt, M.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Zheng, M.; Zobernig, G.; Aleph Collaboration

1993-06-01

The lifetimes of the overlineB0 and B- mesons have been measured with the ALEPH detector at LEP. Semileptonic decays of overlineB0 and B- mesons were partially reconstructed by identifying events containing a lepton with an associated D ∗+or D 0 meson. The proper time of the B meson was estimated from the measured decay length and the momentum and mass of the D-lepton system. A fit to the proper time of 77 D ∗+ℓ - and 77 D0ℓ - candidates, combined with a constraint on the lifetime ratio ( {τ -}/{τ 0}) arising from the relative rates of observed D ∗+ℓ - and D0ℓ - events, yielded the following lifetimes: τ 0=1.52 -0.18+0.20( stat.) -0.13+0.07( syst.) ps, τ - = 1.47 -0.19+0.22( stat.) -0.14+0.15( syst.) ps, {τ -}/{τ 0} = 0.96 -0.15+0.19( stat.) -0.12+0.18( syst.) .

LytB1 and LytB2 of Mycobacterium tuberculosis Are Not Genetically Redundant.

Directory of Open Access Journals (Sweden)

Amanda Claire Brown

Full Text Available Mycobacterium tuberculosis synthesises isoprenoid precursors via the MEP/DOXP pathway and at least five enzymes in the pathway (Dxs1, Dxr/IspC, IspD, IspF, and GcpE/IspG are required for growth in vitro. We investigated the role of LytB (IspH in M. tuberculosis; M. tuberculosis is unusual in that it has two homologs-LytB1 and LytB2. We were unable to delete the lytB2 gene unless we provided an additional copy elsewhere, demonstrating that this is the essential homolog. We expressed lytB1 from the lytB2 promoter and confirmed that this could not complement for loss of function of lytB2, despite LytB1 possessing all the previously described conserved critical residues. Interestingly the sole LytB homolog of Mycobacterium smegmatis was able to compensate for loss of LytB2 in M. tuberculosis. We tested translational fusions of LytB1 and LytB2 for functionality in M. tuberculosis, but only a fusion with 90% N-terminal LytB2 and 10% C-terminal LytB1 was functional. In order to identify the key difference between the two proteins, site directed mutagenesis was used to change LytB2 residues into their counterparts in LytB1. None of these amino acid substitutions was essential for function and all lytB2 mutant alleles were functional. In contrast, mutation of the key residues for [Fe4S4] cluster formation, as well as a catalytic residue in LytB1 did not result in functional complementation. Thus, although LytB1 and LytB2 are not genetically redundant, this is not dependent on small amino acid changes, but is likely to be a result of major overall structural differences.

Human apolipoprotein B (apoB) mRNA: Identification of two distinct apoB mRNAs, an mRNA with the apoB-100 sequence and an apoB mRNA containing a premature in-frame translational stop codon, in both liver and intestine

International Nuclear Information System (INIS)

Higuchi, K.; Hospattankar, A.V.; Law, S.W.; Meglin, N.; Cortright, J.; Brewer, H.B. Jr.

1988-01-01

Human apolipoprotein B (apoB) is present in plasma as two separate isoproteins, designated apoB-100 (512 kDa) and apoB-48 (250 kDa). ApoB is encoded by a single gene on chromosome 2, and a single nuclear mRNA is edited and processed into two separate apoB mRNAs. A 14.1-kilobase apoB mRNA codes for apoB-100, and the second mRNA, which codes for apoB-48, contains a premature stop codon generated by a single base substitution of cytosine to uracil at nucleotide 6,538, which converts the translated CAA codon coding for the amino acid glutamine at residue 2,153 in apoB-100 to a premature in-frame stop codon (UAA). Two 30-base synthetic oligonucleotides, designated apoB-Stop and apoB-Gln, were synthesized containing the complementary sequence to the stop codon (UAA) and glutamine codon (CAA), respectively. The combined results from these studies establish that both human intestine and liver contain the two distinct apoB mRNAs, an mRNA that codes for apoB-100 and an apoB mRNA that contains the premature stop codon, which codes for apoB-48. The premature in-frame stop codon is not tissue specific and is present in both human liver and intestine

$B^{0}\\overline{B^{0}}$ oscillations at LEP

CERN Document Server

Palla, Fabrizio

2001-01-01

We report the LEP results on B/sup 0/B/sup 0/ oscillations, together with a review of the analysis strategies. Many measurements of the B /sub d//sup 0/ oscillation frequency have been performed giving an average, Delta m/sub d/=0.486+or-0.015 ps/sup -1/. Lower limits on Delta m/sub s/ are presented, giving a LEP-combined limit, Delta m /sub s/>11.8 ps/sup -1/, with an expected exclusion limit of 14.5 ps /sup -1/. When combined with SLD and CDF, a tantalising 2.5% effect at about 17 ps/sup -1/ is observed, having a probability of about 2.5% for a fluctuation of a sample where the true frequency is beyond the global sensitivity. (19 refs).

B-L mediated SUSY breaking with radiative B-L symmetry breaking

International Nuclear Information System (INIS)

Kikuchi, Tatsuru; Kubo, Takayuki

2008-01-01

We explore a mechanism of radiative B-L symmetry breaking in analogous to the radiative electroweak symmetry breaking. The breaking scale of B-L symmetry is related to the neutrino masses through the see-saw mechanism. Once we incorporate the U(1) B-L gauge symmetry in SUSY models, the U(1) B-L gaugino, Z-tilde B-L appears, and it can mediate the SUSY breaking (Z-prime mediated SUSY breaking) at around the scale of 10 6 GeV. Then we find a links between the neutrino mass (more precisly the see-saw or B-L scale of order 10 6 GeV) and the Z-prime mediated SUSY breaking scale. It is also very interesting that the gluino at the weak scale becomes relatively light, and almost compressed mass spectra for the gaugino sector can be realized in this scenario, which is very interesting in scope of the LHC.

The superfamily of C3b/C4b-binding proteins

DEFF Research Database (Denmark)

Kristensen, Torsten; D'Eustachio, P; Ogata, R T

1987-01-01

The determination of primary structures by amino acid and nucleotide sequencing for the C3b-and/or C4b-binding proteins H, C4BP, CR1, B, and C2 has revealed the presence of a common structural element. This element is approximately 60 amino acids long and is repeated in a tandem fashion, commencing...... at the amino-terminal end of each molecule. Two other complement components, C1r and C1s, have two of these repeating units in the carboxy-terminal region of their noncatalytic A chains. Three noncomplement proteins, beta 2-glycoprotein I (beta 2I), the interleukin 2 receptor (IL 2 receptor), and the b chain...... of factor XIII, have 4, 2 and 10 of these repeating units, respectively. These proteins obviously belong to the above family, although there is no evidence that they interact with C3b and/or C4b. Human haptoglobin and rat leukocyte common antigen also contain two and three repeating units, respectively...

B P Bag

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. B P Bag. Articles written in Bulletin of Materials Science. Volume 35 Issue 1 February 2012 pp 1-5. Structural and optical characterization of thick and thin polycrystalline diamond films deposited by microwave plasma activated CVD · S K Pradhan B Satpati B P Bag T Sharda.

Evaluation of FlaB1, FlaB2, FlaB3, and Tp0463 of Treponema pallidum for serodiagnosis of syphilis.

Science.gov (United States)

Jiang, Chuanhao; Xiao, Jinhong; Xie, Yafeng; Xiao, Yongjian; Wang, Chuan; Kuang, Xingxing; Xu, Man; Li, Ranhui; Zeng, Tiebing; Liu, Shuanquan; Yu, Jian; Zhao, Feijun; Wu, Yimou

2016-02-01

Syphilis is a multistage disease caused by the invasive spirochete Treponema pallidum subsp. pallidum, and accurate diagnosis is important for the prevention and treatment of syphilis. Here, to identify appropriate diagnostic antigens for serodiagnosis of syphilis, 6 recombinant proteins were expressed in Escherichia coli and purified, including flagellins (FlaB1 [Tp0868], FlaB2 [Tp0792], and FlaB3 [Tp0870]), Tp0463, Tp0751, and Tp1038. The sensitivities were determined by screening sera from individuals with primary (n=82), secondary (n=115), latent (n=105), and congenital (n=65) syphilis. The specificities were determined by screening sera from uninfected controls (n=30) and potentially cross-reactive infections including Lyme disease (n=30), leptospirosis (n=5), and hepatitis B (n=30). Our data showed that FlaB1, FlaB2, FlaB3, Tp0463, and Tp1038 exhibited higher overall sensitivities and specificities for detecting IgG antibody, with 95.4% and 98.9%, 92.6% and 95.8%, 95.1% and 95.8%, 92.6% and 97.9%, and 95.9% and 98.9%, respectively. In contrast, Tp0751 demonstrated only an overall sensitivity of 39.2%. For comparison, the sensitivity and specificity of Architect Syphilis TP were determined to be 98.1% and 93.7%, respectively. In addition, FlaB1, FlaB2, FlaB3, and Tp0463 demonstrated excellent performance for detecting IgM antibody in primary and congenital syphilis, with sensitivities of 76.8% and 83.1%, 72.0% and 87.7%, 74.4% and 89.2%, and 64.6% and 75.3%, respectively. These results indicate that FlaB1, FlaB2, FlaB3, and Tp0463 could be as novel diagnostic candidates for serodiagnosis of syphilis. Copyright © 2016 Elsevier Inc. All rights reserved.

Symmetry Tests in Polarized Z{sup 0} Decays to b{bar b}g

Energy Technology Data Exchange (ETDEWEB)

Muller, David

1999-07-09

Angular asymmetries have been measured in polarized Z{sup 0} decays to b{bar b}g collected by the SLD experiment at the SLC. A high purity b{bar b}g event sample is selected by utilizing B lifetime information given by the SLD CCD pixel vertex detector and the stable micron-size SLC beams, and the b- and {bar b}-jets are identified using lifetime information and momentum- weighted track charge. The forward-backward asymmetry is observed in the b-quark polar angle distribution, and the parity-violation parameter is measured to test the Standard Model. Two angular correlations between the three-jet plane and the Z{sup 0} polarization are studied. The CP-even and T-odd, and the CP-odd and T-odd, angular asymmetries are sensitive to physics beyond the Standard Model. The latter requires tagging both the b- and {bar b}-jet. We measure the expectation values of these quantities to be consistent with zero and set limits on the correlations at the 5% level.

Observation and characterization of the smallest borospherene, B28− and B28

International Nuclear Information System (INIS)

Wang, Ying-Jin; Chen, Qiang; You, Xue-Rui; Ou, Ting; Zhao, Xiao-Yun; Li, Si-Dian; Zhao, Ya-Fan; Li, Jun; Li, Wei-Li; Jian, Tian; Wang, Lai-Sheng; Zhai, Hua-Jin

2016-01-01

Free-standing boron nanocages or borospherenes have been observed recently for B 40 − and B 40 . There is evidence that a family of borospherenes may exist. However, the smallest borospherene is still not known. Here, we report experimental and computational evidence of a seashell-like borospherene cage for B 28 − and B 28 . Photoelectron spectrum of B 28 − indicated contributions from different isomers. Theoretical calculations showed that the seashell-like B 28 − borospherene is competing for the global minimum with a planar isomer and it is shown to be present in the cluster beam, contributing to the observed photoelectron spectrum. The seashell structure is found to be the global minimum for neutral B 28 and the B 28 − cage represents the smallest borospherene observed to date. It is composed of two triangular close-packed B 15 sheets, interconnected via the three corners by sharing two boron atoms. The B 28 borospherene was found to obey the 2(n + 1) 2 electron-counting rule for spherical aromaticity

Dietary intake of the water-soluble vitamins B1, B2, B6, B12 and C in 10 countries in the European Prospective Investigation into Cancer and Nutrition.

Science.gov (United States)

Olsen, A; Halkjaer, J; van Gils, C H; Buijsse, B; Verhagen, H; Jenab, M; Boutron-Ruault, M C; Ericson, U; Ocké, M C; Peeters, P H M; Touvier, M; Niravong, M; Waaseth, M; Skeie, G; Khaw, K T; Travis, R; Ferrari, P; Sanchez, M J; Agudo, A; Overvad, K; Linseisen, J; Weikert, C; Sacerdote, C; Evangelista, A; Zylis, D; Tsiotas, K; Manjer, J; van Guelpen, B; Riboli, E; Slimani, N; Bingham, S

2009-11-01

To describe the intake of vitamins thiamine (B1), riboflavin (B2), B6 (pyridoxine), B12 (cobalamine) and C (ascorbic acid) and their food sources among 27 centres in 10 countries participating in the European Prospective Investigation into Cancer and Nutrition (EPIC) study. Between 1995 and 2000, 36 034 persons aged between 35 and 74 years were administered a standardized 24-h dietary recall using a computerized interview software programme (EPIC-SOFT). Intakes of the four B vitamins and vitamin C were estimated using the standardized EPIC Nutrient Database (ENDB). Mean intakes were adjusted for age and weighted by season and day of recall. Intake of B vitamins did not vary considerably between centres, except in the UK health-conscious cohort, in which substantially higher intakes of thiamine and lower intakes of vitamin B12 were reported compared with other centres. Overall, meat was the most important contributor to the B vitamins in all centres except in the UK health-conscious group. Vitamin C showed a clear geographical gradient, with higher intakes in the southern centres as compared with the northern ones; this was more pronounced in men than in women. Vegetables and fruits were major contributors to vitamin C in all centres, but juices and potatoes were also important sources in the northern centres. This study showed no major differences across centres in the mean intakes of B vitamins (thiamine, riboflavin, B6, B12), whereas a tendency towards a north-south gradient was observed for vitamin C.

Incidência de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em produtos de milho Occurrence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in corn products

Directory of Open Access Journals (Sweden)

Luciane Mie Kawashima

2006-09-01

Full Text Available Levantamentos de ocorrência de micotoxinas em alimentos foram realizados nas últimas duas décadas nas regiões Sudeste e Sul do Brasil. Levantamentos em alimentos comercializados em outras regiões têm-se limitado a aflatoxinas em amendoim e castanhas do Brasil. O presente trabalho pesquisou a presença de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em 74 amostras de produtos a base de milho adquiridas no comércio da cidade de Recife, PE, durante o período de 1999 a 2001. Fumonisina B1 foi determinada por cromatografia líquida de alta eficiência com detecção por fluorescência e as demais toxinas foram determinadas por cromatografia em camada delgada. Fumonisina B1 foi encontrada em 94,6% das amostras em concentrações variando de 20 a 8600 µg/kg. Apenas 5 amostras continham aflatoxina B1 e o teor máximo encontrado foi 20 µg/kg. Duas amostras ultrapassaram o limite de 20 µg/kg para a somatória das aflatoxinas B1, B2, G1 e G2 (farinha de milho pré-cozida com 21,5 µg/kg e quirera (xerém com 23,3 µg/kg. As aflatoxinas G1 e G2, ocratoxina A e zearalenona não foram detectadas em nenhuma das amostras. Todas as amostras contaminadas com aflatoxinas também apresentaram fumonisina B1.Research concerning the presence of mycotoxin in food has been conducted in the Southwest and South regions of Brazil over the last two decades. Research in other regions has been limited to aflatoxin in peanuts and Brazil nuts. The aim of this work is to study the presence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in 74 samples of corn products acquired in shops and food markets in the city of Recife (PE from 1999 to 2001. Fumonisin B1 was determined by high performance liquid chromatography and fluorescence was detected. The other toxins were determined by thin layer chromatography. Fumonisin B1 was found in 94.6% of the samples in levels from 20 to 8600 µg/kg. Only 5 samples contained

bHLH003, bHLH013 and bHLH017 are new targets of JAZ repressors negatively regulating JA responses.

Directory of Open Access Journals (Sweden)

Sandra Fonseca

Full Text Available Cell reprogramming in response to jasmonates requires a tight control of transcription that is achieved by the activity of JA-related transcription factors (TFs. Among them, MYC2, MYC3 and MYC4 have been described as activators of JA responses. Here we characterized the function of bHLH003, bHLH013 and bHLH017 that conform a phylogenetic clade closely related to MYC2, MYC3 and MYC4. We found that these bHLHs form homo- and heterodimers and also interact with JAZ repressors in vitro and in vivo. Phenotypic analysis of JA-regulated processes, including root and rosette growth, anthocyanin accumulation, chlorophyll loss and resistance to Pseudomonas syringae, on mutants and overexpression lines, suggested that these bHLHs are repressors of JA responses. bHLH003, bHLH013 and bHLH017 are mainly nuclear proteins and bind DNA with similar specificity to that of MYC2, MYC3 and MYC4, but lack a conserved activation domain, suggesting that repression is achieved by competition for the same cis-regulatory elements. Moreover, expression of bHLH017 is induced by JA and depends on MYC2, suggesting a negative feed-back regulation of the activity of positive JA-related TFs. Our results suggest that the competition between positive and negative TFs determines the output of JA-dependent transcriptional activation.

KEK: B factory plans

International Nuclear Information System (INIS)

Anon.

1991-01-01

To boost the study of B mesons (carrying the heavy b quark), the Japanese KEK Laboratory is looking to construct a B-meson 'factory'. B-mesons have revealed unexpected and important quark physics. Well-known examples are the long lifetime of the B-mesons, indicating a large gap between the third and second quark generation (compared to that between the second and the first), and relatively large mixing of the neutral B-meson and its antiparticle, now interpreted as being due to a heavy sixth ('top') quark

B Saha

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education. B Saha. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 11 November 1999 pp 65-71 Classroom. Inadequacy of Water Band Movement Technique for Kinetic Interpretation of RCOOH–NaHCO3 Reaction · P Sahoo B Saha.

Transiting circumbinary planets Kepler-34 b and Kepler-35 b.

Science.gov (United States)

Welsh, William F; Orosz, Jerome A; Carter, Joshua A; Fabrycky, Daniel C; Ford, Eric B; Lissauer, Jack J; Prša, Andrej; Quinn, Samuel N; Ragozzine, Darin; Short, Donald R; Torres, Guillermo; Winn, Joshua N; Doyle, Laurance R; Barclay, Thomas; Batalha, Natalie; Bloemen, Steven; Brugamyer, Erik; Buchhave, Lars A; Caldwell, Caroline; Caldwell, Douglas A; Christiansen, Jessie L; Ciardi, David R; Cochran, William D; Endl, Michael; Fortney, Jonathan J; Gautier, Thomas N; Gilliland, Ronald L; Haas, Michael R; Hall, Jennifer R; Holman, Matthew J; Howard, Andrew W; Howell, Steve B; Isaacson, Howard; Jenkins, Jon M; Klaus, Todd C; Latham, David W; Li, Jie; Marcy, Geoffrey W; Mazeh, Tsevi; Quintana, Elisa V; Robertson, Paul; Shporer, Avi; Steffen, Jason H; Windmiller, Gur; Koch, David G; Borucki, William J

2012-01-11

Most Sun-like stars in the Galaxy reside in gravitationally bound pairs of stars (binaries). Although long anticipated, the existence of a 'circumbinary planet' orbiting such a pair of normal stars was not definitively established until the discovery of the planet transiting (that is, passing in front of) Kepler-16. Questions remained, however, about the prevalence of circumbinary planets and their range of orbital and physical properties. Here we report two additional transiting circumbinary planets: Kepler-34 (AB)b and Kepler-35 (AB)b, referred to here as Kepler-34 b and Kepler-35 b, respectively. Each is a low-density gas-giant planet on an orbit closely aligned with that of its parent stars. Kepler-34 b orbits two Sun-like stars every 289 days, whereas Kepler-35 b orbits a pair of smaller stars (89% and 81% of the Sun's mass) every 131 days. The planets experience large multi-periodic variations in incident stellar radiation arising from the orbital motion of the stars. The observed rate of circumbinary planets in our sample implies that more than ∼1% of close binary stars have giant planets in nearly coplanar orbits, yielding a Galactic population of at least several million.

Measurement of the Ratio of Branching Fractions B(B_{c}^{+}→J/ψτ^{+}ν_{τ})/B(B_{c}^{+}→J/ψμ^{+}ν_{μ}).

Science.gov (United States)

Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S

2018-03-23

A measurement is reported of the ratio of branching fractions R(J/ψ)=B(B_{c}^{+}→J/ψτ^{+}ν_{τ})/B(B_{c}^{+}→J/ψμ^{+}ν_{μ}), where the τ^{+} lepton is identified in the decay mode τ^{+}→μ^{+}ν_{μ}ν[over ¯]_{τ}. This analysis uses a sample of proton-proton collision data corresponding to 3.0  fb^{-1} of integrated luminosity recorded with the LHCb experiment at center-of-mass energies of 7 and 8 TeV. A signal is found for the decay B_{c}^{+}→J/ψτ^{+}ν_{τ} at a significance of 3 standard deviations corrected for systematic uncertainty, and the ratio of the branching fractions is measured to be R(J/ψ)=0.71±0.17(stat)±0.18(syst). This result lies within 2 standard deviations above the range of central values currently predicted by the standard model.

Experiences and Future Expectations towards Online Courses--An Empirical Study of the B2C-and B2B-Segments

Science.gov (United States)

Krämer, Andreas; Böhrs, Sandra

2016-01-01

This article explores the future potential for the development of online courses. The findings are based on an empirical study with 3 sample groups: (1) B2C segment in Germany, (2) B2C segment in the United States, and (3) B2B segment (international). In the first step the status quo of the use of e-learning in general and online courses in…

B-waves revisited

Directory of Open Access Journals (Sweden)

Andreas Spiegelberg

2016-12-01

With the still unmet need for a clinically acceptable method for acquiring intracranial compliance, and the revival of ICP waveform analysis, B-waves are moving back into the research focus. Herein we provide a concise review of the literature on B-waves, including a critical assessment of non-invasive methods for obtaining B-wave surrogates.

B N Panda

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. B N Panda. Articles written in Pramana – Journal of Physics. Volume 77 Issue 4 October 2011 pp 715-726 Research Articles. Effect of hybridization and dispersion of quasiparticles on the coexistent state of superconductivity and antiferromagnetism in Ni2B2C · B K Sahoo ...

B K Godwal

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. B K Godwal. Articles written in Bulletin of Materials Science. Volume 23 Issue 2 April 2000 pp 151-154 Instrumentation. A CCD area detector for X-ray diffraction under high pressure for rotating anode source · Amar Sinha Alka B Garg V Vijayakumar B K Godwal S K Sikka.

Strategic B2B customer experience management: the importance of outcomes-based measures

OpenAIRE

Zolkiewski, Judy; Story, Victoria; Burton, Jamie; Chan, Paul; Gomes, Andre; Hunter-Jones, Philippa; O’Malley, Lisa; Peters, Linda D.; Raddats, Chris; Robinson, William

2017-01-01

Purpose\\ud \\ud The purpose of this paper is to critique the adequacy of efforts to capture the complexities of customer experience in a business-to-business (B2B) context using input–output measures. The paper introduces a strategic customer experience management framework to capture the complexity of B2B service interactions and discusses the value of outcomes-based measurement.\\ud Design/methodology/approach\\ud \\ud This is a theoretical paper that reviews extant literature related to B2B cu...

Chlorophyll b degradation by chlorophyll b reductase under high-light conditions.

Science.gov (United States)

Sato, Rei; Ito, Hisashi; Tanaka, Ayumi

2015-12-01

The light-harvesting chlorophyll a/b binding protein complex of photosystem II (LHCII) is the main antenna complex of photosystem II (PSII). Plants change their LHCII content depending on the light environment. Under high-light conditions, the content of LHCII should decrease because over-excitation damages the photosystem. Chlorophyll b is indispensable for accumulating LHCII, and chlorophyll b degradation induces LHCII degradation. Chlorophyll b degradation is initiated by chlorophyll b reductase (CBR). In land plants, NON-YELLOW COLORING 1 (NYC1) and NYC1-Like (NOL) are isozymes of CBR. We analyzed these mutants to determine their functions under high-light conditions. During high-light treatment, the chlorophyll a/b ratio was stable in the wild-type (WT) and nol plants, and the LHCII content decreased in WT plants. The chlorophyll a/b ratio decreased in the nyc1 and nyc1/nol plants, and a substantial degree of LHCII was retained in nyc1/nol plants after the high-light treatment. These results demonstrate that NYC1 degrades the chlorophyll b on LHCII under high-light conditions, thus decreasing the LHCII content. After the high-light treatment, the maximum quantum efficiency of the PSII photochemistry was lower in nyc1 and nyc1/nol plants than in WT and nol plants. A larger light-harvesting system would damage PSII in nyc1 and nyc1/nol plants. The fluorescence spectroscopy of the leaves indicated that photosystem I was also damaged by the excess LHCII in nyc1/nol plants. These observations suggest that chlorophyll b degradation by NYC1 is the initial reaction for the optimization of the light-harvesting capacity under high-light conditions.

Post-Translational Modifications of RelB NF-κB Subunit and Associated Functions

Directory of Open Access Journals (Sweden)

Véronique Baud

2016-05-01

Full Text Available The family of NF-κB transcription factors plays a key role in diverse biological processes, such as inflammatory and immune responses, cell survival and tumor development. Beyond the classical NF-κB activation pathway, a second NF-κB pathway has more recently been uncovered, the so-called alternative NF-κB activation pathway. It has been shown that this pathway mainly controls the activity of RelB, a member of the NF-κB family. Post-translational modifications, such as phosphorylation, acetylation, methylation, ubiquitination and SUMOylation, have recently emerged as a strategy for the fine-tuned regulation of NF-κB. Our review discusses recent progress in the understanding of RelB regulation by post-translational modifications and the associated functions in normal and pathological conditions.

Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

Endothelial Plasmalemma Vesicle Associated Protein regulates the homeostasis of splenic immature B cell and B1 B cells

Science.gov (United States)

Elgueta, Raul; Tse, Dan; Deharvengt, Sophie J.; Luciano, Marcus R.; Carriere, Catherine; Noelle, Randolph J.; Stan, Radu V.

2016-01-01

Plasmalemma vesicle associated protein (Plvap) is an endothelial protein with roles in endothelial diaphragm formation and maintenance of basal vascular permeability. At the same time Plvap has roles in immunity by facilitating leukocyte diapedesis at inflammatory sites and controlling peripheral lymph node morphogenesis and the entry of soluble antigens into lymph node conduits. Based on its postulated role in diapedesis, we have investigated the role of Plvap in hematopoiesis and show that deletion of Plvap results in a dramatic decrease of IgM+IgDlo B cells in both the spleen and peritoneal cavity. Tissue specific deletion of Plvap demonstrates that the defect is B cell extrinsic, as B cell and pan hematopoietic Plvap deletion has no effect on IgM+IgDlo B cell numbers. Endothelial specific deletion of Plvap in the embryo or at adult stage recapitulates the full Plvap knockout phenotype whereas endothelial specific reconstitution of Plvap under the Chd5 promoter rescues the IgM+IgDlo B cell phenotype. Taken together, these results show that Plvap expression in endothelial cells is important in the maintenance of IgM+ B cells in the spleen and peritoneal cavity. PMID:27742829

Correction: Electronic structure of the boron fullerene B14 and its silicon derivatives B13Si+, B13Si- and B12Si2: a rationalization using a cylinder model.

Science.gov (United States)

Van Duong, Long; Nguyen, Minh Tho

2016-08-28

Correction for 'Electronic structure of the boron fullerene B 14 and its silicon derivatives B 13 Si + , B 13 Si - and B 12 Si 2 : a rationalization using a cylinder model' by Long Van Duong et al., Phys. Chem. Chem. Phys., 2016, 18, 17619-17626.

Fission-like decay of 20Ne: eccentric behavior in the B+B fusion processes

International Nuclear Information System (INIS)

Toledo, A.S. de; Coimbra, M.M.; Added, N.; Anjos, R.M.; Carlin Filho, N.; Fante Junior, L.; Figueira, M.C.S.; Guimaraes, V.; Szanto, E.M.

1988-08-01

Cross sections for the fusion of 10,11 B+ 10,11 B have been measured in the energy range from 1.5 MeV/A to 5 MeV/A. The 10 B+ 10 B system unexpectedly presents a hindered fusion cross section when compared to the 10 B+ 11 B and 11 B+ 11 B reactions and to standard model predictions. The missing fusion cross section was diverted the 10 B exit channel with a total kinetic energy characteristic of strongly damped collisions. Q-values and kinematical analysis together with angular distributions suggest a binary symmetric decay of the composite 20 Ne system. (author) [pt

Editorial, n. 12, 2001

Directory of Open Access Journals (Sweden)

Editor Encontros Bibli

2001-01-01

Full Text Available EDITORIAL, n. 12, 2001 Este número da Encontros Bibli apresenta diferentes abordagens de questões relativas à sociedade do conhecimento. Esta sociedade vem acompanhada de uma evolução tecnológica que afeta, em diferentes graus, todos os países do mundo, produzindo impactos de natureza econômica, política, social e cultural. Tais impactos necessitam de parâmetros para sua análise e avaliação. A medição de bens intangíveis, neste caso, provenientes do uso das tecnologias da informação e da comunicação, é uma tarefa complexa. O artigo do professor Michel Menou, da City University, de Londres, apresenta uma metodologia original para análise desses indicadores na sociedade atual. O relato de pesquisa da professora Clarice Fortkamp Caldin, do Departamento de Ciência da Informação da UFSC, aborda o processo de leitura como função terapêutica. Este trabalho é baseado na sua dissertação de mestrado e representa um foco de abordagem pouco usual na Ciência da Informação. O professor Francisco das Chagas de Souza, também do Departamento de Ciência da Informação da UFSC, apresenta uma análise de sua experiência no ensino de fundamentos teóricos da Biblioteconomia. A estudante Maria Elizabeth Horn Pepulim, do Curso de Biblioteconomia da UFSC, reflete sobre o papel do bibliotecário na sociedade da informação, ressaltando os dilemas, atribuições e responsabilidades deste profissional no mundo globalizado. Esta edição divulga ainda uma pesquisa sobre bibliotecas públicas, sociedade da informação e tecnologia, que está sendo desenvolvida pelos colegas do Instituto de Investigaciones Bibliotecológicas da Universidad de Buenos Aires: Elsa Barber, Nicolás Tripaldi, Silvia Pisano, Valeria Werner, Sofia D´Alessandro, Sandra Romagnoli, Verónica Parsiale, Carolina Gregui e Gabriela De Pedro. Miriam Vieira da Cunha, editora Disponibilizado na WWW em 28/12/2001. Enc. Bibli: R. Eletr. Bibliotecon. Ci. Inf., ISSN 1518

H B Liu

Indian Academy of Sciences (India)

Home; Journals; Sadhana. H B Liu. Articles written in Sadhana. Volume 34 Issue 4 August 2009 pp 599-606. Of light, of MEMS: Optical MEMS in telecommunications and beyond · F Chollet H B Liu M Ashraf B Thubthimthong X M Zhang G Hegde A Asundi V M Murukeshan A Q Liu · More Details Abstract Fulltext PDF.

The ratio (fBs/fB)/(fDs/fD) and its implications for B-bar B mixing

International Nuclear Information System (INIS)

Grinstein, B.

1993-01-01

We observe that quantities like (f Bs /f B )/(f Ds /f D ) are predicted to be unity both by heavy quark and by light quark flavor symmetries. Hence, the deviation from the symmetry prediction must be simultaneously small in both symmetry breaking parameters, i.e., order of the ratio of light to heavy quark masses. We estimate the size of the correction. We observe that the ratio of (ΔM/Γ) for B s- bar Bs to B-bar B mixing can be expressed in terms of the measurable ratio f Ds /f D with good precision. We comment on applications of these ideas to other processes

B Chaudhuri

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. B Chaudhuri. Articles written in Bulletin of Materials Science. Volume 25 Issue 2 April 2002 pp 121-125 Ceramic Materials. Sintering of nano crystalline silicon carbide doping with aluminium nitride · M S Datta A K Bandyopadhyay B Chaudhuri · More Details Abstract Fulltext ...

B Chatterji

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. B Chatterji. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 39-45 Metallic Materials. Role of diffusional coherency strain theory in the discontinuous precipitation in Mg–Al alloy · K T Kashyap C Ramachandra M Sujatha B Chatterji.

B Talukdar

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. B Talukdar. Articles written in Pramana – Journal of Physics. Volume 58 Issue 3 March 2002 pp 443-448 Research Articles. Korteweg–de Vries hierarchy using the method of base equations · Subhendu Chakrabarti J Pal B Talukdar · More Details Abstract Fulltext PDF.

Customer satisfaction in B2B cloud services

OpenAIRE

Turunen, Helinä

2013-01-01

Tutkimuksen tavoitteena on kirjallisuuskatsauksen kautta esitellä B2B-pilvipalveluiden asiakastyytyväisyyteen vaikuttavia seikkoja, ja kuinka näitä seikkoja tulisi ottaa huomioon asiakastyytyväisyyden parantamisessa. Tässä tutkimuksessa verkkopohjaiseen liiketoimintaan liittyvää asiakastyytyväisyyden tutkimusta käytettiin pohjana etsiessä asiakastyytyväisyyteen vaikuttavia seikkoja pilvipalveluissa. Tutkimuksessa vertaillaan asiakastyytyväisyyteen vaikuttavia seikkoja vertailemalla tyytyväisy...

Measurement of Inclusive Radiative B -Meson Decay B -> X_s gamma

Energy Technology Data Exchange (ETDEWEB)

Ozcan, V.E.; /SLAC /Stanford U., Appl. Phys. Dept.

2006-01-06

Radiative decays of the B meson, B {yields} X{sub s}{gamma}, proceed via virtual flavor changing neutral current processes that are sensitive to contributions from high mass scales, either within the Standard Model of electroweak interactions or beyond. In the Standard Model, these transitions are sensitive to the weak interactions of the top quark, and relatively robust predictions of the inclusive decay rate exist. Significant deviation from these predictions could be interpreted as indications for processes not included in the minimal Standard Model, like interactions of charged Higgs or SUSY particles. The analysis of the inclusive photon spectrum from B {yields} X{sub s}{gamma} decays is rather challenging due to high backgrounds from photons emitted in the decay of mesons in B decays as well as e{sup +}e{sup -} annihilation to low mass quark and lepton pairs. Based on 88.5 million B{bar B} events collected by the BABAR detector, the photon spectrum above 1.9 GeV is presented. By comparison of the first and second moments of the photon spectrum with QCD predictions (calculated in the kinetic scheme), QCD parameters describing the bound state of the b quark in the B meson are extracted: m{sub b} = (4.45 {+-} 0.16) GeV/c{sup 2}; {mu}{sub {pi}}{sup 2} = (0.65 {+-} 0.29) GeV{sup 2}. These parameters are useful input to non-perturbative QCD corrections to the semileptonic B decay rate and the determination of the CKM parameter |V{sub ub}|. Based on these parameters and heavy quark expansion, the full branching fraction is obtained as: {Beta}(B {yields} X{sub s}{gamma}){sup E{sub {gamma}}>1.6 GeV} = (4.05 {+-} 0.32(stat) {+-} 0.38(syst) {+-} 0.29(model)) x 10{sup -4}. This result is in good agreement with previous measurements, the statistical and systematic errors are comparable. It is also in good agreement with the theoretical Standard Model predictions, and thus within the present errors there is no indication of any interactions not accounted for in the

Interaction of the B cell-specific transcriptional coactivator OCA-B and galectin-1 and a possible role in regulating BCR-mediated B cell proliferation.

Science.gov (United States)

Yu, Xin; Siegel, Rachael; Roeder, Robert G

2006-06-02

OCA-B is a B cell-specific transcriptional coactivator for OCT factors during the activation of immunoglobulin genes. In addition, OCA-B is crucial for B cell activation and germinal center formation. However, the molecular mechanisms for OCA-B function in these processes are not clear. Our previous studies documented two OCA-B isoforms and suggested a novel mechanism for the function of the myristoylated, membrane-bound form of OCA-B/p35 as a signaling molecule. Here, we report the identification of galectin-1, and related galectins, as a novel OCA-B-interacting protein. The interaction of OCA-B and galectin-1 can be detected both in vivo and in vitro. The galectin-1 binding domain in OCA-B has been localized to the N terminus of OCA-B. In B cells lacking OCA-B expression, increased galectin-1 expression, secretion, and cell surface association are observed. Consistent with these observations, and a reported inhibitory interaction of galectin-1 with CD45, the phosphatase activity of CD45 is reduced modestly, but significantly, in OCA-B-deficient B cells. Finally, galectin-1 is shown to negatively regulate B cell proliferation and tyrosine phosphorylation upon BCR stimulation. Together, these results raise the possibility that OCA-B may regulate BCR signaling through an association with galectin-1.

Human parvovirus B19 (B19V) infection in systemic sclerosis patients

DEFF Research Database (Denmark)

Zakrzewska, K.; Corcioli, F.; Carlsen, Karen Marie

2009-01-01

BACKGROUND: Our previous reports suggested a possible association between parvovirus B19 (B19V) infection and systemic sclerosis (SSc), based on higher prevalence of B19V DNA in SSc patients in respect to controls. METHODS: In the present study, to further evaluate the differences in the pattern...... of B19 infection in SSc, skin biopsies and bone marrow samples from patients and controls were analysed for B19V DNA detection, genotyping and viral expression. RESULTS: B19V DNA was detected in skin biopsies from 39/49 SSc patients and from 20/28 controls. Bone marrow showed positive in 17/29 SSc...... in the skin of genotype 1-positive patients and not in control skins. CONCLUSION: The results outline some differences in the rate of persistence of B19V DNA, in the simultaneous persistence of 2 genotypes and in the pattern of viral expression among SSc patients and controls Udgivelsesdato: 2009...

Vitamin B12 deficiency

Science.gov (United States)

Vitamin B12 (B12; also known as cobalamin) is a B vitamin that has an important role in cellular metabolism, especially in DNA synthesis, methylation and mitochondrial metabolism. Clinical B12 deficiency with classic haematological and neurological manifestations is relatively uncommon. However, sub...

Structure and Cancer Immunotherapy of the B7 Family Member B7x

Science.gov (United States)

Jeon, Hyungjun; Vigdorovich, Vladimir; Garrett-Thomson, Sarah C.; Janakiram, Murali; Ramagopal, Udupi A.; Abadi, Yael M.; Lee, Jun Sik; Scandiuzzi, Lisa; Ohaegbulam, Kim C; Chinai, Jordan M; Zhao, Ruihua; Yao, Yu; Mao, Ying; Sparano, Joseph A.; Almo, Steven C.; Zang, Xingxing

2014-01-01

SUMMARY B7x (B7-H4 or B7S1) is a member of the B7 family that can inhibit T cell function. B7x protein is absent in most normal human tissues and immune cells, but is overexpressed in human cancers and often correlates with negative clinical outcome. The expression pattern and function of B7x suggest that it may be a potent immunosuppressive pathway in human cancers. Here we determined the crystal structure of human B7x IgV domain at 1.59Å resolution and mapped the epitopes recognized by monoclonal antibodies. We developed a new in vivo system to screen therapeutic monoclonal antibodies against B7x, and found that the clone 1H3 significantly inhibited growth of B7x-expressing tumor in vivo via multiple mechanisms. Furthermore, the surviving mice given 1H3 treatment were resistant to tumor re-challenge. Our data suggest that targeting B7x on tumors is a promising cancer immunotherapy and humanized 1H3 may be efficacious for immunotherapy of human cancers. PMID:25437562

Structure and Cancer Immunotherapy of the B7 Family Member B7x

Directory of Open Access Journals (Sweden)

Hyungjun Jeon

2014-11-01

Full Text Available B7x (B7-H4 or B7S1 is a member of the B7 family that can inhibit T cell function. B7x protein is absent in most normal human tissues and immune cells, but it is overexpressed in human cancers and often correlates with negative clinical outcome. The expression pattern and function of B7x suggest that it may be a potent immunosuppressive pathway in human cancers. Here, we determined the crystal structure of the human B7x immunoglobulin variable (IgV domain at 1.59 Å resolution and mapped the epitopes recognized by monoclonal antibodies. We developed an in vivo system to screen therapeutic monoclonal antibodies against B7x and found that the clone 1H3 significantly inhibited growth of B7x-expressing tumors in vivo via multiple mechanisms. Furthermore, the surviving mice given 1H3 treatment were resistant to tumor rechallenge. Our data suggest that targeting B7x on tumors is a promising cancer immunotherapy and humanized 1H3 may be efficacious for immunotherapy of human cancers.

Relating B_S Mixing and B_S to mu+mu- with New Physics

Energy Technology Data Exchange (ETDEWEB)

Golowich, Eugene; /Massachusetts U., Amherst; Hewett, JoAnne; /SLAC; Pakvasa, Sandip; /Hawaii U.; Petrov, Alexey A; /Wayne State U. /Michigan U., MCTP; Yeghiyan, Gagik K; /Wayne State U.

2012-06-11

We perform a study of the standard model fit to the mixing quantities {Delta}M{sub B{sub s}}, and {Delta}{Lambda}{sub B{sub s}}/{Delta}M{sub B{sub s}} in order to bound contributions of new physics (NP) to B{sub s} mixing. We then use this to explore the branching fraction of B{sub s} {yields} {mu}{sup +}{mu}{sup -} in certain models of NP. In most cases, this constrains NP amplitudes for B{sub s} {yields} {mu}{sup +}{mu}{sup -} to lie below the standard model component.

A measurement of B$^{+}$ and B$^{0}$ lifetimes using $\\overline{D}$l$^{+}$ events

CERN Document Server

Abreu, P; Adye, T; Agasi, E; Ajinenko, I; Aleksan, Roy; Alekseev, G D; Allport, P P; Almehed, S; Alvsvaag, S J; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barate, R; Barbiellini, Guido; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Berggren, M; Bertrand, D; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bloch, D; Blume, M; Blyth, S; Bocci, V; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Borisov, G; Bosio, C; Bosworth, S; Botner, O; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenner, R A; Bricman, C; Brillault, L; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buys, A; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carrilho, P; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Cerrito, L; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Chauveau, J; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Cindro, V; Collins, P; Contreras, J L; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Daum, A; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; De Boeck, H; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Djama, F; Dolbeau, J; Dönszelmann, M; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Dufour, Y; Dupont, F; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Ershaidat, N; Erzen, B; Falk, E; Fassouliotis, D; Feindt, Michael; Fenyuk, A; Ferrer, A; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Fries, D E C; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fürstenau, H; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gibbs, M; Gillespie, D; Gokieli, R; Golob, B; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Grosdidier, G; Gunnarsson, P; Günther, M; Guy, J; Haedinger, U; Hahn, F; Hahn, M; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Hao, W; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Ioannou, P; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kalmus, George Ernest; Kapusta, F; Karlsson, M; Karvelas, E; Katsanevas, S; Katsoufis, E C; Keränen, R; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klein, H; Klovning, A; Kluit, P M; Köhne, J H; Köne, B; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Kramer, P H; Krammer, Manfred; Kreuter, C; Królikowski, J; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamblot, S; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Last, I; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leitner, R; Lemoigne, Y; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Lokajícek, M; Loken, J G; López, J M; López-Fernandez, A; López-Aguera, M A; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Maio, A; Malychev, V; Mandl, F; Marco, J; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Maron, T; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, M; McNulty, M; Medbo, J; Meroni, C; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Negri, P; Némécek, S; Neumann, W; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Plaszczynski, S; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Prest, M; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Ronjin, V M; Roos, L; Rosenberg, E I; Rosso, E; Roudeau, Patrick; Rovelli, T; Rückstuhl, W; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schneider, H; Schyns, M A E; Sciolla, G; Scuri, F; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Shellard, R C; Siccama, I; Siegrist, P; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Solovyanov, O; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Squarcia, S; Stäck, H; Stanescu, C; Stapnes, Steinar; Stavitski, I; Stepaniak, K; Stichelbaut, F; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Chikilev, O G; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Toet, D Z; Tomaradze, A G; Tomé, B; Tortora, L; Tranströmer, G; Treille, D; Trischuk, W; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Überschär, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, V; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Waldner, F; Wehr, A; Weierstall, M; Weilhammer, Peter; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zacharatou-Jarlskog, C; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zuberi, R; Zucchelli, G C; Zumerle, G

1995-01-01

A measurement of B meson lifetimes is presented using data collected from 1991 to 1993 by the DELPHI detector at the LEP collider. Samples of events with a D meson and a lepton in the same jet are selected where \\overline{\\mathrm{D}}^0 \\ell^+ and \\mathrm{D}^{*-} \\ell^+ events originate mainly from the semileptonic decays of B^+ and B^0 mesons, respectively. From the reconstructed B decay length and the estimated B momentum, taking into account the dilution due to B decays into \\overline{\\mathrm{D}}^{**} \\ell^+ \

Tracing hepatitis B virus (HBV genotype B5 (formerly B6 evolutionary history in the circumpolar Arctic through phylogeographic modelling

Directory of Open Access Journals (Sweden)

Remco Bouckaert

2017-08-01

Full Text Available Background Indigenous populations of the circumpolar Arctic are considered to be endemically infected (>2% prevalence with hepatitis B virus (HBV, with subgenotype B5 (formerly B6 unique to these populations. The distinctive properties of HBV/B5, including high nucleotide diversity yet no significant liver disease, suggest virus adaptation through long-term host-pathogen association. Methods To investigate the origin and evolutionary spread of HBV/B5 into the circumpolar Arctic, fifty-seven partial and full genome sequences from Alaska, Canada and Greenland, having known location and sampling dates spanning 40 years, were phylogeographically investigated by Bayesian analysis (BEAST 2 using a reversible-jump-based substitution model and a clock rate estimated at 4.1 × 10−5 substitutions/site/year. Results Following an initial divergence from an Asian viral ancestor approximately 1954 years before present (YBP; 95% highest probability density interval [1188, 2901], HBV/B5 coalescence occurred almost 1000 years later. Surprisingly, the HBV/B5 ancestor appears to locate first to Greenland in a rapid coastal route progression based on the landscape aware geographic model, with subsequent B5 evolution and spread westward. Bayesian skyline plot analysis demonstrated an HBV/B5 population expansion occurring approximately 400 YBP, coinciding with the disruption of the Neo-Eskimo Thule culture into more heterogeneous and regionally distinct Inuit populations throughout the North American Arctic. Discussion HBV/B5 origin and spread appears to occur coincident with the movement of Neo-Eskimo (Inuit populations within the past 1000 years, further supporting the hypothesis of HBV/host co-expansion, and illustrating the concept of host-pathogen adaptation and balance.

QCD improved exclusive rare B-decays at the heavy b-quark limit

International Nuclear Information System (INIS)

Liu Dongsheng.

1993-09-01

The renormalization effects from the b-quark scale down to the non-perturbative QCD regime are studied for rare B-decays at the heavy b-quark limit. Phenomenological consequences of these effects are investigated. We find that the anomalous scaling behaviour plays a positive role in making non-perturbative model calculations consistent with recent CLEO measurements of B → K*γ. (author). 21 refs, 3 tabs

An Evaluation of Taiwanese B&B Service Quality Using the IPA Model

Directory of Open Access Journals (Sweden)

Gao-Liang Wang

2012-09-01

Full Text Available According to a December 2011 report released by Taiwan’s Tourism Bureau, there were 3,763 bed-and-breakfast guesthouses (B&B in Taiwan, 3,367 of which were legal with a combined 13,389 rooms, increasing by 96 percent from December 2006. It seems that the B&B sector is quite a popular target for investors. As the word-of-mouth advertising has been considered one of the most influential marketing methods, those who invest in B&Bs must manage to utilize their limited resources to improve customer satisfaction in a fast-growing and competitive market. The best marketing approach in reaching out to B&B customers, as suggested by this study’s author, would be word-of-mouth adverting. A PZB framed questionnaire is used in this study to explore the expectations and satisfaction of B&B customers both before and after the accommodation period, with the Importance-Performance Analysis (IPA model applied to analyze and measure the service quality. Findings from the questionnaire survey showed 3 out of the totally 23 service factors falling in the “concentrated concerned” quadrant (i.e., tidiness, architectural characteristics, and reasonable rates; 6 factors falling in the “continued maintenance” quadrant (i.e., adequate parking place, commitment to customers, handling of customers’ opinions, legality of B&B, grievance handling, and the local specialties-ordering service; 10 factors falling in the “low priority” quadrant (i.e., modern facilities, safety devices, availability of breakfast, security of online reservations; 4 factors falling in the “over-strived” quadrant (i.e., the availability of custom-made services, the ability to grasp customers’ needs, the availability of tour packages, and the availability of experiences regarding local industries.