WorldWideScience

Sample records for kaihatsu kobe-shi chuo-ku

  1. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Chuo Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    Research and development has been performed on a help and welfare system to transmit and accumulate monitoring data by utilizing a computer system. This paper summarizes the achievements in fiscal 1999. In the research of transmission and management of information on help requiring persons, a server and its peripheral devices were modified to structure a system to measure body temperatures, pulses, and blood pressures, and transmit them to a central server. In the research on support for the visiting helps, a mobile system was developed, which has map information and scheduling function that shows distribution of help requiring persons. In the research of a simulation to link hospitals, medical organizations and homes, the LAN at health facilities for elderly people was structured, and so was a network for linking hospitals, medical organizations and homes (simulated). Investigations and discussions were performed on interface between body information (vital data) measuring instruments and personal computers. Developmental research was executed on private certification office servers and the certification software that consider security in the help systems. (NEDO)

  2. Fiscal 2000 report on results of R and D of welfare techno-system in Chuo Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    'R and D on systems for supporting care and welfare through transmission and accumulation of monitored data' was conducted for the purpose of assisting the operation of service providers for the elderly in need of care and supporting nursing care at home and at facilities, for which the results in fiscal 2000 was reported. In the development of vital data measuring devices and inter-computer interfaces, a USB or IEEE1394 interface was developed which was for automatically inputting, into personal computers (PC), the information such as body temperature, heart rate and blood pressure of a person requiring care; and the interface was incorporated in the system. In the research on support for home visit care centers, a geographic information system (GIS) and data were selected, which were to be installed on server's side, with linkage with portable PC's carried out. However, it was pointed out that data transmission took time between the server in the center and the portable PC at a home to visit. Further, investigative research on care services at facilities under the care insurance system was conducted, as were studies on linkage between general practitioners and hospitals, and studies on prevention of illegal access and wiretapping, among others. (NEDO)

  3. Achievement report for fiscal 1998 on Welfare Technosystem Kobe-Chuo-Ku research and development; 1998 nendo Walfare technosystem kenkyu kaihatsu (Kobeshi Chuo-ku) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Research on the transmission and management of information on those who necessitate nursing care will lead to the development of computer-aided nursing and welfare supporting systems and this in turn will help businesses who provide aged people with service they require for the enhancement of nursing care at home and at facilities for aged people to enjoy independent, unaided living. It is important to prepare liaising methods and coordinate with physicians in case of physical condition suddenly turning worse. Exchange of data at a visited place is important for a visiting nurse, and handling of information on such an occasion has to be easy and rapid to ensure high efficiency. When transmitting or receiving data on patients via PHS (personal handyphone system) or handyphone system, transmission of large-capacity data such as pictures should be avoided. In case a picture has to be transmitted, it should be compressed. ISDN (integrated services digital network) is preferred in all cases. The IEEE1394 interface is deemed to be the best for automatically transmitting as digital data the pictures etc. collected from other measuring instruments on nursing welfare and nursing assisting systems. It is necessary, however, to watch the development of digital interfaces in the future. (NEDO)

  4. Database Description - SSBD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available base Description General information of database Database name SSBD Alternative nam...ss 2-2-3 Minatojima-minamimachi, Chuo-ku, Kobe 650-0047, Japan, RIKEN Quantitative Biology Center Shuichi Onami E-mail: Database... classification Other Molecular Biology Databases Database classification Dynamic databa...elegans Taxonomy ID: 6239 Taxonomy Name: Escherichia coli Taxonomy ID: 562 Database description Systems Scie...i Onami Journal: Bioinformatics/April, 2015/Volume 31, Issue 7 External Links: Original website information Database

  5. Database Description - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available abase Description General information of database Database name GETDB Alternative n...ame Gal4 Enhancer Trap Insertion Database DOI 10.18908/lsdba.nbdc00236-000 Creator Creator Name: Shigeo Haya... Chuo-ku, Kobe 650-0047 Tel: +81-78-306-3185 FAX: +81-78-306-3183 E-mail: Database classification Expression... Invertebrate genome database Organism Taxonomy Name: Drosophila melanogaster Taxonomy ID: 7227 Database des...riginal website information Database maintenance site Drosophila Genetic Resource

  6. Fiscal 2000 report on results of R and D of welfare techno-system in West Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    R and D was conducted on devices for promoting self-support, mitigating nursing care, and improving safety and comfort for the elderly and the disabled, with the fiscal 2000 results reported. In the development of a wheelchair system (small arm sling mountable on a wheelchair) capable of assisting self-support for eating and vocational activity at home, a mounting device of an arm sling was experimentally manufactured for five different types of wheelchairs. In the research on the welfare device support system at a disaster or emergency, the system was modified based on the result of the system operation in the preceding year. Consequently, it became possible to make use of a power from a solar battery, a storage battery and an utility line, and also to reduce instantaneous interruption caused by switching of the self-sustaining operation for example. Further, a load control adaptor linked with an inverter was developed, enabling the system to use electricity for a long period even at the time of power failure. In addition, a conventional simple charge/discharge control was found to cause a marked deterioration in storage cell properties; hence, an accurate charge controller was added. (NEDO)

  7. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Nishi Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    Research and development has been performed on devices to enhance autonomy, safety and comfort for elderly and handicapped people in houses and homes. This paper summarizes the achievements in fiscal 1999. In developing wheelchairs to allow autonomy in meal taking and working at homes, a small upper arm holding device that can be installed on a wheelchair was fabricated on the trial basis according to the experience obtained in making the first prototype in the previous fiscal year, and clinical evaluation was given. In the research and development on a safe walk assisting appliance for elderly and handicapped people, development, improvement and trial fabrication were carried out on a caster in which the brake will not work during walking, but it works automatically in a sudden movement such as falling down. In developing an environment information transmitting system for elderly and handicapped people, a first prototype fabrication was performed on a system to detect sound of an alarm or vibration caused by knocking a door, and convey information to elderly and handicapped people by utilizing the communication services including the commercially available cellular phones. In the research on a welfare device support system for use in disaster and emergency, design and structuring were carried out on a nighttime electric power utilizing system having solar cells combined with storage batteries. Related data were measured. (NEDO)

  8. 21 CFR 172.809 - Curdlan.

    Science.gov (United States)

    2010-04-01

    ...) produced by pure culture fermentation from the nonpathogenic and nontoxicogenic bacterium Alcaligenes... Curdlan,” by Takeda Chemical Industries, Ltd., 12-10 Nihonbashi, 2-Chome, Chuo-ku, Tokyo, 103, Japan, 1996...

  9. 76 FR 55417 - In the Matter of Certain Dynamic Random Access Memory and Nand Flash Memory Devices and Products...

    Science.gov (United States)

    2011-09-07

    ... Bldg. 3F, 2-1 Yaesu 2- chome Chuo-ku, Tokyo 104-0028, Japan. Elpida Memory (USA) Inc., 1175 Sonora..., Round Rock, TX 78682. Hewlett-Packard Company, 3000 Hanover Street, Palo Alto, CA 94304. Kingston...

  10. The Long-Run Socio-Economic Consequences of a Large Disaster: The 1995 Earthquake in Kobe.

    Directory of Open Access Journals (Sweden)

    William duPont

    Full Text Available We quantify the 'permanent' socio-economic impacts of the Great Hanshin-Awaji (Kobe earthquake in 1995 by employing a large-scale panel dataset of 1,719 cities, towns, and wards from Japan over three decades. In order to estimate the counterfactual--i.e., the Kobe economy without the earthquake--we use the synthetic control method. Three important empirical patterns emerge: First, the population size and especially the average income level in Kobe have been lower than the counterfactual level without the earthquake for over fifteen years, indicating a permanent negative effect of the earthquake. Such a negative impact can be found especially in the central areas which are closer to the epicenter. Second, the surrounding areas experienced some positive permanent impacts in spite of short-run negative effects of the earthquake. Much of this is associated with movement of people to East Kobe, and consequent movement of jobs to the metropolitan center of Osaka, that is located immediately to the East of Kobe. Third, the furthest areas in the vicinity of Kobe seem to have been insulated from the large direct and indirect impacts of the earthquake.

  11. The Long-Run Socio-Economic Consequences of a Large Disaster: The 1995 Earthquake in Kobe

    Science.gov (United States)

    duPont IV, William; Noy, Ilan; Okuyama, Yoko; Sawada, Yasuyuki

    2015-01-01

    We quantify the ‘permanent’ socio-economic impacts of the Great Hanshin-Awaji (Kobe) earthquake in 1995 by employing a large-scale panel dataset of 1,719 cities, towns, and wards from Japan over three decades. In order to estimate the counterfactual—i.e., the Kobe economy without the earthquake—we use the synthetic control method. Three important empirical patterns emerge: First, the population size and especially the average income level in Kobe have been lower than the counterfactual level without the earthquake for over fifteen years, indicating a permanent negative effect of the earthquake. Such a negative impact can be found especially in the central areas which are closer to the epicenter. Second, the surrounding areas experienced some positive permanent impacts in spite of short-run negative effects of the earthquake. Much of this is associated with movement of people to East Kobe, and consequent movement of jobs to the metropolitan center of Osaka, that is located immediately to the East of Kobe. Third, the furthest areas in the vicinity of Kobe seem to have been insulated from the large direct and indirect impacts of the earthquake. PMID:26426998

  12. January 1995 Hanshin-Awaji (Kobe), Japan Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On the morning of January 17, 1995 (January 16 at 20:46 GMT), a major earthquake occurred near the City of Kobe, Japan. The greatest intensity of shaking for the 6.9...

  13. International Comparison of Causative Bacteria and Antimicrobial Susceptibilities of Urinary Tract Infections between Kobe, Japan, and Surabaya, Indonesia.

    Science.gov (United States)

    Kitagawa, Koichi; Shigemura, Katsumi; Yamamichi, Fukashi; Alimsardjono, Lindawati; Rahardjo, Dadik; Kuntaman, Kuntaman; Shirakawa, Toshiro; Fujisawa, Masato

    2018-01-23

    Variation by country in urinary tract infection (UTI)-causative bacteria is partly due to the differences in the use of antibiotics. We compared their frequencies and antibiotic susceptibilities in the treatment of patients with UTI from 2 cities, Kobe, Japan, and Surabaya, Indonesia. We retrospectively analyzed 1,804 urine samples collected from patients with UTI in 2014 (1,251 collected in 11 months at Kobe University Hospital in Kobe and 544 collected in 2 months at Dr. Soetomo Hospital in Surabaya). Surabaya data were divided into adult and pediatric patients because a substantial number of specimens from pediatric-patients had been collected. The results indicated that Escherichia coli was the most common uropathogen (24.1% in Kobe and 39.3% in Surabaya) and was significantly resistant to ampicillin and substantially to first- and third-generation cephalosporins in Surabaya adults but not in Kobe adults (p < 0.01). Enterococcus faecalis was often isolated in Kobe (14.0%), but not in Surabaya (5.3%). Klebsiella spp. were isolated at a higher rate in Surabaya pediatric patients (20.3%) than in Surabaya adults (13.6%) and Kobe adults (6.6%). The antibiotic susceptibilities of the isolates form Surabaya isolates tended to be lower than the ones from Kobe. Extended-spectrum β-lactamase-producing Gram-negative bacteria were detected at a significantly higher rate in Surabaya than in Kobe (p < 0.001). These results showed that the antimicrobial resistance patterns of UTI-causative bacteria are highly variable among 2 countries, and the continuous surveillance of trends in antibiotic resistance patterns of uropathogens is necessary for the future revision of antibiotic use.

  14. New energy vision of the Chuo town area. Creation of the town of good rapport and the environment; 2001 nendo Okayama ken Chuo cho chiiki shin energy vision. Fureai to junkan no machidukuri

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Chuo Town, Okayama Prefecture, an investigational study was conducted of the state of energy utilization of the town, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount in Chuo Town was estimated at 68,482 drums in terms of oil drum, and the amount of CO2 emitted from these was 13,287 t-CO2. To reduce this, the introduction of new energy and energy conservation were studied. As a result, the following were indicated as measures to be originally taken: introduction of solar light/solar heat use equipment to general households; installation of the regional cooperation power plant; each household's keeping of a household account book for the environment; introduction of energy-saving navigation device; activities for preservation of forest/terraced paddy field; ticket for exchange of forest volunteer work for products derived from the forest; campaign for composting of garbage using corrugated cardboard; recovery/recycle of waste cooking oil; full-of-flower gardening 500 movement; regionally consistent environmental education of parent/child participating type; introduction of micro hydraulic turbine; manufacture of products from thinnings by biomass lumber drying; expansion of special products of the area; method of the environmental management, etc. (NEDO)

  15. Dark matter at the SHiP experiment

    International Nuclear Information System (INIS)

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  16. 78 FR 64248 - Notice Pursuant to The National Cooperative Research and Production Act of 1993; DVD Copy Control...

    Science.gov (United States)

    2013-10-28

    ...; CyberLink Corporation, Shindian City, Taipei, TAIWAN; D&M Holdings Inc., Chuo-ku, Tokyo, JAPAN; Daesung..., SINGAPORE; Dell Products, L.P., Round Rock, TX; Deluxe Digital Studios, Inc., Burbank, CA; Denso Corporation, Kariya, Aichi-ken, JAPAN; Diamondking Inc., Chino, CA; digiCon AG, Kornwestheim, GERMANY; Huawei Device...

  17. On precursory ULF/ELF electromagnetic signatures for the Kobe earthquake on April 12, 2013

    Science.gov (United States)

    Schekotov, A.; Izutsu, J.; Hayakawa, M.

    2015-12-01

    After the 2011 Tohoku earthquake (EQ), there have been numerous aftershocks in the eastern and Pacific Ocean of Japan, but EQs are still rare in the western part of Japan. In this situation a relatively large (magnitude (M) ∼ 6) EQ happened on April 12 (UT), 2013 at a place close to the 1995 Kobe EQ (M ∼ 7), so we have tried to find whether there existed any electromagnetic precursors to this EQ. Two precursory signatures are detected: one is the depression of ULF (ultra-low-frequency, 0.01-0.02 Hz) geomagnetic variations on April 9, and the second is wideband ELF (extremely low frequency) electromagnetic radiation on April 11. These results for the 2013 Kobe EQ are compared with the corresponding results for the former 1995 Kobe EQ.

  18. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  19. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  20. Pametna kuća

    OpenAIRE

    Rade, Sanjin

    2015-01-01

    Uslijed ubrzanog napretka u bežičnoj komunikaciji i informacijskim tehnologijama, sada je moguće uvesti i implementirati različite razine „pametnosti“ u kuće. Ove pametne kuće su kuće koje mogu da se inteligentno uključe u razne interakcije sa svojim stanovnicima da bi im omogućile udobnost i siguran život. Ovo uključivanje u živote svojih stanara može varirati od jednostavne kontrole ambijentne temperature do ispunjavanja usluga koje su zasnovane na mobilnim agentima. Pametne kuće imaju ...

  1. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  2. Identification and analysis of Ku70 and Ku80 homologs in the koji molds Aspergillus sojae and Aspergillus oryzae.

    Science.gov (United States)

    Takahashi, Tadashi; Masuda, Tsutomu; Koyama, Yasuji

    2006-01-01

    Ku genes play a key role in the non-homologous end-joining pathway. We have identified Ku70 and Ku80 homologs in the koji molds Aspergillus sojae and Aspergillus oryzae, and have constructed the disruption mutants of Ku70, Ku80, and Ku70-80 to characterize the phenotypic change in these mutants. Neither Ku70- nor Ku80-disrupted strains show hypersensitivity to the DNA damaging agents methylmethane sulfonate (MMS) and phleomycin. Moreover, undesirable phenotypes, such as poor growth or repressed conidiospore formation, were not observed in the Ku-disrupted A. sojae and A. oryzae.

  3. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  4. Molecular analysis of Ku redox regulation

    Directory of Open Access Journals (Sweden)

    Shatilla Andrea

    2009-08-01

    Full Text Available Abstract Background DNA double-strand breaks (DSBs can occur in response to ionizing radiation (IR, radiomimetic agents and from endogenous DNA-damaging reactive oxygen metabolites. Unrepaired or improperly repaired DSBs are potentially the most lethal form of DNA damage and can result in chromosomal translocations and contribute to the development of cancer. The principal mechanism for the repair of DSBs in humans is non-homologous end-joining (NHEJ. Ku is a key member of the NHEJ pathway and plays an important role in the recognition step when it binds to free DNA termini. Ku then stimulates the assembly and activation of other NHEJ components. DNA binding of Ku is regulated by redox conditions and evidence from our laboratory has demonstrated that Ku undergoes structural changes when oxidized that results in a reduction in DNA binding activity. The C-terminal domain and cysteine 493 of Ku80 were investigated for their contribution to redox regulation of Ku. Results We effectively removed the C-terminal domain of Ku80 generating a truncation mutant and co-expressed this variant with wild type Ku70 in an insect cell system to create a Ku70/80ΔC heterodimer. We also generated two single amino acid variants of Cys493, replacing this amino acid with either an alanine (C493A or a serine (C493S, and over-expressed the variant proteins in SF9 insect cells in complex with wild type Ku70. Neither the truncation nor the amino acid substitutions alters protein expression or stability as determined by SDS-PAGE and Western blot analysis. We show that the C493 mutations do not alter the ability of Ku to bind duplex DNA in vitro under reduced conditions while truncation of the Ku80 C-terminus slightly reduced DNA binding affinity. Diamide oxidation of cysteines was shown to inhibit DNA binding similarly for both the wild-type and all variant proteins. Interestingly, differential DNA binding activity following re-reduction was observed for the Ku70/80

  5. Inhibition of Ku70 acetylation by INHAT subunit SET/TAF-Iβ regulates Ku70-mediated DNA damage response.

    Science.gov (United States)

    Kim, Kee-Beom; Kim, Dong-Wook; Park, Jin Woo; Jeon, Young-Joo; Kim, Daehwan; Rhee, Sangmyung; Chae, Jung-Il; Seo, Sang-Beom

    2014-07-01

    DNA double-strand breaks (DSBs) can cause either cell death or genomic instability. The Ku heterodimer Ku70/80 is required for the NHEJ (non-homologous end-joining) DNA DSB repair pathway. The INHAT (inhibitor of histone acetyltransferases) complex subunit, SET/TAF-Iβ, can inhibit p300- and PCAF-mediated acetylation of both histone and p53, thereby repressing general transcription and that of p53 target genes. Here, we show that SET/TAF-Iβ interacts with Ku70/80, and that this interaction inhibits CBP- and PCAF-mediated Ku70 acetylation in an INHAT domain-dependent manner. Notably, DNA damage by UV disrupted the interaction between SET/TAF-Iβ and Ku70. Furthermore, we demonstrate that overexpressed SET/TAF-Iβ inhibits recruitment of Ku70/80 to DNA damage sites. We propose that dysregulation of SET/TAF-Iβ expression prevents repair of damaged DNA and also contributes to cellular proliferation. All together, our findings indicate that SET/TAF-Iβ interacts with Ku70/80 in the nucleus and inhibits Ku70 acetylation. Upon DNA damage, SET/TAF-Iβ dissociates from the Ku complex and releases Ku70/Ku80, which are then recruited to DNA DSB sites via the NHEJ DNA repair pathway.

  6. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  7. Women stereotypes in Shi Zhecun's short stories.

    Science.gov (United States)

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  8. Fabrication and erection of 'Chuo ohashi bridge' for Tokyo Metropolitan Government. Tokyoto kensetsukyoku 'Chuo ohashi' no seisaku oyobi kasetsu

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The present report outlines the superstructure of 'Chuo Ohashi Bridge' spanning the Sumida River, Tokyo Metropolis. Being 210.7m in length and 25.0m in breadth, that bridge is a cable-stayed bridge partially curved with a 220m radius curvature. Having a height of 76.8m, its main tower is shaped into an upside-down V with a curved top. Description of the points of which care was specially taken for the fabrication and construction in yard covers the cable anchorage of both girders and tower, assembly and welding, anti-shrinkage camber of girders, weld bevel preparation for the tower, tentative assembly, and accuracy control. Results of the wind tunnel test with a (1/50) scale model are as follows: stay cables were installed as measures against the vibration during the main tower erection. The main girders, main tower and cables were the order of superstructural erection. The cable tensioning was supervised mainly with its proper tension adjustment and subsidiarily for the configuration of bridge built. 2 refs., 10 figs., 1 tab.

  9. On the ionospheric perturbation for the 1995 Kobe earthquake: revisited

    Directory of Open Access Journals (Sweden)

    Masashi Hayakawa

    2016-01-01

    Full Text Available The presence of seismo-lower ionospheric perturbation for the Kobe earthquake (EQ has been revisited with a relatively new phenomenon of ULF (ultra-low-frequency magnetic field depression effect. By using the ULF data in Japan only at Kakioka belonging to Japan Meteorological Agency (because data from Memambetsu and Kanoya were not available, we have found that a very clear ULF depression was observed at Kakioka on 14 January 1995. A comparison with our former result on subionospheric VLF (very low frequency propagation anomaly indicates that the occurrence of ULF depression exhibits a temporal coincidence (synchronization with that of subionospheric VLF anomaly. This may be acceptable because the ULF depression can be explained in terms of enhanced absorption of magnetospheric ULF waves through the disturbed lower ionosphere prior to an EQ. The result of ULF magnetic field depression in this paper is likely to provide a further support to the presence of the lower ionospheric perturbation before the Kobe EQ.

  10. Brothers or Rivals? Iran and the Shi'a of Iraq

    National Research Council Canada - National Science Library

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  11. Evidence of precursor phenomena in the Kobe earthquake obtained from atmospheric radon concentration

    Energy Technology Data Exchange (ETDEWEB)

    Yasuoka, Yumi [Kobe Pharmaceutical University, 4-19-1 Mtoyamakitama-machi, Higashinada-ku, Kobe, Hyogo 658-8558 (Japan)]. E-mail: yasuoka@kobepharma-u.ac.jp; Igarashi, George [Science Research Center for Prediction of Earthquakes and Volcanic Eruptions, Tohoku University, 4-1 Seiryo-machi, Aoba-ku, Sendai, Miyagi 980-8575 (Japan); Ishikawa, Testuo [National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Tokonami, Shinji [National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Shinogi, Masaki [Kobe Pharmaceutical University, 4-19-1 Mtoyamakitama-machi, Higashinada-ku, Kobe, Hyogo 658-8558 (Japan)

    2006-06-15

    Atmospheric {sup 222}Rn concentrations were determined over a 10a period, which included the date of the Kobe, Japan earthquake, on January 17th 1995. It was found that the seismically related {sup 222}Rn anomaly was higher than the 99% confidence limits for the residual value of atmospheric {sup 222}Rn which had been observed 2 months before. The residual {sup 222}Rn concentration, in which residual values of the daily minimum are the difference between each normal {sup 222}Rn concentration (calculated from January 1984 to December 1993) and the daily minimum {sup 222}Rn concentration (January 1994 to January 1995), was calculated by applying the exponential smoothing method to the residual values for each day. It was found that the fluctuations of the residual values can be fitted very well to a log-periodic oscillation model. The real residual values stopped increasing at 1994.999 (December 31st 1994), which corresponds with the critical point (t {sub c}) of best fit model. This anomalous {sup 222}Rn variation can be seen as the result of local stresses, not primary stresses which directly lead to the Kobe earthquake. On the other hand, when the critical exponent (z) and the radial frequency ({omega}) of the model were simultaneously fixed 0.2 {<=} z {<=} 0.6 and 6 {<=} {omega} {<=} 12, t {sub c} (critical point) was between January 13th 1995 and January 27th 1995. The Kobe earthquake occurrence date (January 17th 1995) is within this range. Therefore this anomalous {sup 222}Rn variation can also be seen as the result of primary stresses which possibly led to the Kobe earthquake. There is a distinct possibility that similar statistical oscillations will be detected in other measurements such as microseismicity, tectonic strain, fluctuation in the ground level, or changes in groundwater elevations and composition.

  12. Karikaturist Aivar Juhanson näitab KuKu klubis oma töid

    Index Scriptorium Estoniae

    2009-01-01

    Loit Jõekalda kureeritud joonistustriennaali raames eksponeerivad oma töid Ave Avalo, Kärt Hammer, Eero Ijavoinen, Kristjan Kittus, Mari-Liis Laanemaa, Triinu Lille, Valli Lember-Bogatkina jpt. kunstnikud. Ajalehe "Eesti Ekspress" karikaturisti Aivar Juhansoni tööde näitus Tallinnas KuKu klubis

  13. Interaction and conflict between Sufism and Shi`ism during Safavid era

    Directory of Open Access Journals (Sweden)

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  14. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    International Nuclear Information System (INIS)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  15. Er KU et mobbeuniversitet?

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian

    2009-01-01

    Ansatte på KU mobber hverken mere eller mindre end på andre danske arbejdspladser. Mediernes dækning af APV-undersøgelsens resultater mht. mobning er sensationalistisk og delvis vildledende.......Ansatte på KU mobber hverken mere eller mindre end på andre danske arbejdspladser. Mediernes dækning af APV-undersøgelsens resultater mht. mobning er sensationalistisk og delvis vildledende....

  16. Dr. Shi Hanzhang's Experience in Treating Andropathy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  17. Calibrating the SHiP muon-flux using NA61/SHINE

    CERN Document Server

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  18. $\\mu$-flux measurements for SHiP using NA61/SHINE

    CERN Document Server

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  19. Stress transferred by the 1995 Mw = 6.9 Kobe, Japan, shock: Effect on aftershocks and future earthquake probabilities

    Science.gov (United States)

    Toda, S.; Stein, R.S.; Reasenberg, P.A.; Dieterich, J.H.; Yoshida, A.

    1998-01-01

    The Kobe earthquake struck at the edge of the densely populated Osaka-Kyoto corridor in southwest Japan. We investigate how the earthquake transferred stress to nearby faults, altering their proximity to failure and thus changing earthquake probabilities. We find that relative to the pre-Kobe seismicity, Kobe aftershocks were concentrated in regions of calculated Coulomb stress increase and less common in regions of stress decrease. We quantify this relationship by forming the spatial correlation between the seismicity rate change and the Coulomb stress change. The correlation is significant for stress changes greater than 0.2-1.0 bars (0.02-0.1 MPa), and the nonlinear dependence of seismicity rate change on stress change is compatible with a state- and rate-dependent formulation for earthquake occurrence. We extend this analysis to future mainshocks by resolving the stress changes on major faults within 100 km of Kobe and calculating the change in probability caused by these stress changes. Transient effects of the stress changes are incorporated by the state-dependent constitutive relation, which amplifies the permanent stress changes during the aftershock period. Earthquake probability framed in this manner is highly time-dependent, much more so than is assumed in current practice. Because the probabilities depend on several poorly known parameters of the major faults, we estimate uncertainties of the probabilities by Monte Carlo simulation. This enables us to include uncertainties on the elapsed time since the last earthquake, the repeat time and its variability, and the period of aftershock decay. We estimate that a calculated 3-bar (0.3-MPa) stress increase on the eastern section of the Arima-Takatsuki Tectonic Line (ATTL) near Kyoto causes fivefold increase in the 30-year probability of a subsequent large earthquake near Kyoto; a 2-bar (0.2-MPa) stress decrease on the western section of the ATTL results in a reduction in probability by a factor of 140 to

  20. Mycobacterium smegmatis Ku binds DNA without free ends.

    Science.gov (United States)

    Kushwaha, Ambuj K; Grove, Anne

    2013-12-01

    Ku is central to the non-homologous end-joining pathway of double-strand-break repair in all three major domains of life, with eukaryotic homologues being associated with more diversified roles compared with prokaryotic and archaeal homologues. Ku has a conserved central 'ring-shaped' core domain. While prokaryotic homologues lack the N- and C-terminal domains that impart functional diversity to eukaryotic Ku, analyses of Ku from certain prokaryotes such as Pseudomonas aeruginosa and Mycobacterium smegmatis have revealed the presence of distinct C-terminal extensions that modulate DNA-binding properties. We report in the present paper that the lysine-rich C-terminal extension of M. smegmatis Ku contacts the core protein domain as evidenced by an increase in DNA-binding affinity and a decrease in thermal stability and intrinsic tryptophan fluorescence upon its deletion. Ku deleted for this C-terminus requires free DNA ends for binding, but translocates to internal DNA sites. In contrast, full-length Ku can directly bind DNA without free ends, suggesting that this property is conferred by its C-terminus. Such binding to internal DNA sites may facilitate recruitment to sites of DNA damage. The results of the present study also suggest that extensions beyond the shared core domain may have independently evolved to expand Ku function.

  1. Ku80-deleted cells are defective at base excision repair

    International Nuclear Information System (INIS)

    Li, Han; Marple, Teresa; Hasty, Paul

    2013-01-01

    Graphical abstract: - Highlights: • Ku80-deleted cells are hypersensitive to ROS and alkylating agents. • Cells deleted for Ku80, but not Ku70 or Lig4, have reduced BER capacity. • OGG1 rescues hypersensitivity to H 2 O 2 and paraquat in Ku80-mutant cells. • Cells deleted for Ku80, but not Lig4, are defective at repairing AP sites. • Cells deleted for Ku80, but not Lig4 or Brca2 exon 27, exhibit increased PAR. - Abstract: Ku80 forms a heterodimer with Ku70, called Ku, that repairs DNA double-strand breaks (DSBs) via the nonhomologous end joining (NHEJ) pathway. As a consequence of deleting NHEJ, Ku80-mutant cells are hypersensitive to agents that cause DNA DSBs like ionizing radiation. Here we show that Ku80 deletion also decreased resistance to ROS and alkylating agents that typically cause base lesions and single-strand breaks (SSBs). This is unusual since base excision repair (BER), not NHEJ, typically repairs these types of lesions. However, we show that deletion of another NHEJ protein, DNA ligase IV (Lig4), did not cause hypersensitivity to these agents. In addition, the ROS and alkylating agents did not induce γ-H2AX foci that are diagnostic of DSBs. Furthermore, deletion of Ku80, but not Lig4 or Ku70, reduced BER capacity. Ku80 deletion also impaired BER at the initial lesion recognition/strand scission step; thus, involvement of a DSB is unlikely. Therefore, our data suggests that Ku80 deletion impairs BER via a mechanism that does not repair DSBs

  2. Ku80-deleted cells are defective at base excision repair

    Energy Technology Data Exchange (ETDEWEB)

    Li, Han [The University of Texas Health Science Center at San Antonio, The Institute of Biotechnology, The Department of Molecular Medicine, 15355 Lambda Drive, San Antonio, TX 78245-3207 (United States); Tumor Suppression Group, Spanish National Cancer Research Centre (CNIO), Madrid 28029 (Spain); Marple, Teresa [The University of Texas Health Science Center at San Antonio, The Institute of Biotechnology, The Department of Molecular Medicine, 15355 Lambda Drive, San Antonio, TX 78245-3207 (United States); Hasty, Paul, E-mail: hastye@uthscsa.edu [The University of Texas Health Science Center at San Antonio, The Institute of Biotechnology, The Department of Molecular Medicine, 15355 Lambda Drive, San Antonio, TX 78245-3207 (United States); Tumor Suppression Group, Spanish National Cancer Research Centre (CNIO), Madrid 28029 (Spain)

    2013-05-15

    Graphical abstract: - Highlights: • Ku80-deleted cells are hypersensitive to ROS and alkylating agents. • Cells deleted for Ku80, but not Ku70 or Lig4, have reduced BER capacity. • OGG1 rescues hypersensitivity to H{sub 2}O{sub 2} and paraquat in Ku80-mutant cells. • Cells deleted for Ku80, but not Lig4, are defective at repairing AP sites. • Cells deleted for Ku80, but not Lig4 or Brca2 exon 27, exhibit increased PAR. - Abstract: Ku80 forms a heterodimer with Ku70, called Ku, that repairs DNA double-strand breaks (DSBs) via the nonhomologous end joining (NHEJ) pathway. As a consequence of deleting NHEJ, Ku80-mutant cells are hypersensitive to agents that cause DNA DSBs like ionizing radiation. Here we show that Ku80 deletion also decreased resistance to ROS and alkylating agents that typically cause base lesions and single-strand breaks (SSBs). This is unusual since base excision repair (BER), not NHEJ, typically repairs these types of lesions. However, we show that deletion of another NHEJ protein, DNA ligase IV (Lig4), did not cause hypersensitivity to these agents. In addition, the ROS and alkylating agents did not induce γ-H2AX foci that are diagnostic of DSBs. Furthermore, deletion of Ku80, but not Lig4 or Ku70, reduced BER capacity. Ku80 deletion also impaired BER at the initial lesion recognition/strand scission step; thus, involvement of a DSB is unlikely. Therefore, our data suggests that Ku80 deletion impairs BER via a mechanism that does not repair DSBs.

  3. Muon-flux measurements for SHiP at H4

    CERN Document Server

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  4. A SHiP to explore new routes

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  5. Predictive images of postoperative levator resection outcome using image processing software

    OpenAIRE

    Mawatari, Yuki; Fukushima, Mikiko

    2016-01-01

    Yuki Mawatari,1 Mikiko Fukushima2 1Igo Ophthalmic Clinic, Kagoshima, 2Department of Ophthalmology, Faculty of Life Science, Kumamoto University, Chuo-ku, Kumamoto, Japan Purpose: This study aims to evaluate the efficacy of processed images to predict postoperative appearance following levator resection.Methods: Analysis involved 109 eyes from 65 patients with blepharoptosis who underwent advancement of levator aponeurosis and Müller’s muscle complex (levator resection). P...

  6. A moonlighting function of Mycobacterium smegmatis Ku in zinc homeostasis?

    Science.gov (United States)

    Kushwaha, Ambuj K; Deochand, Dinesh K; Grove, Anne

    2015-02-01

    Ku protein participates in DNA double-strand break repair via the nonhomologous end-joining pathway. The three-dimensional structure of eukaryotic Ku reveals a central core consisting of a β-barrel domain and pillar and bridge regions that combine to form a ring-like structure that encircles DNA. Homologs of Ku are encoded by a subset of bacterial species, and they are predicted to conserve this core domain. In addition, the bridge region of Ku from some bacteria is predicted from homology modeling and sequence analyses to contain a conventional HxxC and CxxC (where x is any residue) zinc-binding motif. These potential zinc-binding sites have either deteriorated or been entirely lost in Ku from other organisms. Using an in vitro metal binding assay, we show that Mycobacterium smegmatis Ku binds two zinc ions. Zinc binding modestly stabilizes the Ku protein (by ∼3°C) and prevents cysteine oxidation, but it has little effect on DNA binding. In vivo, zinc induces significant upregulation of the gene encoding Ku (∼sixfold) as well as a divergently oriented gene encoding a predicted zinc-dependent MarR family transcription factor. Notably, overexpression of Ku confers zinc tolerance on Escherichia coli. We speculate that zinc-binding sites in Ku proteins from M. smegmatis and other mycobacterial species have been evolutionarily retained to provide protection against zinc toxicity without compromising the function of Ku in DNA double-strand break repair. © 2014 The Protein Society.

  7. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Directory of Open Access Journals (Sweden)

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  8. Regulation of homologous recombination repair protein Rad51 by Ku70

    International Nuclear Information System (INIS)

    Du Liqing; Liu Qiang; Wang Yan; Xu Chang; Cao Jia; Fu Yue; Chen Fenghua; Fan Feiyue

    2013-01-01

    Objective: To explore the regulative effect of non-homologous end joining (NHEJ)protein Ku70 on homologous recombination repair protein Rad51, and to investigate the synergistic mechanism of homologous recombination repair in combination with NHEJ. Methods: Observed Rad51 protein expression after transfect Ku70 small interfering RNA or Ku70 plasmid DNA into tumor cells using Western blot. Results: Expression of Rad51 was obviously reduced after pretreated with Ku70 small interfering RNA. And with the increasing expression of Ku70 protein after transfection of Ku70 plasmid DNA PGCsi3.0-hKu70 into tumor cell lines, the Rad51 protein expression was increased. Conclusion: Ku70 protein has regulating effect on gene expression of Rad51, and it might participate in the collaboration between homologous recombination repair and NHEJ. (authors)

  9. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Science.gov (United States)

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  10. Refraction experiment in the Kobe-Hanshin area; Kobe Hanshin kan ni okeru kussetsuho tansa

    Energy Technology Data Exchange (ETDEWEB)

    Koketsu, K [The University of Tokyo, Tokyo (Japan). Earthquake Research Institute

    1996-05-01

    The refraction experiments were conducted to investigate the underground structures reaching the basement by analyzing the results of the artificial earthquakes the explosion earthquake research group produced in City of Kobe and the Hanshin District on December 12 to 15, 1995. Considering that noise level can exceed 1 mkine in an urban area even in the mid-night, the courses of traverse were drawn focusing on Points S2 through S4 and U1. The earthquake waves from Points S2 through S4 are generally low in amplitude. However, the major components of the signals have a dominant frequency exceeding 10Hz, which makes them distinguishable from urban noise having a lower frequency, contrary to the previous indication that such a low-amplitude wave might not be distinguishable. On the other hand, the signals from the explosion at Point 4 in Awaji Island cannot be distinguished in the urban area, even on the nearby course of traverse D. At present, the analytical group is organized to read various phases running and analyze the P-velocity structures. 2 refs., 10 figs., 1 tab.

  11. Time series modelling of the Kobe-Osaka earthquake recordings

    Directory of Open Access Journals (Sweden)

    N. Singh

    2002-01-01

    generated by an earthquake. With a view of comparing these two types of waveforms, Singh (1992 developed a technique for identifying a model in time domain. Fortunately this technique has been found useful in modelling the recordings of the killer earthquake occurred in the Kobe-Osaka region of Japan at 5.46 am on 17 January, 1995. The aim of the present study is to show how well the method for identifying a model (developed by Singh (1992 can be used for describing the vibrations of the above mentioned earthquake recorded at Charters Towers in Queensland, Australia.

  12. Gode råd til KU om bæredygtig omstilling

    DEFF Research Database (Denmark)

    Lund, Jens Friis

    2016-01-01

    I gennemsnit flyver alle KU-ansatte retur til Cairo årligt. KU's stigende internationalisering skader klimaet, og det kræver bæredygtig omstilling.......I gennemsnit flyver alle KU-ansatte retur til Cairo årligt. KU's stigende internationalisering skader klimaet, og det kræver bæredygtig omstilling....

  13. TianShuiShi space breeding current situation and developing trend

    International Nuclear Information System (INIS)

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  14. Interaction of caveolin-1 with Ku70 inhibits Bax-mediated apoptosis.

    Directory of Open Access Journals (Sweden)

    Huafei Zou

    Full Text Available Caveolin-1, the structural protein component of caveolae, acts as a scaffolding protein that functionally regulates signaling molecules. We show that knockdown of caveolin-1 protein expression enhances chemotherapeutic drug-induced apoptosis and inhibits long-term survival of colon cancer cells. In vitro studies demonstrate that caveolin-1 is a novel Ku70-binding protein, as shown by the binding of the scaffolding domain of caveolin-1 (amino acids 82-101 to the caveolin-binding domain (CBD of Ku70 (amino acids 471-478. Cell culture data show that caveolin-1 binds Ku70 after treatment with chemotherapeutic drugs. Mechanistically, we found that binding of caveolin-1 to Ku70 inhibits the chemotherapeutic drug-induced release of Bax from Ku70, activation of Bax, translocation of Bax to mitochondria and apoptosis. Potentiation of apoptosis by knockdown of caveolin-1 protein expression is greatly reduced in the absence of Bax expression. Finally, we found that overexpression of wild type Ku70, but not a mutant form of Ku70 that cannot bind to caveolin-1 (Ku70 Φ→A, limits the chemotherapeutic drug-induced Ku70/Bax dissociation and apoptosis. Thus, caveolin-1 acts as an anti-apoptotic protein in colon cancer cells by binding to Ku70 and inhibiting Bax-dependent cell death.

  15. Ku-pa-ro en las tablillas de Cnoso

    Directory of Open Access Journals (Sweden)

    José L. Melena

    1974-12-01

    Full Text Available This paper is intended to be a comprehensive analysis of the evidence of ku-pa-ro in the Knossos Linear B tablets. Its main purpose is to set up the importance of such aromatic plant in the Mycenaean economy at Knossos and to identify what kind of sedge was concealed under the name ku-pa-ro and what part of the plant was used and for what purposes. What it is stressed is the usage of the Cyperus rotundus L. (i. e. the ku-pa-ro in the industry of perfumes and as a food additive as well. What is inferred from the discussion on the evidence of ku-pa-ro issues a series of valuable data concerning the localization of certain place-names in the map of Crete, and concerning the explanation of ideogram *171. The high qualities of ku-pa-ro preserved in the tablets lead the author to assume that such a plant was cultivated in Crete and was one of the main aromatic plants used by the Mycenaeans in the making of perfumes.

  16. Subsurface geology by shallow seismic reflection survey and microgravity survey in Kobe area; Senso hanshaho danseiha tansa oyobi seimitsu juryoku tansa ni yoru Kobe chiiki no chika chishitsu

    Energy Technology Data Exchange (ETDEWEB)

    Endo, H; Makino, M; Murata, Y; Watanabe, S [Geological Survey of Japan, Tsukuba (Japan)

    1996-05-01

    This paper reports discussions on subsurface structure of the Kobe area by means of microgravity survey. A Bouguer anomaly distribution graph was obtained (which is close to a near straight line) by measuring the gravity at measurement points with an interval of about 25 m along a traverse line (with a total length of about 1.7 km) in an approximately NNW-SSE direction crossing the downtown of the city of Kobe. Viewing the residuals to a straight line linking the values at both ends of the traverse line revealed that the gradient in the Bouguer anomaly distribution changes as if it is bent at a point near the center of the traverse line as a boundary. Deriving the residuals from fine changes seen in a distribution graph for the residuals made clear that this residual distribution has two discontinuous points. The paper indicates that the bending point in the former case corresponds to a reverse fault in a base bed of a flat land as compared with the result of model calculation on the base structure and gravity distribution. The discontinuous points in the latter case agree with positions of fault distribution derived by a reflection elastic wave survey. 6 refs., 4 figs.

  17. Ku70 inhibits gemcitabine-induced DNA damage and pancreatic cancer cell apoptosis

    International Nuclear Information System (INIS)

    Ma, Jiali; Hui, Pingping; Meng, Wenying; Wang, Na; Xiang, Shihao

    2017-01-01

    The current study focused on the role of Ku70, a DNA-dependent protein kinase (DNA-PK) complex protein, in pancreatic cancer cell resistance to gemcitabine. In both established cell lines (Mia-PaCa-2 and PANC-1) and primary human pancreatic cancer cells, shRNA/siRNA-mediated knockdown of Ku70 significantly sensitized gemcitabine-induced cell death and proliferation inhibition. Meanwhile, gemcitabine-induced DNA damage and subsequent pancreatic cancer cell apoptosis were also potentiated with Ku70 knockdown. On the other hand, exogenous overexpression of Ku70 in Mia-PaCa-2 cells suppressed gemcitabine-induced DNA damage and subsequent cell apoptosis. In a severe combined immune deficient (SCID) mice Mia-PaCa-2 xenograft model, gemcitabine-induced anti-tumor activity was remarkably pontificated when combined with Ku70 shRNA knockdown in the xenografts. The results of this preclinical study imply that Ku70 might be a primary resistance factor of gemcitabine, and Ku70 silence could significantly chemo-sensitize gemcitabine in pancreatic cancer cells. - Highlights: • Ku70 knockdown sensitizes gemcitabine-induced killing of pancreatic cancer cells. • Ku70 knockdown facilitates gemcitabine-induced DNA damage and cell apoptosis. • Ku70 overexpression deceases gemcitabine's sensitivity in pancreatic cancer cells. • Ku70 knockdown sensitizes gemcitabine-induced anti-tumor activity in vivo.

  18. Search for New Physics in SHiP and at future colliders

    CERN Document Server

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  19. 19 CFR Appendix to Part 102 - Textile and Apparel Manufacturer Identification

    Science.gov (United States)

    2010-04-01

    ... Morich Indo Fashion.” In Russia, other prefixes are used, such as “JSC,” “OAO,” “OOO,” and “ZAO.” These..., Sidney, Australia; AUCARJON88SID N. MINAMI & CO., LTD., 2-6, 8-Chome Isogami-Dori, Fukiai-Ku, Kobe, Japan...

  20. Ku70, Ku80, and sClusterin: A Cluster of Predicting Factors for Response to Neoadjuvant Chemoradiation Therapy in Patients With Locally Advanced Rectal Cancer

    International Nuclear Information System (INIS)

    Pucci, Sabina; Polidoro, Chiara; Joubert, Alessandro; Mastrangeli, Francesca; Tolu, Barbara; Benassi, Michaela; Fiaschetti, Valeria; Greco, Laura; Miceli, Roberto; Floris, Roberto; Novelli, Giuseppe; Orlandi, Augusto; Santoni, Riccardo

    2017-01-01

    Purpose: The identification of predictive biomarkers for neoadjuvant chemoradiation therapy (CRT) is a current clinical need. The heterodimer Ku70/80 plays a critical role in DNA repair and cell death induction after damage. The aberrant expression and localization of these proteins fail to control DNA repair and apoptosis. sClusterin is the Ku70 partner that sterically inhibits Bax-dependent cell death after damage in some pathologic conditions. This study sought to evaluate the molecular relevance of Ku70-Ku80-Clu as a molecular cluster predicting the response to neoadjuvant CRT in patients with locally advanced rectal cancer (LARC). Methods and Materials: Patients enrolled in this study underwent preoperative CRT followed by surgical excision. A retrospective study based on individual response, evaluated by computed tomography and diffusion-weighted magnetic resonance imaging, identified responder (56%) and no-responder patients (44%). Ku70/80 and Clu expression were observed in biopsy specimens obtained before and after treatment with neoadjuvant CRT from the same LARC patients. In vitro studies before and after irradiation were also performed on radioresistant (SW480) and radiosensitive (SW620) colorectal cancer cell lines, mimicking sensitive or resistant tumor behavior. Results: We found a conventional nuclear localization of Ku70/80 in pretherapeutic tumor biopsies of responder patients, in agreement with their role in DNA repair and regulating apoptosis. By contrast, in the no-responder population we observed an unconventional overexpression of Ku70 in the cytoplasm (P<.001). In this context we also overexpression of sClu in the cytoplasm, which accorded with its role in stabilizing of Bax-Ku70 complex, inhibiting Bax-dependent apoptosis. Strikingly, Ku80 in these tumor tissues was lost (P<.005). In vitro testing of colon cancer cells finally confirmed the results observed in tumor biopsy specimens, proving that Ku70/80-Clu deregulation is extensively

  1. Ku70, Ku80, and sClusterin: A Cluster of Predicting Factors for Response to Neoadjuvant Chemoradiation Therapy in Patients With Locally Advanced Rectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pucci, Sabina, E-mail: sabina.pucci@uniroma2.it; Polidoro, Chiara; Joubert, Alessandro; Mastrangeli, Francesca; Tolu, Barbara; Benassi, Michaela; Fiaschetti, Valeria; Greco, Laura; Miceli, Roberto; Floris, Roberto; Novelli, Giuseppe; Orlandi, Augusto; Santoni, Riccardo

    2017-02-01

    Purpose: The identification of predictive biomarkers for neoadjuvant chemoradiation therapy (CRT) is a current clinical need. The heterodimer Ku70/80 plays a critical role in DNA repair and cell death induction after damage. The aberrant expression and localization of these proteins fail to control DNA repair and apoptosis. sClusterin is the Ku70 partner that sterically inhibits Bax-dependent cell death after damage in some pathologic conditions. This study sought to evaluate the molecular relevance of Ku70-Ku80-Clu as a molecular cluster predicting the response to neoadjuvant CRT in patients with locally advanced rectal cancer (LARC). Methods and Materials: Patients enrolled in this study underwent preoperative CRT followed by surgical excision. A retrospective study based on individual response, evaluated by computed tomography and diffusion-weighted magnetic resonance imaging, identified responder (56%) and no-responder patients (44%). Ku70/80 and Clu expression were observed in biopsy specimens obtained before and after treatment with neoadjuvant CRT from the same LARC patients. In vitro studies before and after irradiation were also performed on radioresistant (SW480) and radiosensitive (SW620) colorectal cancer cell lines, mimicking sensitive or resistant tumor behavior. Results: We found a conventional nuclear localization of Ku70/80 in pretherapeutic tumor biopsies of responder patients, in agreement with their role in DNA repair and regulating apoptosis. By contrast, in the no-responder population we observed an unconventional overexpression of Ku70 in the cytoplasm (P<.001). In this context we also overexpression of sClu in the cytoplasm, which accorded with its role in stabilizing of Bax-Ku70 complex, inhibiting Bax-dependent apoptosis. Strikingly, Ku80 in these tumor tissues was lost (P<.005). In vitro testing of colon cancer cells finally confirmed the results observed in tumor biopsy specimens, proving that Ku70/80-Clu deregulation is extensively

  2. Discovery and characterization of Ku acetylation in Mycobacterium smegmatis.

    Science.gov (United States)

    Zhou, Ying; Chen, Tao; Zhou, Lin; Fleming, Joy; Deng, Jiaoyu; Wang, Xude; Wang, Liwei; Wang, Yingying; Zhang, Xiaoli; Wei, Wenjing; Bi, Lijun

    2015-03-01

    Lysine acetylation is an important post-translational modification and is known to regulate many eukaryotic cellular processes. Little, however, is known about acetylated proteins in prokaryotes. Here, using immunoblotting, mass spectrometry and mutagenesis studies, we investigate the acetylation dynamics of the DNA repair protein Ku and its relationship with the deacetylase protein Sir2 and the non-homologous end joining (NHEJ) pathway in Mycobacterium smegmatis. We report that acetylation of Ku increases with growth, while NHEJ activity decreases, providing support for the hypothesis that acetylation of Ku may be involved in the DNA damage response in bacteria. Ku has multiple lysine sites. Our results indicate that K29 is an important acetylation site and that deficiency of Sir2 or mutation of K29 affects the quantity of Ku and its acetylation dynamics. Our findings expand knowledge of acetylation targets in prokaryotes and indicate a new direction for further research on bacterial DNA repair mechanisms. © FEMS 2014. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Science.gov (United States)

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  4. Interspecific variation of intracellular localization and postirradiation movement of Ku70-protein in fibroblastic cells

    International Nuclear Information System (INIS)

    Endoh, Daiji; Hayashi, Masanobu; Okui, Toyo; Kawase, Shiro; Kon, Yasushiro

    2003-01-01

    Ku (Ku70 and Ku80) Proteins are known as components of DNA-dependent protein kinase (DNA-PK) and play an important role for DNA repair. We previously reported that more than 70% of Ku proteins were located in cytoplasm of rat cells, the Ku proteins moved into nuclei of normal rat cells after X-irradiation, Ku proteins also moved into nuclei after X-irradiation but were not retained in nucleus of radiosensitive LEC rat cells. While reports have been shown about mechanisms on nuclear localization of Ku proteins, how Ku proteins export from nucleus is poorly understood. Here we show that C-terminal region of Ku70 protein is important for its cytoplasmic localization. When transfected into LEC rat cells, exogenous intact Ku70 (1-609) tagged with enhanced green fluorescent protein (EGFP-Ku70) localized mainly in the cytoplasm, whereas C-terminal-deletion mutant of Ku70 (1-593) tagged with EGFP (EGFP-Ku70D) was mainly localized in the nucleus. After X-irradiation, the endogenous intact EGFP-Ku70 once moved into nucleus, but returned into the cytoplasm. On the other hand, EGFP-Ku70D was retained in nucleus for two hours after X-irradiation. These results suggest that C-terminal region of Ku70 is included in the postirradiation nuclear export. Next, we investigated the intracellular localization of Ku70 proteins and the movement after X-irradiation of fibroblastic cells prepared from some mammalian species. Ku70 proteins were localized in nucleus and the postirradiation-extranuclear transport was not observed in human and African green monkey cells. On the other hand, Ku70 proteins were mainly localized in cytoplasm and moved into nucleus in mouse, Chinese hamster, Golden hamster, cotton rat, squirrel, cat and dog cells. These results may show that alternatively Ku70 protein is localized in the cytoplasm or nucleus depends on species and translocation of cytoplasmic Ku70 into nucleus is a response against low dose irradiation in fibroblasts of rodents, cats and dogs

  5. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Science.gov (United States)

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  6. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    CERN Document Server

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  7. Disturbed mouse circadian rhythm before the Kobe EQ in 1995

    Science.gov (United States)

    Yokoi, Sayoko

    2013-04-01

    Legends of macro-anomalies before large earthquakes have been passed down for generations in Asia. Most of the statements on earthquake precursors are considered unreliable afterthoughts by traditional scientists. However, disturbed biological rhythms in mice were observed before the Kobe EQ in 1995 (Yokoi et al, 2003). The records of unusual mouse behavior before the earthquake were obtained to study biological clock at Institute for Protein Research, Osaka University. It is clarified that the disturbance was very rare phenomena statistically. Similar phenomenon was observed before the Wenchuan earthquake in 2008, too (Li et al, 2009). In the presentation, I will discuss the phenomena as one example of preseismic unusual animal behaviors.

  8. Report on achievements in fiscal 1998. Surveys on development of an at-home welfare device system to rationalize energy use. (Kobe); 1998 nendo energy shiyo gorika zaitaku fukushi kiki system kaihatsu chosa (Kobe) saiitaku kenkyu seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    In the Kobe district, studies were performed with the importance placed on energy consumption at care-taking sites. Power consumption of devices used in residential houses of families having physically handicapped and elderly persons has been measured for two to three months, and in addition a questionnaire survey was carried out on operation frequency of welfare devices. Particularly from the power consumption and the use frequency of the devices to keep warm heat environment for physically handicapped and elderly persons, meaningful findings were obtained from the viewpoint of effective energy utilization, summarized as follows: (1) energy consumption of welfare devices used in care-taking sites in homes is small; (2) the power consumption varies greatly depending on methods to keep the warm heat environment; (3) in the case of discussing residential houses arranged with considerations for elderly people, the warm heat environment is important, and room cooling and warming devices including air conditioners should be included in the category of welfare devices, (4) a proposal was made on structuring a 'system to match elderly persons' physical conditions' intended to make a warm heat environment most suitable for physically handicapped and elderly persons, and (5) a proposal was made on discussing a 'system combining solar cells with large capacity batteries' of effective energy utilization type. (NEDO)

  9. Study of nu-tau properties with the SHiP experiment

    CERN Document Server

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  10. Expression of Ku correlates with radiation sensitivities in the head and neck cancer cell lines

    International Nuclear Information System (INIS)

    Lee, Sang Wook; Yu, Eun Sil; Yi, So Lyoung; Son, Se Hee; Kim, Jong Hoon; Ahn, Seung Do; Shin, Seong Soo; Choi, Eun Kyung

    2004-01-01

    DNA-dependent protein kinase (DNA-PK) is a serine/threonine kinase consisting of a 470 kDa catalytic subunit (DNA-PKcs) and a heterodimeric regulatory complex, called Ku, which is composed of 70 kDa (Ku 70) and 86 kDa (Ku 80) proteins. The DNA-PK has been shown to play a pivotal role in rejoining DNA double-strand-breaks (dsb) in mammalian cells. The purpose of this study is to examine the relationship between the level of Ku expression and radiation sensitivity. Nine head and neck, cancer cell lines showed various intrinsic radiation sensitivities. Among the nine, AMC-HN-3 cell was the most sensitive for X-ray irradiation and AMC-HN-9 cell was the most resistance. The most sensitive and resistant cell lines were selected and the test sensitivity of radiation and expression of Ku were measured. Radiation sensitivity was obtained by colony forming assay and Ku protein expression using Western blot analysis. Ku80 increased expression by radiation, wheras Ku70 did not. Overexpression of Ku80 protein increased radiation resistance in AMC-HN9 cell line. There was a correlation between Ku80 expression and radiation resistance. Ku80 was shown to play an important role in radiation damage response. Induction of Ku80 expression had an important role in DNA damage repair by radiation. Ku80 expression may be an effective predictive assay of radiosensitivity on head and neck cancer

  11. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Science.gov (United States)

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  12. Ku must load directly onto the chromosome end in order to mediate its telomeric functions.

    Directory of Open Access Journals (Sweden)

    Christopher R Lopez

    2011-08-01

    Full Text Available The Ku heterodimer associates with the Saccharomyces cerevisiae telomere, where it impacts several aspects of telomere structure and function. Although Ku avidly binds DNA ends via a preformed channel, its ability to associate with telomeres via this mechanism could be challenged by factors known to bind directly to the chromosome terminus. This has led to uncertainty as to whether Ku itself binds directly to telomeric ends and whether end association is crucial for Ku's telomeric functions. To address these questions, we constructed DNA end binding-defective Ku heterodimers by altering amino acid residues in Ku70 and Ku80 that were predicted to contact DNA. These mutants continued to associate with their known telomere-related partners, such as Sir4, a factor required for telomeric silencing, and TLC1, the RNA component of telomerase. Despite these interactions, we found that the Ku mutants had markedly reduced association with telomeric chromatin and null-like deficiencies for telomere end protection, length regulation, and silencing functions. In contrast to Ku null strains, the DNA end binding defective Ku mutants resulted in increased, rather than markedly decreased, imprecise end-joining proficiency at an induced double-strand break. This result further supports that it was the specific loss of Ku's telomere end binding that resulted in telomeric defects rather than global loss of Ku's functions. The extensive telomere defects observed in these mutants lead us to propose that Ku is an integral component of the terminal telomeric cap, where it promotes a specific architecture that is central to telomere function and maintenance.

  13. Ku must load directly onto the chromosome end in order to mediate its telomeric functions.

    Science.gov (United States)

    Lopez, Christopher R; Ribes-Zamora, Albert; Indiviglio, Sandra M; Williams, Christopher L; Haricharan, Svasti; Bertuch, Alison A

    2011-08-01

    The Ku heterodimer associates with the Saccharomyces cerevisiae telomere, where it impacts several aspects of telomere structure and function. Although Ku avidly binds DNA ends via a preformed channel, its ability to associate with telomeres via this mechanism could be challenged by factors known to bind directly to the chromosome terminus. This has led to uncertainty as to whether Ku itself binds directly to telomeric ends and whether end association is crucial for Ku's telomeric functions. To address these questions, we constructed DNA end binding-defective Ku heterodimers by altering amino acid residues in Ku70 and Ku80 that were predicted to contact DNA. These mutants continued to associate with their known telomere-related partners, such as Sir4, a factor required for telomeric silencing, and TLC1, the RNA component of telomerase. Despite these interactions, we found that the Ku mutants had markedly reduced association with telomeric chromatin and null-like deficiencies for telomere end protection, length regulation, and silencing functions. In contrast to Ku null strains, the DNA end binding defective Ku mutants resulted in increased, rather than markedly decreased, imprecise end-joining proficiency at an induced double-strand break. This result further supports that it was the specific loss of Ku's telomere end binding that resulted in telomeric defects rather than global loss of Ku's functions. The extensive telomere defects observed in these mutants lead us to propose that Ku is an integral component of the terminal telomeric cap, where it promotes a specific architecture that is central to telomere function and maintenance.

  14. Somatic mutation frequency in the stamen hairs of Tradescantia KU 7 and KU 9 clones exposed to low-level gamma rays

    International Nuclear Information System (INIS)

    Ichikawa, S.; Nagashima, C.; Takahashi, C.S.

    1981-01-01

    Two triploid clones (KU 7 and KU 9) of Tradescantia heterozygous for flower color were exposed to 1 to 42.3R of gamma rays or the scattering radiation in the gamma field of the Institute of Radiation . Breeding. Occurrence of somatic pink mutations in the stamen hairs was investigated 10 to 16 (or 14) days after irradiation. The mutation frequency was found to increase linearly with increasing gamma-ray exposure in the both clones, and the frequencies of 0.437 and 0.468 pink mutant events per 10 3 hairs per R were determined for KU 7 and KU 9, respectively. When the data collected in the present study were analyzed together with those obtained in earlier experiments in the gamma field, linear relationships of the somatic mutation frequency with gamma-ray (2.1 to 201.6R) and scattering radiation (0.72 to 57.6R) exposures were confirmed. Scattering radiation was found to have a genetical efficiency more than two times higher than that of gamma rays. Variation of spontaneous mutation frequency observed in the present study and in earlier studies was inversely correlated to temperature variation

  15. Multilayered elastic analysis formulation for surface moment loading

    CSIR Research Space (South Africa)

    Maina, JW

    2006-01-01

    Full Text Available Denki University Hatoyama-Cho, Hiki-Gun, Saitama 350-0394, JAPAN Tel.: +81-492-96-2911 Fax: +81-492-96-6501 fkiyo@g.dendai.ac.jp Kunihito Matsui Professor Dept. of Civil and Environmental Engineering, Tokyo Denki University Hatoyama-Cho, Hiki...-Gun, Saitama 350-0394, JAPAN Tel.: +81-492-96-2911 Fax: +81-492-96-6501 matsui@g.dendai.ac.jp Takemi Inoue Executive Managing Director NIPPO Corporation 19-11 Kyobashi 1-Chome. Chuo-Ku, Tokyo 104-8380, JAPAN Tel.: +81-3-3563-6760 Fax: +81...

  16. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Science.gov (United States)

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  17. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Directory of Open Access Journals (Sweden)

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  18. Five-year outcomes of pars plana vitrectomy for macular edema associated with branch retinal vein occlusion

    Directory of Open Access Journals (Sweden)

    Nishida A

    2017-02-01

    Full Text Available Akihiro Nishida,1,2 Hiroshi Kojima,1,2 Takanori Kameda,1,2 Michiko Mandai,1,3 Yasuo Kurimoto1,2 1Department of Ophthalmology, Kobe City Medical Center General Hospital, 2Department of Ophthalmology, Institute of Biomedical Research and Innovation, 3Laboratory for Retinal Regeneration, RIKEN Center for Developmental Biology, Chuo-ku, Kobe, Hyogo, Japan Purpose: Long-term outcomes of pars plana vitrectomy (PPV for macular edema (ME associated with branch retinal vein occlusion (BRVO have been previously reported, but the studies did not report the number of additional treatments after surgery. During 5 years of follow-up, we therefore investigated the efficacy and safety of PPV for BRVO and evaluated the incidence of additional treatments. Methods: We retrospectively reviewed the medical records of 25 eyes of 24 patients who underwent PPV for ME associated with BRVO and were followed up for at least 5 years. Best-corrected visual acuity was measured, and foveal thickness was assessed by optical coherence tomography. Additional treatments were also investigated. Results: The logarithm of the minimal angle of resolution (logMAR improved from 0.53±0.23 at baseline to 0.16±0.25 at 5 years (P<0.0001. The foveal thickness decreased from 535±222 µm at baseline to 205±143 µm at 5 years (P<0.0001. For the eyes with residual ME, the following additional treatments were performed within 5 years of follow-up: sub-Tenon injection of triamcinolone acetonide in two eyes, intravitreal injection of bevacizumab in three eyes, grid laser photocoagulation in one eye, and direct photocoagulation of macroaneurysm in one eye. Additional surgeries were performed in two eyes: for one eye, phacoemulsification extraction of the ocular lens and intraocular lens implantation were performed because of cataract progression, and for the other eye, additional PPV was done for postoperative retinal detachment. Conclusion: PPV was effective for resolution of ME

  19. The Ku80 carboxy terminus stimulates joining and artemis-mediated processing of DNA ends

    DEFF Research Database (Denmark)

    Weterings, Eric; Verkaik, Nicole S; Keijzers, Guido

    2008-01-01

    Repair of DNA double-strand breaks (DSBs) is predominantly mediated by nonhomologous end joining (NHEJ) in mammalian cells. NHEJ requires binding of the Ku70-Ku80 heterodimer (Ku70/80) to the DNA ends and subsequent recruitment of the DNA-dependent protein kinase catalytic subunit (DNA-PK(CS)) an......Repair of DNA double-strand breaks (DSBs) is predominantly mediated by nonhomologous end joining (NHEJ) in mammalian cells. NHEJ requires binding of the Ku70-Ku80 heterodimer (Ku70/80) to the DNA ends and subsequent recruitment of the DNA-dependent protein kinase catalytic subunit (DNA......-PK(CS)) and the XRCC4/ligase IV complex. Activation of the DNA-PK(CS) serine/threonine kinase requires an interaction with Ku70/80 and is essential for NHEJ-mediated DSB repair. In contrast to previous models, we found that the carboxy terminus of Ku80 is not absolutely required for the recruitment and activation...... was phosphorylated to normal levels. This resulted in severely reduced levels of Artemis nuclease activity in vivo and in vitro. We therefore conclude that the Ku80 carboxy terminus is important to support DNA-PK(CS) autophosphorylation at specific sites, which facilitates DNA end processing by the Artemis...

  20. Expression of Ku70 predicts results of radiotherapy in prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Tomokazu; Someya, Masanori; Hori, Masakazu; Nakata, Kensei; Kitagawa, Mio; Tsuchiya, Takaaki; Sakata, Koh-ichi [Sapporo Medical University School of medicine, Department of Radiology, Chuo-ku, Sapporo, Hokkaido (Japan); Matsumoto, Yoshihisa [Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, Meguro-ku, Tokyo (Japan); Nojima, Masanori [The University of Tokyo, The Institute of Medical Science Hospital, Minatoku, Tokyo (Japan); Masumori, Naoya [Sapporo Medical University School of medicine, Department of Urology, Chuo-ku, Sapporo, Hokkaido (Japan); Hasegawa, Tadashi [Sapporo Medical University School of medicine, Department of Surgical Pathology, Chuo-ku, Sapporo, Hokkaido (Japan)

    2017-01-15

    Therapeutic strategy for prostate cancer is decided according to T stage, Gleason score, and prostate-specific antigen (PSA) level. These clinical factors are not accurate enough to predict individual risk of local failure of prostate cancer after radiotherapy. Parameters involved with radiosensitivity are required to improve the predictive capability for local relapse. We analyzed 58 patients with localized adenocarcinoma of the prostate between August 2007 and October 2010 treated with 76 Gy of intensity-modulated radiotherapy (IMRT) as a discovery cohort and 42 patients between March 2001 and May 2007 treated with three-dimensional conformal radiotherapy (3D-CRT) as a validation cohort. Immunohistochemical examination for proteins involved in nonhomologous end-joining was performed using biopsy specimens. Ku70 expression was not correlated with various clinical parameters, such as the Gleason score and D'amico risk classification, indicating that Ku70 expression was an independent prognostic factor. The predictive value for PSA relapse was markedly improved after the combination of Gleason score and Ku70 expression, as compared with Gleason score alone. In patients treated with radiotherapy and androgen deprivation therapy (ADT), no relapses were observed in patients with Gleason score ≤7 or low Ku70 expression. In contrast, patients with Gleason score ≥8 and high Ku70 expression had high PSA relapse rates. In the validation cohort, similar results were obtained. Treatment with 76 Gy and ADT can be effective for patients with Gleason score ≤7 or low Ku70 expression, but is not enough for patients with Gleason score ≥8 and high Ku70 expression and, thus, require other treatment approaches. (orig.) [German] Die Behandlung beim Prostatakarzinom ist abhaengig von T-Stadium, Gleason-Score und prostataspezifischem Antigen (PSA). Diese klinischen Faktoren sind jedoch zu ungenau, um das individuelle Lokalrezidivrisiko beim Prostatakarzinom nach

  1. Mycobacterium tuberculosis Ku can bind to nuclear DNA damage and sensitize mammalian cells to bleomycin sulfate.

    Science.gov (United States)

    Castore, Reneau; Hughes, Cameron; Debeaux, Austin; Sun, Jingxin; Zeng, Cailing; Wang, Shih-Ya; Tatchell, Kelly; Shi, Runhua; Lee, Kyung-Jong; Chen, David J; Harrison, Lynn

    2011-11-01

    Radiotherapy and chemotherapy are effective cancer treatments due to their ability to generate DNA damage. The major lethal lesion is the DNA double-strand break (DSB). Human cells predominantly repair DSBs by non-homologous end joining (NHEJ), which requires Ku70, Ku80, DNA-PKcs, DNA ligase IV and accessory proteins. Repair is initiated by the binding of the Ku heterodimer at the ends of the DSB and this recruits DNA-PKcs, which initiates damage signaling and functions in repair. NHEJ also exists in certain types of bacteria that have dormant phases in their life cycle. The Mycobacterium tuberculosis Ku (Mt-Ku) resembles the DNA-binding domain of human Ku but does not have the N- and C-terminal domains of Ku70/80 that have been implicated in binding mammalian NHEJ repair proteins. The aim of this work was to determine whether Mt-Ku could be used as a tool to bind DSBs in mammalian cells and sensitize cells to DNA damage. We generated a fusion protein (KuEnls) of Mt-Ku, EGFP and a nuclear localization signal that is able to perform bacterial NHEJ and hence bind DSBs. Using transient transfection, we demonstrated that KuEnls is able to bind laser damage in the nucleus of Ku80-deficient cells within 10 sec and remains bound for up to 2 h. The Mt-Ku fusion protein was over-expressed in U2OS cells and this increased the sensitivity of the cells to bleomycin sulfate. Hydrogen peroxide and UV radiation do not predominantly produce DSBs and there was little or no change in sensitivity to these agents. Since in vitro studies were unable to detect binding of Mt-Ku to DNA-PKcs or human Ku70/80, this work suggests that KuEnls sensitizes cells by binding DSBs, preventing human NHEJ. This study indicates that blocking or decreasing the binding of human Ku to DSBs could be a method for enhancing existing cancer treatments.

  2. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Science.gov (United States)

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  3. Discrete Scaling in Earthquake Precursory Phenomena: Evidence in the Kobe Earthquake, Japan

    Science.gov (United States)

    Johansen, Anders; Sornette, Didier; Wakita, Hiroshi; Tsunogai, Urumu; Newman, William I.; Saleur, Hubert

    1996-10-01

    We analyze the ion concentration of groundwater issuing from deep wells located near the epicenter of the recent earthquake of magnitude 6.9 near Kobe, Japan, on January 17, 1995. These concentrations are well fitted by log-periodic modulations around a leading power law. The exponent (real and imaginary parts) is very close to those already found for the fits of precursory seismic activity for Loma Prieta and the Aleutian Islands. This brings further support for the general hypothesis that complex critical exponents are a general phenomenon in irreversible self-organizing systems and particularly in rupture and earthquake phenomena. Nous analysons les fluctuations de concentrations ioniques de l'eau issue de puits profonds situés à proximité de l'épicentre du récent tremblement de terre de magnitude 6.9 proche de Kobe au Japon, le 17 janvier 1995. Ces fluctuations sont bien reproduites par des modulations log-périodiques autour d'une loi de puissance. Les parties réelle et imaginaire de l'exposant sont très proches de celles trouvées précédemment pour les tremblements de terre de Loma Prieta et des Iles Aléoutiennes. Ces résultats renforcent l'hypothèse que des exposants critiques complexes sont une propriété générale des phénomènes de croissance irréversible, et en particulier des problèmes de rupture et des tremblements de terre.

  4. Deletion of individual Ku subunits in mice causes an NHEJ-independent phenotype potentially by altering apurinic/apyrimidinic site repair.

    Directory of Open Access Journals (Sweden)

    Yong Jun Choi

    Full Text Available Ku70 and Ku80 form a heterodimer called Ku that forms a holoenzyme with DNA dependent-protein kinase catalytic subunit (DNA-PKCS to repair DNA double strand breaks (DSBs through the nonhomologous end joining (NHEJ pathway. As expected mutating these genes in mice caused a similar DSB repair-defective phenotype. However, ku70(-/- cells and ku80(-/- cells also appeared to have a defect in base excision repair (BER. BER corrects base lesions, apurinic/apyrimidinic (AP sites and single stand breaks (SSBs utilizing a variety of proteins including glycosylases, AP endonuclease 1 (APE1 and DNA Polymerase β (Pol β. In addition, deleting Ku70 was not equivalent to deleting Ku80 in cells and mice. Therefore, we hypothesized that free Ku70 (not bound to Ku80 and/or free Ku80 (not bound to Ku70 possessed activity that influenced BER. To further test this hypothesis we performed two general sets of experiments. The first set showed that deleting either Ku70 or Ku80 caused an NHEJ-independent defect. We found ku80(-/- mice had a shorter life span than dna-pkcs(-/- mice demonstrating a phenotype that was greater than deleting the holoenzyme. We also found Ku70-deletion induced a p53 response that reduced the level of small mutations in the brain suggesting defective BER. We further confirmed that Ku80-deletion impaired BER via a mechanism that was not epistatic to Pol β. The second set of experiments showed that free Ku70 and free Ku80 could influence BER. We observed that deletion of either Ku70 or Ku80, but not both, increased sensitivity of cells to CRT0044876 (CRT, an agent that interferes with APE1. In addition, free Ku70 and free Ku80 bound to AP sites and in the case of Ku70 inhibited APE1 activity. These observations support a novel role for free Ku70 and free Ku80 in altering BER.

  5. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Science.gov (United States)

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  6. Preclinical evaluation of (111)In-DTPA-INCA-X anti-Ku70/Ku80 monoclonal antibody in prostate cancer.

    Science.gov (United States)

    Evans-Axelsson, Susan; Vilhelmsson Timmermand, Oskar; Welinder, Charlotte; Borrebaeck, Carl Ak; Strand, Sven-Erik; Tran, Thuy A; Jansson, Bo; Bjartell, Anders

    2014-01-01

    The aim of this investigation was to assess the Ku70/Ku80 complex as a potential target for antibody imaging of prostate cancer. We evaluated the in vivo and ex vivo tumor targeting and biodistribution of the (111)In-labeled human internalizing antibody, INCA-X ((111)In-DTPA-INCA-X antibody), in NMRI-nude mice bearing human PC-3, PC-3M-Lu2 or DU145 xenografts. DTPA-conjugated, non-labeled antibody was pre-administered at different time-points followed by a single intravenous injection of (111)In-DTPA-INCA-X. At 48, 72 and 96 h post-injection, tissues were harvested, and the antibody distribution was determined by measuring radioactivity. Preclinical SPECT/CT imaging of mice with and without the predose was performed at 48 hours post-injection of labeled DTPA-INCA-X. Biodistribution of the labeled antibody showed enriched activity in tumor, spleen and liver. Animals pre-administered with DTPA-INCA-X showed increased tumor uptake and blood content of (111)In-DTPA-INCA-X with reduced splenic and liver uptake. The in vitro and in vivo data presented show that the (111)In-labeled INCA-X antibody is internalized into prostate cancer cells and by pre-administering non-labeled DTPA-INCA-X, we were able to significantly reduce the off target binding and increase the (111)In-DTPA-INCA-X mAb uptake in PC-3, PC-3M-Lu2 and DU145 xenografts. The results are encouraging and identifying the Ku70/Ku80 antigen as a target is worth further investigation for functional imaging of prostate cancer.

  7. Preclinical evaluation of 111In-DTPA-INCA-X anti-Ku70/Ku80 monoclonal antibody in prostate cancer

    Science.gov (United States)

    Evans-Axelsson, Susan; Vilhelmsson Timmermand, Oskar; Welinder, Charlotte; Borrebaeck, Carl AK; Strand, Sven-Erik; Tran, Thuy A; Jansson, Bo; Bjartell, Anders

    2014-01-01

    The aim of this investigation was to assess the Ku70/Ku80 complex as a potential target for antibody imaging of prostate cancer. We evaluated the in vivo and ex vivo tumor targeting and biodistribution of the 111In-labeled human internalizing antibody, INCA-X (111In-DTPA-INCA-X antibody), in NMRI-nude mice bearing human PC-3, PC-3M-Lu2 or DU145 xenografts. DTPA-conjugated, non-labeled antibody was pre-administered at different time-points followed by a single intravenous injection of 111In-DTPA-INCA-X. At 48, 72 and 96 h post-injection, tissues were harvested, and the antibody distribution was determined by measuring radioactivity. Preclinical SPECT/CT imaging of mice with and without the predose was performed at 48 hours post-injection of labeled DTPA-INCA-X. Biodistribution of the labeled antibody showed enriched activity in tumor, spleen and liver. Animals pre-administered with DTPA-INCA-X showed increased tumor uptake and blood content of 111In-DTPA-INCA-X with reduced splenic and liver uptake. The in vitro and in vivo data presented show that the 111In-labeled INCA-X antibody is internalized into prostate cancer cells and by pre-administering non-labeled DTPA-INCA-X, we were able to significantly reduce the off target binding and increase the 111In-DTPA-INCA-X mAb uptake in PC-3, PC-3M-Lu2 and DU145 xenografts. The results are encouraging and identifying the Ku70/Ku80 antigen as a target is worth further investigation for functional imaging of prostate cancer. PMID:24982817

  8. Variation in radon exhalation from the ground on the active fault in Kobe

    Energy Technology Data Exchange (ETDEWEB)

    Yasuoka, Y.; Shinogi, M. [Kobe Pharmaceutical Univ., Kobe, Hyogo (Japan)

    1998-12-31

    Since 27 January 1997, the measurements of radon (Rn-222) exhaled from the ground have been made continuously by the use of PICO-RAD detector (Packard instrument Co.) at monitoring stations on Ashiya active fault. The fault may have been slipped by the Kobe earthquake (magnitude 7.2, 17 January 1995). The variation of relative radon exhalation on the fault was large. We guessed the large variation of relative radon exhalation on the fault was caused by not only the influence of meteorology but also the influence of other factors. (author)

  9. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  10. Ku recruits XLF to DNA double-strand breaks.

    Science.gov (United States)

    Yano, Ken-ichi; Morotomi-Yano, Keiko; Wang, Shih-Ya; Uematsu, Naoya; Lee, Kyung-Jong; Asaithamby, Aroumougame; Weterings, Eric; Chen, David J

    2008-01-01

    XRCC4-like factor (XLF)--also known as Cernunnos--has recently been shown to be involved in non-homologous end-joining (NHEJ), which is the main pathway for the repair of DNA double-strand breaks (DSBs) in mammalian cells. XLF is likely to enhance NHEJ by stimulating XRCC4-ligase IV-mediated joining of DSBs. Here, we report mechanistic details of XLF recruitment to DSBs. Live cell imaging combined with laser micro-irradiation showed that XLF is an early responder to DSBs and that Ku is essential for XLF recruitment to DSBs. Biochemical analysis showed that Ku-XLF interaction occurs on DNA and that Ku stimulates XLF binding to DNA. Unexpectedly, XRCC4 is dispensable for XLF recruitment to DSBs, although photobleaching analysis showed that XRCC4 stabilizes the binding of XLF to DSBs. Our observations showed the direct involvement of XLF in the dynamic assembly of the NHEJ machinery and provide mechanistic insights into DSB recognition.

  11. RECQ HELICASE RECQL4 PARTICIPATES IN NON-HOMOLOGOUS END JOINING AND INTERACTS WITH THE KU COMPLEX

    DEFF Research Database (Denmark)

    Shamanna, Raghavendra A; Singh, Dharmendra Kumar; Lu, Huiming

    2014-01-01

    -irradiation and resulted in accumulation of 53BP1 foci after irradiation, indicating defects in the processing of DSB. We find that RECQL4 interacts with the Ku70/Ku80 heterodimer, part of the DNA-dependent protein kinase (DNA-PK) complex, via its N-terminal domain. Further, RECQL4 stimulates higher order DNA binding...... of Ku70/Ku80 to a blunt end DNA substrate. Taken together, these results implicate that RECQL4 participates in the NHEJ pathway of DSB repair via a functional interaction with the Ku70/Ku80 complex. This is the first study to provide both in vitro and in vivo evidence for a role of a RecQ helicase...

  12. Construction of cell model of silenced Ku80 and the radiobiology change of HeLa cell

    International Nuclear Information System (INIS)

    Zhuang Liang; Yu Shiying; Huang Xiaoyuan; Xiong Huihua; Xiong Hua; Li Xiaolan; Leng Yan

    2007-01-01

    Objective: To construct the cell model of Ku80 with expression inhibited by siRNA and to explore the role of Ku80 in radiobiology. Methods: Ku80-siRNA expression plasmids were constructed and HeLa cells were transfected with these plasmids by lipofectamine. Western blotting was used to measure the expression of Ku80. After irradiation with 6 MV X ray, cells were collected and analyzed by flow cytometry for apoptosis and cell cycle at 24, 48 and 72 h; The radiobiology parameters of four cell lines were acquired by clone formation array. Results: Three stable transfected cell clones were obtained, and the inhibition rates of Ku80 protein expression of two positive clones were 89.3% and 96.4%; The apoptosis rates of HeLa cells Ku80 inhibited were higher than control cells at 48 and 72 after X ray irradiation (P 0.05). HeLa cells of silenced Ku80 had lower SF 2 and D 0 than control cells, and their SER (sensitization enhancement ratio) based on D 10 were 1.315 and 1.365, respectively. Conclusions: The HeLa cell models with Ku80 expression suppressed were successfully established; the inhibition of Ku80 by siRNA could enhance the radiosensitivity of HeLa cells. (authors)

  13. The Ku80 carboxy terminus stimulates joining and artemis-mediated processing of DNA ends.

    Science.gov (United States)

    Weterings, Eric; Verkaik, Nicole S; Keijzers, Guido; Florea, Bogdan I; Wang, Shih-Ya; Ortega, Laura G; Uematsu, Naoya; Chen, David J; van Gent, Dik C

    2009-03-01

    Repair of DNA double-strand breaks (DSBs) is predominantly mediated by nonhomologous end joining (NHEJ) in mammalian cells. NHEJ requires binding of the Ku70-Ku80 heterodimer (Ku70/80) to the DNA ends and subsequent recruitment of the DNA-dependent protein kinase catalytic subunit (DNA-PK(CS)) and the XRCC4/ligase IV complex. Activation of the DNA-PK(CS) serine/threonine kinase requires an interaction with Ku70/80 and is essential for NHEJ-mediated DSB repair. In contrast to previous models, we found that the carboxy terminus of Ku80 is not absolutely required for the recruitment and activation of DNA-PK(CS) at DSBs, although cells that harbored a carboxy-terminal deletion in the Ku80 gene were sensitive to ionizing radiation and showed reduced end-joining capacity. More detailed analysis of this repair defect showed that DNA-PK(CS) autophosphorylation at Thr2647 was diminished, while Ser2056 was phosphorylated to normal levels. This resulted in severely reduced levels of Artemis nuclease activity in vivo and in vitro. We therefore conclude that the Ku80 carboxy terminus is important to support DNA-PK(CS) autophosphorylation at specific sites, which facilitates DNA end processing by the Artemis endonuclease and the subsequent joining reaction.

  14. The Ku80 Carboxy Terminus Stimulates Joining and Artemis-Mediated Processing of DNA Ends▿

    Science.gov (United States)

    Weterings, Eric; Verkaik, Nicole S.; Keijzers, Guido; Florea, Bogdan I.; Wang, Shih-Ya; Ortega, Laura G.; Uematsu, Naoya; Chen, David J.; van Gent, Dik C.

    2009-01-01

    Repair of DNA double-strand breaks (DSBs) is predominantly mediated by nonhomologous end joining (NHEJ) in mammalian cells. NHEJ requires binding of the Ku70-Ku80 heterodimer (Ku70/80) to the DNA ends and subsequent recruitment of the DNA-dependent protein kinase catalytic subunit (DNA-PKCS) and the XRCC4/ligase IV complex. Activation of the DNA-PKCS serine/threonine kinase requires an interaction with Ku70/80 and is essential for NHEJ-mediated DSB repair. In contrast to previous models, we found that the carboxy terminus of Ku80 is not absolutely required for the recruitment and activation of DNA-PKCS at DSBs, although cells that harbored a carboxy-terminal deletion in the Ku80 gene were sensitive to ionizing radiation and showed reduced end-joining capacity. More detailed analysis of this repair defect showed that DNA-PKCS autophosphorylation at Thr2647 was diminished, while Ser2056 was phosphorylated to normal levels. This resulted in severely reduced levels of Artemis nuclease activity in vivo and in vitro. We therefore conclude that the Ku80 carboxy terminus is important to support DNA-PKCS autophosphorylation at specific sites, which facilitates DNA end processing by the Artemis endonuclease and the subsequent joining reaction. PMID:19103741

  15. Traffic supervisory/control system for Kobe-Awaji- Naruto expressway of Honshu-Shikoku Bridge Authority; Honshu Shikoku Renrakukyo Kodan nonyu no Kobe Awaji Naruto jidoshado kotsu kansei shisetsu seigyo system

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Toshiba delivered the traffic supervisory/control system for Kobe-Awaji-Naruto expressway of Honshu-Shikoku Bridge Authority opened in May 1998. This traffic supervisory system rapidly exactly collects and services the information on the expressway of 89km including Akashi Kaikyo bridge and O-Naruto bridge. The facility control system totally efficiently maintains and controls various facilities for lighting and air circulation of tunnels on the expressway. The previous control system transmitted road information on traffic volume and traffic congestion to offices by using specific lines and terminals, while this system with a monitoring function using intranet can easily service such information by existing PCs. (translated by NEDO)

  16. Traffic supervisory/control system for Kobe-Awaji- Naruto expressway of Honshu-Shikoku Bridge Authority. Honshu Shikoku Renrakukyo Kodan nonyu no Kobe Awaji Naruto jidoshado kotsu kansei shisetsu seigyo system

    Energy Technology Data Exchange (ETDEWEB)

    1999-03-01

    Toshiba delivered the traffic supervisory/control system for Kobe-Awaji-Naruto expressway of Honshu-Shikoku Bridge Authority opened in May 1998. This traffic supervisory system rapidly exactly collects and services the information on the expressway of 89km including Akashi Kaikyo bridge and O-Naruto bridge. The facility control system totally efficiently maintains and controls various facilities for lighting and air circulation of tunnels on the expressway. The previous control system transmitted road information on traffic volume and traffic congestion to offices by using specific lines and terminals, while this system with a monitoring function using intranet can easily service such information by existing PCs. (translated by NEDO)

  17. ν{sub τ}-physics with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  18. The Ku Heterodimer and the Metabolism of Single-Ended DNA Double-Strand Breaks

    Directory of Open Access Journals (Sweden)

    Alessia Balestrini

    2013-06-01

    Full Text Available Single-ended double-strand breaks (DSBs are a common form of spontaneous DNA break, generated when the replisome encounters a discontinuity in the DNA template. Given their prevalence, understanding the mechanisms governing the fate(s of single-ended DSBs is important. We describe the influence of the Ku heterodimer and Mre11 nuclease activity on processing of single-ended DSBs. Separation-of-function alleles of yku70 were derived that phenocopy Ku deficiency with respect to single-ended DSBs but remain proficient for NHEJ. The Ku mutants fail to regulate Exo1 activity, and bypass the requirement for Mre11 nuclease activity in the repair of camptothecin-induced single-ended DSBs. Ku mutants exhibited reduced affinity for DNA ends, manifest as both reduced end engagement and enhanced probability of diffusing inward on linear DNA. This study reveals an interplay between Ku and Mre11 in the metabolism of single-ended DSBs that is distinct from repair pathway choice at double-ended DSBs.

  19. Ku proteins function as corepressors to regulate farnesoid X receptor-mediated gene expression

    International Nuclear Information System (INIS)

    Ohno, Masae; Kunimoto, Masaaki; Nishizuka, Makoto; Osada, Shigehiro; Imagawa, Masayoshi

    2009-01-01

    The farnesoid X receptor (FXR; NR1H4) is a member of the nuclear receptor superfamily and regulates the expression of genes involved in enterohepatic circulation and the metabolism of bile acids. Based on functional analyses, nuclear receptors are divided into regions A-F. To explore the cofactors interacting with FXR, we performed a pull-down assay using GST-fused to the N-terminal A/B region and the C region, which are required for the ligand-independent transactivation and DNA-binding, respectively, of FXR, and nuclear extracts from HeLa cells. We identified DNA-dependent protein kinase catalytic subunit (DNA-PKcs), Ku80, and Ku70 as FXR associated factors. These proteins are known to have an important role in DNA repair, recombination, and transcription. DNA-PKcs mainly interacted with the A/B region of FXR, whereas the Ku proteins interacted with the C region and with the D region (hinge region). Chromatin immunoprecipitation assays revealed that the Ku proteins associated with FXR on the bile salt export pump (BSEP) promoter. Furthermore, we demonstrated that ectopic expression of the Ku proteins decreased the promoter activity and expression of BSEP gene mediated by FXR. These results suggest that the Ku proteins function as corepressors for FXR.

  20. Design of a detector to study associated charm production in the SHiP beam dump facility

    CERN Document Server

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  1. The Ku heterodimer and the metabolism of single-ended DNA double-strand breaks.

    Science.gov (United States)

    Balestrini, Alessia; Ristic, Dejan; Dionne, Isabelle; Liu, Xiao Z; Wyman, Claire; Wellinger, Raymund J; Petrini, John H J

    2013-06-27

    Single-ended double-strand breaks (DSBs) are a common form of spontaneous DNA break, generated when the replisome encounters a discontinuity in the DNA template. Given their prevalence, understanding the mechanisms governing the fate(s) of single-ended DSBs is important. We describe the influence of the Ku heterodimer and Mre11 nuclease activity on processing of single-ended DSBs. Separation-of-function alleles of yku70 were derived that phenocopy Ku deficiency with respect to single-ended DSBs but remain proficient for NHEJ. The Ku mutants fail to regulate Exo1 activity, and bypass the requirement for Mre11 nuclease activity in the repair of camptothecin-induced single-ended DSBs. Ku mutants exhibited reduced affinity for DNA ends, manifest as both reduced end engagement and enhanced probability of diffusing inward on linear DNA. This study reveals an interplay between Ku and Mre11 in the metabolism of single-ended DSBs that is distinct from repair pathway choice at double-ended DSBs. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

  2. Engineering of E. coli for increased production of L- lactic acid

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-15

    Sep 15, 2009 ... Wakamatsu-ku, Kitakyushu-shi, Fukuoka, Japan. Accepted 11 ... was cloned into pBAD vector and transformed into E. coli SZ85 by electroporation. SDS-page and ..... replacement. In the first construct, the internal promoter.

  3. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    CERN Document Server

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  4. DNA-PK/Ku complex binds to latency-associated nuclear antigen and negatively regulates Kaposi's sarcoma-associated herpesvirus latent replication

    International Nuclear Information System (INIS)

    Cha, Seho; Lim, Chunghun; Lee, Jae Young; Song, Yoon-Jae; Park, Junsoo; Choe, Joonho; Seo, Taegun

    2010-01-01

    During latent infection, latency-associated nuclear antigen (LANA) of Kaposi's sarcoma-associated herpesvirus (KSHV) plays important roles in episomal persistence and replication. Several host factors are associated with KSHV latent replication. Here, we show that the catalytic subunit of DNA protein kinase (DNA-PKcs), Ku70, and Ku86 bind the N-terminal region of LANA. LANA was phosphorylated by DNA-PK and overexpression of Ku70, but not Ku86, impaired transient replication. The efficiency of transient replication was significantly increased in the HCT116 (Ku86 +/-) cell line, compared to the HCT116 (Ku86 +/+) cell line, suggesting that the DNA-PK/Ku complex negatively regulates KSHV latent replication.

  5. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Science.gov (United States)

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  6. Alternaria Leaf Spot on Mealycup Sage (Salvia farinacea Benth.) Caused by Alternaria alternata (Fr.) Keissler

    OpenAIRE

    Hiromitsu, NEGISHI; Kazuo, SUYAMA; Faculty of Agriculture,Tokyo University of Agriculture; Faculty of Agriculture,Tokyo University of Agriculture

    2002-01-01

    In June 1995, a disease causing round to irregular-shaped, water-soaked, brown to blackish brown spots on mealycup sage (Salvia farinacea Benth.) was found in Atsugi-shi, Kanagawa Prefecture, Japan. The symptoms were seen only on leaves, not on neither flower petals or stems. The disease was also found in Setagaya-ku, Tokyo, Memambetsu-cho, Hokkaido and Shimoda-shi and Matsuzaki-cho, Shizuoka. An Alternaria sp. was frequently isolated from these diseased plants. The isolates were severely pat...

  7. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    Directory of Open Access Journals (Sweden)

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  8. Airborn Ku-band polarimetric radar remote sensing of terrestrial snow cover

    Science.gov (United States)

    Simon H. Yueh; Steve J. Dinardo; Ahmed Akgiray; Richard West; Donald W. Cline; Kelly Elder

    2009-01-01

    Characteristics of the Ku-band polarimetric scatterometer (POLSCAT) data acquired from five sets of aircraft flights in the winter months of 2006-2008 for the second Cold Land Processes Experiment (CLPX-II) in Colorado are described in this paper. The data showed the response of the Ku-band radar echoes to snowpack changes for various types of background vegetation in...

  9. Drosophila UTX coordinates with p53 to regulate ku80 expression in response to DNA damage.

    Directory of Open Access Journals (Sweden)

    Chengwan Zhang

    Full Text Available UTX is known as a general factor that activates gene transcription during development. Here, we demonstrate an additional essential role of UTX in the DNA damage response, in which it upregulates the expression of ku80 in Drosophila, both in cultured cells and in third instar larvae. We further showed that UTX mediates the expression of ku80 by the demethylation of H3K27me3 at the ku80 promoter upon exposure to ionizing radiation (IR in a p53-dependent manner. UTX interacts physically with p53, and both UTX and p53 are recruited to the ku80 promoter following IR exposure in an interdependent manner. In contrast, the loss of utx has little impact on the expression of ku70, mre11, hid and reaper, suggesting the specific regulation of ku80 expression by UTX. Thus, our findings further elucidate the molecular function of UTX.

  10. C-terminal low-complexity sequence repeats of Mycobacterium smegmatis Ku modulate DNA binding.

    Science.gov (United States)

    Kushwaha, Ambuj K; Grove, Anne

    2013-01-24

    Ku protein is an integral component of the NHEJ (non-homologous end-joining) pathway of DSB (double-strand break) repair. Both eukaryotic and prokaryotic Ku homologues have been characterized and shown to bind DNA ends. A unique feature of Mycobacterium smegmatis Ku is its basic C-terminal tail that contains several lysine-rich low-complexity PAKKA repeats that are absent from homologues encoded by obligate parasitic mycobacteria. Such PAKKA repeats are also characteristic of mycobacterial Hlp (histone-like protein) for which they have been shown to confer the ability to appose DNA ends. Unexpectedly, removal of the lysine-rich extension enhances DNA-binding affinity, but an interaction between DNA and the PAKKA repeats is indicated by the observation that only full-length Ku forms multiple complexes with a short stem-loop-containing DNA previously designed to accommodate only one Ku dimer. The C-terminal extension promotes DNA end-joining by T4 DNA ligase, suggesting that the PAKKA repeats also contribute to efficient end-joining. We suggest that low-complexity lysine-rich sequences have evolved repeatedly to modulate the function of unrelated DNA-binding proteins.

  11. Shuttle orbiter Ku-band radar/communications system design evaluation. Deliverable test equipment evaluation

    Science.gov (United States)

    Maronde, R. G.

    1980-07-01

    The Ku-band test equipment, known as the Deliverable System Test equipment (DSTE), is reviewed and evaluated. The DSTE is semiautomated and computer programs were generated for 14 communication mode tests and 17 radar mode tests. The 31 test modules provide a good cross section of tests with which to exercise the Ku-band system; however, it is very limited when being used to verify Ku-band system performance. More detailed test descriptions are needed, and a major area of concern is the DSTE sell-off procedure which is inadequate.

  12. Improving DNA double-strand repair inhibitor KU55933 therapeutic index in cancer radiotherapy using nanoparticle drug delivery

    Science.gov (United States)

    Tian, Xi; Lara, Haydee; Wagner, Kyle T.; Saripalli, Srinivas; Hyder, Syed Nabeel; Foote, Michael; Sethi, Manish; Wang, Edina; Caster, Joseph M.; Zhang, Longzhen; Wang, Andrew Z.

    2015-11-01

    Radiotherapy is a key component of cancer treatment. Because of its importance, there has been high interest in developing agents and strategies to further improve the therapeutic index of radiotherapy. DNA double-strand repair inhibitors (DSBRIs) are among the most promising agents to improve radiotherapy. However, their clinical translation has been limited by their potential toxicity to normal tissue. Recent advances in nanomedicine offer an opportunity to overcome this limitation. In this study, we aim to demonstrate the proof of principle by developing and evaluating nanoparticle (NP) formulations of KU55933, a DSBRI. We engineered a NP formulation of KU55933 using nanoprecipitation method with different lipid polymer nanoparticle formulation. NP KU55933 using PLGA formulation has the best loading efficacy as well as prolonged drug release profile. We demonstrated that NP KU55933 is a potent radiosensitizer in vitro using clonogenic assay and is more effective as a radiosensitizer than free KU55933 in vivo using mouse xenograft models of non-small cell lung cancer (NSCLC). Western blots and immunofluorescence showed NP KU55933 exhibited more prolonged inhibition of DNA repair pathway. In addition, NP KU55933 leads to lower skin toxicity than KU55933. Our study supports further investigations using NP to deliver DSBRIs to improve cancer radiotherapy treatment.

  13. Development of intense terahertz coherent synchrotron radiation at KU-FEL

    Energy Technology Data Exchange (ETDEWEB)

    Sei, Norihiro, E-mail: sei.n@aist.go.jp [Research Institute for Measurement and Analytical Instrumentation, National Institute of Advanced Industrial Science and Technology, 1-1-1 Umezono, Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Zen, Heishun; Ohgaki, Hideaki [Institute for Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan)

    2016-10-01

    We produced intense coherent synchrotron radiation (CSR) in the terahertz (THz) region using an S-band linac at the Kyoto University Free Electron Laser (KU-FEL), which is a mid-infrared free-electron laser facility. The CSR beam was emitted from short-pulse electron bunches compressed by a 180° arc, and was transferred to air at a large solid angle of 0.10 rad. The measured CSR energy was 55 μJ per 7 μs macropulse, and KU-FEL was one of the most powerful CSR sources in normal conducting linear accelerator facilities. The CSR spectra were measured using an uncooled pyroelectric detector and a Michelson-type interferometer designed specifically for the KU-FEL electron beam, and had a maximum at a frequency of 0.11 THz. We found that adjusting the energy slit enhanced the CSR energy and shortened the electron beam bunch length in the CSR spectra measurements. Our results demonstrated that the efficient use of the energy slit can help improve the characteristics of CSR. - Highlights: • We have developed intense coherent synchrotron radiation (CSR) at KU-FEL. • The elevation angle of the CSR was correctly measured by a new technique. • The CSR power extracted to the air was 55 μJ per 7 μs macropulse. • It was demonstrated that an energy slit was effective to improve the CSR properties.

  14. Development of intense terahertz coherent synchrotron radiation at KU-FEL

    International Nuclear Information System (INIS)

    Sei, Norihiro; Zen, Heishun; Ohgaki, Hideaki

    2016-01-01

    We produced intense coherent synchrotron radiation (CSR) in the terahertz (THz) region using an S-band linac at the Kyoto University Free Electron Laser (KU-FEL), which is a mid-infrared free-electron laser facility. The CSR beam was emitted from short-pulse electron bunches compressed by a 180° arc, and was transferred to air at a large solid angle of 0.10 rad. The measured CSR energy was 55 μJ per 7 μs macropulse, and KU-FEL was one of the most powerful CSR sources in normal conducting linear accelerator facilities. The CSR spectra were measured using an uncooled pyroelectric detector and a Michelson-type interferometer designed specifically for the KU-FEL electron beam, and had a maximum at a frequency of 0.11 THz. We found that adjusting the energy slit enhanced the CSR energy and shortened the electron beam bunch length in the CSR spectra measurements. Our results demonstrated that the efficient use of the energy slit can help improve the characteristics of CSR. - Highlights: • We have developed intense coherent synchrotron radiation (CSR) at KU-FEL. • The elevation angle of the CSR was correctly measured by a new technique. • The CSR power extracted to the air was 55 μJ per 7 μs macropulse. • It was demonstrated that an energy slit was effective to improve the CSR properties.

  15. Double strand break rejoining by the Ku-dependent mechanism of non-homologous end-joining

    International Nuclear Information System (INIS)

    Jeggo, P.; Singleton, B.; Beamish, H.; Priestley, A.

    1999-01-01

    The DNA-dependent protein kinase functions in the repair of DNA double strand breaks (DSBs) and in V(D)J recombination. To gain insight into the function of DNA-PK in this process we have carried out a mutation analysis of Ku80 and DNA-PKcs. Mutations at multiple sites within the N-terminal two thirds of Ku80 result in loss of Ku70/80 interaction, loss of DNA end-binding activity and inability to complement Ku80 defective cell fines. In contrast, mutations in the carboxy terminal region of the protein do not impair DNA end-binding activity but decrease the ability of Ku to activate DNA-PK. To gain insight into important functional domains within DNA-PKcs, we have analysed defective mutants, including the mouse scid cell line, and the rodent mutants, ire-20 and V-3. Mutational changes in the carboxy terminal region have been identified in all cases. Our results strongly suggest that the C-terminus of DNA-PKcs is required for kinase activity. (author)

  16. Vecāku un bērnu mantiskās attiecības

    OpenAIRE

    Krauja, Uldis

    2009-01-01

    Bakalaura darba "Vecāku un bērna mantiskās attiecības" mērķis ir izpētīt vecāku un bērna mantisko attiecību regulējumu Latvijas Republikas normatīvajos tiesību aktos, atklājot tajos iespējamās problēmas un nepilnības. Bakalaura darba pirmajā daļā apskatīts vecāku un bērna mantisko attiecību jēdziens un izpratne, pievērsta uzmanība uz vecāku un bērna mantisko attiecību pirmsākumiem caur vēstures prizmu, lai apzinātos ģimenes tiesību nozīmīgumu cilvēces attīstībā un tagadējā dzīvē. Bakalaura da...

  17. Synthetic lethality between murine DNA repair factors XLF and DNA-PKcs is rescued by inactivation of Ku70

    DEFF Research Database (Denmark)

    Xing, Mengtan; Bjørås, Magnar; Daniel, Jeremy A

    2017-01-01

    DNA double-strand breaks (DSBs) are recognized and repaired by the Classical Non-Homologous End-Joining (C-NHEJ) and Homologous Recombination pathways. C-NHEJ includes the core Ku70 and Ku80 (or Ku86) heterodimer that binds DSBs and thus promotes recruitment of accessory downstream NHEJ factors XLF......, PAXX, DNA-PKcs, Artemis and other core subunits, XRCC4 and DNA Ligase 4 (Lig4). In the absence of core C-NHEJ factors, DNA repair can be performed by Alternative End-Joining, which likely depends on DNA Ligase 1 and DNA Ligase 3. Genetic inactivation of C-NHEJ factors, such as Ku70, Ku80, XLF, PAXX...... with severe apoptosis in the central nervous system. Here, we demonstrate that inactivation of the Ku70 gene rescues the synthetic lethality between XLF and DNA-PKcs, resulting in triple knockout mice that are indistinguishable from Ku70-deficient littermates by size or levels of genomic instability. Moreover...

  18. Downregulated Ku70 and ATM associated to poor prognosis in colorectal cancer among Chinese patients

    Directory of Open Access Journals (Sweden)

    Lu YF

    2014-10-01

    Full Text Available Yuanfang Lu,1,2 Jingyan Gao,1,3 Yuanming Lu,1 1Department of Toxicology, School of Public Health, Guilin Medical University, Guangxi, People's Republic of China; 2Department of Clinical Research Center, Affiliated 2nd Hospital of Nanjing Medical University, Nanjing, People's Republic of China; 3Department of Human Anatomy and Histo-Embryology, Shanghai Medical College, Fudan University, Shanghai, People's Republic of China Background: Double-strand DNA breaks (DSBs are a key factor in carcinogenesis. The necessary repair of DSBs is pivotal in maintaining normal cell division. To address the relationship between altered expression of DSB repair of proteins Ku70 and ataxia-telangiectasia mutated (ATM in colorectal cancer (CRC, we examined the expression levels and patterns of Ku70 and ATM in CRC samples. Methods: Expression and coexpression of Ku70 and ATM were investigated by using real-time quantitative polymerase chain reaction assays and confirmed further with fluorescent immunohistochemistry in CRC and pericancerous samples from 112 Chinese patients. Results: Downexpression patterns for both Ku70 and ATM were found in the CRC samples and were significantly associated with advanced tumor node metastasis stage and decreased 5-year overall survival rate. Conclusion: Downregulated Ku70 and ATM were associated with poor disease-free survival. Loss of Ku70 and ATM expression might act as a biomarker to predict poor prognosis in patients with CRC. Keywords: DNA double-strand breaks, ataxia-telangiectasia mutated, Ku70, colorectal cancer

  19. Ku-mediated coupling of DNA cleavage and repair during programmed genome rearrangements in the ciliate Paramecium tetraurelia.

    Directory of Open Access Journals (Sweden)

    Antoine Marmignon

    2014-08-01

    Full Text Available During somatic differentiation, physiological DNA double-strand breaks (DSB can drive programmed genome rearrangements (PGR, during which DSB repair pathways are mobilized to safeguard genome integrity. Because of their unique nuclear dimorphism, ciliates are powerful unicellular eukaryotic models to study the mechanisms involved in PGR. At each sexual cycle, the germline nucleus is transmitted to the progeny, but the somatic nucleus, essential for gene expression, is destroyed and a new somatic nucleus differentiates from a copy of the germline nucleus. In Paramecium tetraurelia, the development of the somatic nucleus involves massive PGR, including the precise elimination of at least 45,000 germline sequences (Internal Eliminated Sequences, IES. IES excision proceeds through a cut-and-close mechanism: a domesticated transposase, PiggyMac, is essential for DNA cleavage, and DSB repair at excision sites involves the Ligase IV, a specific component of the non-homologous end-joining (NHEJ pathway. At the genome-wide level, a huge number of programmed DSBs must be repaired during this process to allow the assembly of functional somatic chromosomes. To understand how DNA cleavage and DSB repair are coordinated during PGR, we have focused on Ku, the earliest actor of NHEJ-mediated repair. Two Ku70 and three Ku80 paralogs are encoded in the genome of P. tetraurelia: Ku70a and Ku80c are produced during sexual processes and localize specifically in the developing new somatic nucleus. Using RNA interference, we show that the development-specific Ku70/Ku80c heterodimer is essential for the recovery of a functional somatic nucleus. Strikingly, at the molecular level, PiggyMac-dependent DNA cleavage is abolished at IES boundaries in cells depleted for Ku80c, resulting in IES retention in the somatic genome. PiggyMac and Ku70a/Ku80c co-purify as a complex when overproduced in a heterologous system. We conclude that Ku has been integrated in the Paramecium

  20. Volba idolů ve školním věku (Pop-Pantheon)

    OpenAIRE

    Ryba, Zdeněk

    2016-01-01

    Title: Idolization In The School Age (Pop-Pantheon) Author: Zdeněk Ryba Department: Department of Psychology Supervizor: doc. PhDr. Miloš Kučera, CSc. The main theme of this thesis is basic-school-age children choice of idols. The work is a part of Miloš Kučera research at Faculty of Education UK and it follows up the Mikšíček (1999) and Kravcová (2008) conclusions in their diploma thesis and short Kučera's contribution. The goal of this thesis is to make a database of idols and to create mod...

  1. Uloga kućnih ljubimaca u socioemocionalnom  razvoju djece školskog uzrasta

    OpenAIRE

    Smojver-Ažić, Sanja; Topalović, Zorica

    2010-01-01

    Rezultati istraživanja potvrđuju kako je odrastanje uz kućnoga ljubimca povezano sa socioemocionalnim razvojem djece. Cilj ovoga istraživanja bio je ispitati odnos u kojemu stoje privrženost majci, privrženost kućnomu ljubimcu i empatija, socijalna kompetencija i usamljenost. U istraživanju je sudjelovalo 480 učenika četvrtoga, šestoga i osmoga razreda osnovnih škola u Istri (226 djevojčica i 254 dječaka) te njihovi roditelji. U ispitanom uzorku 63 % djece ima jednoga ili više kućnih ljubi...

  2. The Ku70/80 ring in Non-Homologous End-Joining

    DEFF Research Database (Denmark)

    Kragelund, Birthe Brandt; Weterings, Eric; Hartmann-Petersen, Rasmus

    2016-01-01

    /80 heterodimer is a key-player in the NHEJ pathway and binds to DNA termini with high affinity, where it helps to protect DNA ends from degradation and to recruit other NHEJ factors required for repair. The mechanism of Ku70/80 detachment from the DNA helix after completion of DNA repair is incompletely......Non-homologous end-joining (NHEJ) is an essential DNA double strand break repair pathway during all cell cycle stages. Deficiency in NHEJ factors can lead to accumulation of unrepaired DNA breaks or faulty DNA repair, which may ultimately result in cell death, senescence or carcinogenesis. The Ku70...... understood. Some data suggest that certain DNA repair factors are ubiquitylated and targeted for proteasomal degradation after repair. Recent studies suggest that Ku80 is conjugated to lysine48-linked ubiquitin chains by the Skp1-Cullin-F-box (SCF) complex and/or the RING finger protein 8 (RNF8) ubiquitin-protein...

  3. Xrcc1-dependent and Ku-dependent DNA double-strand break repair kinetics in Arabidopsis plants.

    Science.gov (United States)

    Charbonnel, Cyril; Gallego, Maria E; White, Charles I

    2010-10-01

    Double-strand breakage (DSB) of DNA involves loss of information on the two strands of the DNA fibre and thus cannot be repaired by simple copying of the complementary strand which is possible with single-strand DNA damage. Homologous recombination (HR) can precisely repair DSB using another copy of the genome as template and non-homologous recombination (NHR) permits repair of DSB with little or no dependence on DNA sequence homology. In addition to the well-characterised Ku-dependent non-homologous end-joining (NHEJ) pathway, much recent attention has been focused on Ku-independent NHR. The complex interrelationships and regulation of NHR pathways remain poorly understood, even more so in the case of plants, and we present here an analysis of Ku-dependent and Ku-independent repair of DSB in Arabidopsis thaliana. We have characterised an Arabidopsis xrcc1 mutant and developed quantitative analysis of the kinetics of appearance and loss of γ-H2AX foci as a tool to measure DSB repair in dividing root tip cells of γ-irradiated plants in vivo. This approach has permitted determination of DSB repair kinetics in planta following a short pulse of γ-irradiation, establishing the existence of a Ku-independent, Xrcc1-dependent DSB repair pathway. Furthermore, our data show a role for Ku80 during the first minutes post-irradiation and that Xrcc1 also plays such a role, but only in the absence of Ku. The importance of Xrcc1 is, however, clearly visible at later times in the presence of Ku, showing that alternative end-joining plays an important role in DSB repair even in the presence of active NHEJ. © 2010 The Authors. Journal compilation © 2010 Blackwell Publishing Ltd.

  4. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  5. ONR Far East Scientific Information Bulletin. Volume 15, Number 2

    Science.gov (United States)

    1990-06-01

    other Japanese propulsor concepts (Ref 14 matters, Professors Hisashi Kajitani and and 15) that were undergoing evaluation at Hiroharu Kato of Tokyo... Kimura Dept of Electrical Engineering 15-F200-J600 Faculty of Engineering Kyoto University Yoshida-honmachi Sakyo-ku, Kyoto 606 August International...Symposium Kobe, Professor Hidenori Kimura 17-21 on the Mathematical Theory of Japan Dept. of Mechanical Engineering for Networks and Systems (MTNS-91

  6. A novel small molecule inhibitor of the DNA repair protein Ku70/80.

    Science.gov (United States)

    Weterings, Eric; Gallegos, Alfred C; Dominick, Lauren N; Cooke, Laurence S; Bartels, Trace N; Vagner, Josef; Matsunaga, Terry O; Mahadevan, Daruka

    2016-07-01

    Non-Homologous End-Joining (NHEJ) is the predominant pathway for the repair of DNA double strand breaks (DSBs) in human cells. The NHEJ pathway is frequently upregulated in several solid cancers as a compensatory mechanism for a separate DSB repair defect or for innate genomic instability, making this pathway a powerful target for synthetic lethality approaches. In addition, NHEJ reduces the efficacy of cancer treatment modalities which rely on the introduction of DSBs, like radiation therapy or genotoxic chemotherapy. Consequently, inhibition of the NHEJ pathway can modulate a radiation- or chemo-refractory disease presentation. The Ku70/80 heterodimer protein plays a pivotal role in the NHEJ process. It possesses a ring-shaped structure with high affinity for DSBs and serves as the first responder and central scaffold around which the rest of the repair complex is assembled. Because of this central position, the Ku70/80 dimer is a logical target for the disruption of the entire NHEJ pathway. Surprisingly, specific inhibitors of the Ku70/80 heterodimer are currently not available. We here describe an in silico, pocket-based drug discovery methodology utilizing the crystal structure of the Ku70/80 heterodimer. We identified a novel putative small molecule binding pocket and selected several potential inhibitors by computational screening. Subsequent biological screening resulted in the first identification of a compound with confirmed Ku-inhibitory activity in the low micro-molar range, capable of disrupting the binding of Ku70/80 to DNA substrates and impairing Ku-dependent activation of another NHEJ factor, the DNA-PKCS kinase. Importantly, this compound synergistically sensitized human cell lines to radiation treatment, indicating a clear potential to diminish DSB repair. The chemical scaffold we here describe can be utilized as a lead-generating platform for the design and development of a novel class of anti-cancer agents. Copyright © 2016 Elsevier B.V. All

  7. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    CERN Document Server

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  8. Molecular characterization of resistant chronic lymphocytic leukemia (CLL): function of a new phosphorylated form of Ku70

    International Nuclear Information System (INIS)

    Saad, Lina

    2013-01-01

    We have identified a new form of phospho-S27-S33-Ku70 constitutively over expressed in a subset of chronic lymphocytic leukemia (CLL) B cells resistant to apoptosis induced by DNA double strand breaks (DSB). Ku70 is one of the essential proteins involved in the maintenance of genomic stability through its role in DNA double strand break repair (non-homologous end-joining, NHEJ) and in telomeric protection. Laboratory previously established that resistant CLL cells disclose an up-regulated NHEJ DNA repair and an impaired structure of telomeres. The goal of this thesis was to characterize the biological function(s) of this new form of Ku70. For this purpose we have constructed specific EBV-based vectors (siRNA / cDNA) enabling a simultaneous inhibition of endogenous Ku70 and an expression of different forms (mutated, wild, phospho-mimetic at ser27-33) of Ku70 resistant to siRNA. Thus, we showed: i) a strict co-localisation of phospho-Ku70 with γ-H2AX foci; ii) that DSB induces the phosphorylation of Ku70 within minutes after genotoxic stress in heterodimer complex Ku70/Ku80. This phosphorylation necessitates both the physical interaction and the activity of pS2056-DNA-PKcs and/or ATM, linking phospho-Ku70 to NHEJ-mediated DNA DSB repair; iii) cells expressing mutated A27-A33-Ku70 exhibit a delayed G2/M cell cycle arrest, slower kinetic of DNA repair, lower level of genotoxic stress-induced chromosomal aberrations, and a higher cellular impedance correlated with translocation of transcriptional factor β-catenin from cytoplasmic membrane to the nucleus. Together, these data unveil an involvement of phospho-Ku70 in fast and inaccurate DNA repair; new paradigm for NHEJ regulation and to the control of resistance and maintenance of malignant cells.In parallel, we have initiated experimental approaches to explore other potential roles of phospho-Ku70. Especially, we were interested to determine whether it could play a role in an initiation of cell senescence induced by

  9. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  10. Extraction and beam transfer for the SHiP facility

    CERN Document Server

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  11. DNA-PK/Ku complex binds to latency-associated nuclear antigen and negatively regulates Kaposi's sarcoma-associated herpesvirus latent replication

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Seho [Department of Life Science, Dongguk Univ-Seoul, Seoul 100-715 (Korea, Republic of); Lim, Chunghun [Department of Biological Sciences, Korea Advanced Institute of Science and Technology, Daejeon 305-701 (Korea, Republic of); Lee, Jae Young [Department of Life Science, Dongguk Univ-Seoul, Seoul 100-715 (Korea, Republic of); Song, Yoon-Jae [Department of Life Science, Kyungwon University, Seongnam-Si, Kyeonggi-Do 461-701 (Korea, Republic of); Park, Junsoo [Division of Biological Science and Technology, Yonsei University, Wonju 220-100 (Korea, Republic of); Choe, Joonho [Department of Biological Sciences, Korea Advanced Institute of Science and Technology, Daejeon 305-701 (Korea, Republic of); Seo, Taegun, E-mail: tseo@dongguk.edu [Department of Life Science, Dongguk Univ-Seoul, Seoul 100-715 (Korea, Republic of)

    2010-04-16

    During latent infection, latency-associated nuclear antigen (LANA) of Kaposi's sarcoma-associated herpesvirus (KSHV) plays important roles in episomal persistence and replication. Several host factors are associated with KSHV latent replication. Here, we show that the catalytic subunit of DNA protein kinase (DNA-PKcs), Ku70, and Ku86 bind the N-terminal region of LANA. LANA was phosphorylated by DNA-PK and overexpression of Ku70, but not Ku86, impaired transient replication. The efficiency of transient replication was significantly increased in the HCT116 (Ku86 +/-) cell line, compared to the HCT116 (Ku86 +/+) cell line, suggesting that the DNA-PK/Ku complex negatively regulates KSHV latent replication.

  12. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Science.gov (United States)

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  13. Functional Interplay of the Mre11 Nuclease and Ku in the Response to Replication-Associated DNA Damage ▿

    Science.gov (United States)

    Foster, Steven S.; Balestrini, Alessia; Petrini, John H. J.

    2011-01-01

    The Mre11 complex is a central component of the DNA damage response, with roles in damage sensing, molecular bridging, and end resection. We have previously shown that in Saccharomyces cerevisiae, Ku70 (yKu70) deficiency reduces the ionizing radiation sensitivity of mre11Δ mutants. In this study, we show that yKu70 deficiency suppressed the camptothecin (CPT) and methyl methanesulfonate (MMS) sensitivity of nuclease-deficient mre11-3 and sae2Δ mutants in an Exo1-dependent manner. CPT-induced G2/M arrest, γ-H2AX persistence, and chromosome breaks were elevated in mre11-3 mutants. These outcomes were reduced by yKu70 deficiency. Given that the genotoxic effects of CPT are manifest during DNA replication, these data suggest that Ku limits Exo1-dependent double-strand break (DSB) resection during DNA replication, inhibiting the initial processing steps required for homology-directed repair. We propose that Mre11 nuclease- and Sae2-dependent DNA end processing, which initiates DSB resection prevents Ku from engaging DSBs, thus promoting Exo1-dependent resection. In agreement with this idea, we show that Ku affinity for binding to short single-stranded overhangs is much lower than for blunt DNA ends. Collectively, the data define a nonhomologous end joining (NHEJ)-independent, S-phase-specific function of the Ku heterodimer. PMID:21876003

  14. Interplay between Ku and Replication Protein A in the Restriction of Exo1-mediated DNA Break End Resection*

    Science.gov (United States)

    Krasner, Danielle S.; Daley, James M.; Sung, Patrick; Niu, Hengyao

    2015-01-01

    DNA double-strand breaks can be eliminated via non-homologous end joining or homologous recombination. Non-homologous end joining is initiated by the association of Ku with DNA ends. In contrast, homologous recombination entails nucleolytic resection of the 5′-strands, forming 3′-ssDNA tails that become coated with replication protein A (RPA). Ku restricts end access by the resection nuclease Exo1. It is unclear how partial resection might affect Ku engagement and Exo1 restriction. Here, we addressed these questions in a reconstituted system with yeast proteins. With blunt-ended DNA, Ku protected against Exo1 in a manner that required its DNA end-binding activity. Despite binding poorly to ssDNA, Ku could nonetheless engage a 5′-recessed DNA end with a 40-nucleotide (nt) ssDNA overhang, where it localized to the ssDNA-dsDNA junction and efficiently blocked resection by Exo1. Interestingly, RPA could exclude Ku from a partially resected structure with a 22-nt ssDNA tail and thus restored processing by Exo1. However, at a 40-nt tail, Ku remained stably associated at the ssDNA-dsDNA junction, and RPA simultaneously engaged the ssDNA region. We discuss a model in which the dynamic equilibrium between Ku and RPA binding to a partially resected DNA end influences the timing and efficiency of the resection process. PMID:26067273

  15. Serum anti-Ku86 is a potential biomarker for early detection of hepatitis C virus-related hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Fumio, E-mail: fnomura@faculty.chiba-u.jp [Department of Molecular Diagnosis, Graduate School of Medicine, Chiba University and Divisions of Laboratory Medicine, Clinical Genetics and Proteomics, Chiba University Hospital, Chiba (Japan); Sogawa, Kazuyuki; Noda, Kenta; Seimiya, Masanori; Matsushita, Kazuyuki; Miura, Toshihide [Department of Molecular Diagnosis, Graduate School of Medicine, Chiba University and Divisions of Laboratory Medicine, Clinical Genetics and Proteomics, Chiba University Hospital, Chiba (Japan); Tomonaga, Takeshi [Laboratory of Proteome Research, National Institute of Biomedical Innovation, Ibaraki (Japan); Yoshitomi, Hideyuki [Department of General Surgery, Graduate School of Medicine, Chiba University, Chiba (Japan); Imazeki, Fumio [Department of Medicine and Clinical Oncology, Graduate School of Medicine, Chiba University, Chiba (Japan); Takizawa, Hirotaka [Kashiwado Clinic in Port-Square of the Kashiwado Memorial Foundation, Chiba (Japan); Mogushi, Kaoru [Information Center for Medical Sciences, Tokyo Dental and Medical University, Tokyo (Japan); Miyazaki, Masaru [Department of General Surgery, Graduate School of Medicine, Chiba University, Chiba (Japan); Yokosuka, Osamu [Department of Medicine and Clinical Oncology, Graduate School of Medicine, Chiba University, Chiba (Japan)

    2012-05-18

    Highlights: Black-Right-Pointing-Pointer Overexpression of Ku86 in human liver cancer was shown by immunohistochemistry. Black-Right-Pointing-Pointer Serum anti-Ku86 was significantly elevated in early hepatocellular carcinoma. Black-Right-Pointing-Pointer Anti-Ku86 may be more sensitive than the conventional markers for early detection. Black-Right-Pointing-Pointer Serum anti-Ku86 significantly decreased after surgical resection of liver tumors. Black-Right-Pointing-Pointer Elevation of serum anti-Ku86 in other non-liver solid tumors was minimal. -- Abstract: Hepatocellular carcinoma (HCC), the predominant form of primary liver cancer, is one of the most common cancers worldwide and the third most common cause of cancer-related death. Imaging studies including ultrasound and computed tomography are recommended for early detection of HCC, but they are operator dependent, costly and involve radiation. Therefore, there is a need for simple and sensitive serum markers for the early detection of hepatocellular carcinoma (HCC). In our recent proteomic studies, a number of proteins overexpressed in HCC tissues were identified. We thought if the serum autoantibodies to these overexpressed proteins were detectable in HCC patients. Of these proteins, we focused on Ku86, a nuclear protein involved in multiple biological processes and aimed to assess the diagnostic value of serum anti-Ku86 in the early detection of HCC. Serum samples were obtained prior to treatment from 58 consecutive patients with early or relatively early hepatitis C virus (HCV)-related HCC and 137 patients with HCV-related liver cirrhosis without evidence of HCC. Enzyme immunoassays were used to measure serum levels of autoantibodies. Serum levels of anti-Ku86 antibodies were significantly elevated in HCC patients compared to those in liver cirrhosis patients (0.41 {+-} 0.28 vs. 0.18 {+-} 0.08 Abs at 450 nm, P < 0001). Setting the cut-off level to give 90% specificity, anti-Ku86 was positive in 60.7% of

  16. Radiosensitizing activity and pharmacokinetics of multiple dose administered KU-2285 in peripheral nerve tissue in mice

    International Nuclear Information System (INIS)

    Iwai, Hiroyuki; Matsuno, Etsuko; Sasai, Keisuke; Abe, Mitsuyuki; Shibamoto, Yuta

    1994-01-01

    In a clinical trial in which a 2-nitroimidazole radiosensitizer was administered repeatedly, the dose-limiting toxicity was found to be peripheral neuropathy. In the present study, the in vivo radiosensitizing activity of KU-2285 in combination with radiation dose fractionation, and the pharmacokinetics of cumulative dosing of KU-2285 in the peripheral nerves were examined. The ability of three nitroimidazoles, misonidazole (MISO), etanidazole (SR-2508) and KU-2285, to sensitize SCCVII tumors to radiation treatment has been compared for drug doses in the range 0-200 mg/kg. Single radiation doses or two different fractionation schedules (6 Gy/fractions x three fractions/48 h or 5 Gy/fractions x five fractions/48 h) were used; the tumor cell survival was determined using an in vivo/in vitro colony assay. The pharmacokinetics in the sciatic nerves were undertaken, when KU-2285 or etanidazole were injected at a dose of 200 mg/kg intravenously one, two, three, or four times at 2-h intervals. At less than 100 mg/kg, KU-2285 sensitized SCCVII tumors more than MISO and SR-2508 by fractionated irradiation. Evaluation of pharmacokinetics in the peripheral nerves showed that the apparent biological half-life of SR-2508 increased with the increases in the number of administrations, whereas that of KU-2285 became shorter. Since most clinical radiotherapy is given in small multiple fractions, KU-2285 appears to be a hypoxic cell radiosensitizer that could be useful in such regimens, and that poses no risk of chronic peripheral neurotoxicity. 12 refs., 5 figs., 1 tab

  17. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  18. Increased expression of IRE1α and stress-related signal transduction proteins in ischemia-reperfusion injured retina

    Directory of Open Access Journals (Sweden)

    Natsuyo Hata

    2008-08-01

    Full Text Available Natsuyo Hata1, Toshiyuki Oshitari1,2, Akiko Yokoyama1,3, Yoshinori Mitamura1, Shuichi Yamamoto11Department of Ophthalmology and Visual Science, Chiba University Graduate School of Medicine, Chuo-ku, Chiba, Japan; 2Department of Ophthalmology, Kimitsu Central Hospital, Kisarazu City, Chiba, Japan; 3Department of Ophthalmology, Inoue Memorial Hospital, Chuo-ku, Chiba, JapanAbstract: The purpose of this study was to determine whether the expression of ER stress-related factors IRE1α, apoptosis signal-regulating kinase 1 (ASK1, SAPK/ERK kinase 1 (SEK1 and c-Jun N-terminal kinase (JNK is associated with the damaged retinal neurons induced by ischemia-reperfusion injury. After 60 minutes of ischemia, the rat retinas were reperfused, and retinas were isolated and fixed after 6, 9, 12, 18, and 24 hours, and 2, 5, and 9 days of reperfusion. Cryosections were immunostained with Fluoro-Jade B, a degenerating neuron marker to label degenerating neurons. Semi-quantitative analysis of the expression of IRE1α, ASK1, SEK1, and JNK were performed in both control and ischemic retinas. In ischemic retinas, the intensities of IRE1α immunoreactivity in the ganglion cell layer (GCL were significantly higher than in the control retinas. In ischemic retinas, the numbers of SEK1-, ASK1-, and JNK-positive cells were significantly increased in the GCL compared to those in the control retinas. In addition, the cells that were positive for SEK1-, ASK1-, and JNK were also positive for Fluoro-Jade B-positive cells. These results indicate that the increased expression of ER stress-related factors was, in part, associated with the retinal neuronal abnormalities after ischemia-reperfusion injury in rat retinas.Keywords: endoplasmic reticulum, IRE1α, apoptosis signal-regulating kinase 1, SAPK/ERK kinase 1, c-Jun N-terminal kinase, Fluoro-Jade B, ischemia-reperfusion injury

  19. Restoration of X-ray resistance and V(D)J recombination in mutant cells by Ku cDNA

    International Nuclear Information System (INIS)

    Smider, V.; Rathmell, W.K.; Chu, G.; Lieber, M.R.

    1994-01-01

    Three genetic complementation groups of rodent cells are defective for both repair of x-ray-induced double-strand breaks and V(D)J recombination. Cells from one group lack a DNA end-binding activity that is biochemically and antigenically similar to the Ku autoantigen. Transfection of complementary DNA (cDNA) that encoded the 86-kilodalton subunit of Ku rescued these mutant cells for DNA end-binding activity, x-ray resistance, and V(D)J recombination activity. These results establish a role for Ku in DNA repair and recombination. Furthermore, as a component of a DNA-dependent protein kinase, Ku may initiate a signaling pathway induced by DNA damage

  20. Prevalence and effects of rape myths in print journalism: the Kobe Bryant case.

    Science.gov (United States)

    Franiuk, Renae; Seefelt, Jennifer L; Cepress, Sandy L; Vandello, Joseph A

    2008-03-01

    Two studies examine the prevalence and effects of rape myths in the print media covering a real-life case of alleged sexual assault. Study 1 was an archival study of 156 sources from around the country. Articles about the Kobe Bryant case were coded for instances of rape myths, among other variables. Of the articles, 65 mentioned at least one rape myth (with "she's lying" being the single most common myth perpetuated). Study 2 assessed participants' (N = 62) prior knowledge of the Bryant case and exposed them to a myth-endorsing or myth-challenging article about the case. Those exposed to the myth-endorsing article were more likely to believe that Bryant was not guilty and the alleged victim was lying. The implications for victim reporting and reducing sexual assault in general are discussed.

  1. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    CERN Document Server

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  2. Unusual Childhood Waking as a Possible Precursor of the 1995 Kobe Earthquake

    Directory of Open Access Journals (Sweden)

    Neil E. Whitehead

    2013-03-01

    Full Text Available Nearly 1,100 young students living in Japan at a range of distances up to 500 km from the 1995 Kobe M7 earthquake were interviewed. A statistically significant abnormal rate of early wakening before the earthquake was found, having exponential decrease with distance and a half value approaching 100 km, but decreasing much slower than from a point source such as an epicentre; instead originating from an extended area of more than 100 km in diameter. Because an improbably high amount of variance is explained, this effect is unlikely to be simply psychological and must reflect another mechanism—perhaps Ultra-Low Frequency (ULF electromagnetic waves creating anxiety—but probably not 222Rn excess. Other work reviewed suggests these conclusions may be valid for animals in general, not just children, but would be very difficult to apply for practical earthquake prediction.

  3. Deletion of individual Ku subunits in mice causes an NHEJ-independent phenotype potentially by altering apurinic/apyrimidinic site repair

    NARCIS (Netherlands)

    Y.J. Choi (Yong Jun); H. Li (Han); M.Y. Son (Mi Young); X.-H. Wang (Xiao-Hong); J.L. Fornsaglio (Jamie L.); R.W. Sobol (Robert W.); M. Lee (Moonsook); J. Vijg (Jan); S. Imholz (Sandra); M.E.T. Dollé (Martijn); H. van Steeg (Harry); E. Reiling (Erwin); P. Hasty (Paul)

    2014-01-01

    textabstractKu70 and Ku80 form a heterodimer called Ku that forms a holoenzyme with DNA dependent-protein kinase catalytic subunit (DNA-PKCS) to repair DNA double strand breaks (DSBs) through the nonhomologous end joining (NHEJ) pathway. As expected mutating these genes in mice caused a similar DSB

  4. 18F-fluorodeoxyglucose positron emission tomography might be useful for diagnosis of hepatic amyloidosis

    Directory of Open Access Journals (Sweden)

    Tawada A

    2014-06-01

    Full Text Available Akinobu Tawada,1 Tatsuo Kanda,1 Takashi Oide,2 Toshio Tsuyuguchi,1 Fumio Imazeki,1,3 Yukio Nakatani,2 Osamu Yokosuka11Department of Gastroenterology, 2Department of Diagnostic Pathology, Chiba University Hospital, Chuo-ku, Chiba, Japan; 3Safety and Health Organization, Chiba University, Inage-ku, Chiba, JapanAbstract: We report on a woman with hepatic involvement of primary systemic (immunoglobulin light chain, AL amyloidosis. Her diagnosis was confirmed by liver biopsy. Clinical symptoms of hepatic amyloidosis are generally mild at its first stage, with most frequent findings being hepatomegaly and alkaline phosphatase elevation. Recent advances in the understanding of the pathophysiology of systemic amyloidosis have made several treatments available. However, its prognosis is occasionally poor. Because liver biopsy is not always safe, other modalities for the diagnosis are needed. Of interest was that fluorodeoxyglucose (FDG uptake into the liver was observed, compared with that into the spleen, in this patient, indicating that FDG positron emission tomography and computed tomography might be useful for the diagnosis of hepatic amyloidosis with mild liver dysfunction.Keywords: amyloidosis, diagnosis, hepatic involvement, FDG PET

  5. GPM, DPR Level 2A Ku Precipitation V03

    Data.gov (United States)

    National Aeronautics and Space Administration — The 2AKu algorithm provides precipitation estimates from the Ku radar of the Dual-Frequency Precipitation Radar on the core GPM spacecraft. The product contains one...

  6. Pohon pásového dopravníku pro transport uhlí

    OpenAIRE

    Kliš, Kamil

    2013-01-01

    Diplomová práce se zabývá návrhem pohonu pásového dopravníku pro transport uhlí. Práce obsahuje nezbytné výpočty dle norem potřebné k určení vhodných komponentů pásového dopravníku. Cílem diplomové práce bylo navrhnout pohon pásového dopravníku, všech jeho potřebných komponentů včetně návrhem rámu pohonu a vytvoření výkresové dokumentace. This diploma thesis deals with designing a drivetrain for a coal belt conveyor. Thesis contains necessary calculations according to norms needed for dete...

  7. Comparisons of Source Characteristics between Recent Inland Crustal Earthquake Sequences inside and outside of Niigata-Kobe Tectonic Zone, Japan

    Science.gov (United States)

    Somei, K.; Asano, K.; Iwata, T.; Miyakoshi, K.

    2012-12-01

    After the 1995 Kobe earthquake, many M7-class inland earthquakes occurred in Japan. Some of those events (e.g., the 2004 Chuetsu earthquake) occurred in a tectonic zone which is characterized as a high strain rate zone by the GPS observation (Sagiya et al., 2000) or dense distribution of active faults. That belt-like zone along the coast in Japan Sea side of Tohoku and Chubu districts, and north of Kinki district, is called as the Niigata-Kobe tectonic zone (NKTZ, Sagiya et al, 2000). We investigate seismic scaling relationship for recent inland crustal earthquake sequences in Japan and compare source characteristics between events occurring inside and outside of NKTZ. We used S-wave coda part for estimating source spectra. Source spectral ratio is obtained by S-wave coda spectral ratio between the records of large and small events occurring close to each other from nation-wide strong motion network (K-NET and KiK-net) and broad-band seismic network (F-net) to remove propagation-path and site effects. We carefully examined the commonality of the decay of coda envelopes between event-pair records and modeled the observed spectral ratio by the source spectral ratio function with assuming omega-square source model for large and small events. We estimated the corner frequencies and seismic moment (ratio) from those modeled spectral ratio function. We determined Brune's stress drops of 356 events (Mw: 3.1-6.9) in ten earthquake sequences occurring in NKTZ and six sequences occurring outside of NKTZ. Most of source spectra obey omega-square source spectra. There is no obvious systematic difference between stress drops of events in NKTZ zone and others. We may conclude that the systematic tendency of seismic source scaling of the events occurred inside and outside of NKTZ does not exist and the average source scaling relationship can be effective for inland crustal earthquakes. Acknowledgements: Waveform data were provided from K-NET, KiK-net and F-net operated by

  8. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  9. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Science.gov (United States)

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  10. Etiology and prevalence rate of bilateral sensorineural hearing impairment in children born in Kobe city over a 10 year period

    International Nuclear Information System (INIS)

    Yoshioka, Mieko; Naito, Yashushi

    2008-01-01

    The study was carried out on children born over a 10 year period from 1997 to 2006 in Kobe city and referred to our center for specialist audiological assessment. A total of 107 cases had a bilateral sensorineural hearing impairment averaging 25 dB or over in the better hearing ear during the study period. To ascertain causes of sensorineural hearing impairment, full medical histories were obtained with detailed family history relevant to hearing impairment and perinatal course for adverse etiological factors. The children were investigated for possible congenital infection and chromosomal anomalies. Children with positive family history of deafness in parents or siblings constituted 11.2% of cases (genetic group). Other etiological groups showed the following distribution: syndromal group 5.6%; inner ear anomalies 5.6%; perinatal group 13.1%; congenital infection 11.2%; chromosomal anomalies 16.8%; multiple congenital anomalies 5.6%; causes unknown 30.9%. The high incidence of causes unknown indicates that steps should be taken to yield a diagnosis. The total number of children born in Kobe city was 117,896 during the period from 1997 to 2005, which gave a prevalence rate of hearing impairment of 0.87/1,000 births. Newborn hearing screening identified many children earlier and also provide the opportunity to finetune the evaluation. (author)

  11. A Ku-band magnetically insulated transmission line oscillator with overmoded slow-wave-structure

    Science.gov (United States)

    Jiang, Tao; He, Jun-Tao; Zhang, Jian-De; Li, Zhi-Qiang; Ling, Jun-Pu

    2016-12-01

    In order to enhance the power capacity, an improved Ku-band magnetically insulated transmission line oscillator (MILO) with overmoded slow-wave-structure (SWS) is proposed and investigated numerically and experimentally. The analysis of the dispersion relationship and the resonant curve of the cold test indicate that the device can operate at the near π mode of the TM01 mode, which is useful for mode selection and control. In the particle simulation, the improved Ku-band MILO generates a microwave with a power of 1.5 GW and a frequency of 12.3 GHz under an input voltage of 480 kV and input current of 42 kA. Finally, experimental investigation of the improved Ku-band MILO is carried out. A high-power microwave (HPM) with an average power of 800 MW, a frequency of 12.35 GHz, and pulse width of 35 ns is generated under a diode voltage of 500 kV and beam current of 43 kA. The consistency between the experimental and simulated far-field radiation pattern confirms that the operating mode of the improved Ku-band MILO is well controlled in π mode of the TM01 mode. Project supported partly by the National Natural Science Foundation of China (Grant No. 61171021).

  12. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    International Nuclear Information System (INIS)

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  13. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Science.gov (United States)

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  14. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  15. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  16. SHI induced irradiation effect on Mo/Si interface

    International Nuclear Information System (INIS)

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  17. An update on purple urine bag syndrome

    Directory of Open Access Journals (Sweden)

    Hadano Y

    2012-08-01

    Full Text Available Yoshiro Hadano,1 Taro Shimizu,2 Shimon Takada,3 Toshiya Inoue,4 Sumire Sorano51Department of General Internal Medicine and Infectious Diseases, Rakuwakai Otowa Hospital, Yamashina-ku, Kyoto, Japan; 2Rollins School of Public Health, Emory University, Atlanta, GA, USA; 3Department of General Internal Medicine, Osaka City General Hospital, Miyakojima-ku, Osaka, Japan; 4Department of Emergency Medicine, Urasoe General Hospital, Urasoe-city, Okinawa, Japan; 5Kobe University School of Medicine, Kusunokicho, Chuoku, Kobe, JapanAbstract: Purple urine bag syndrome is characterized by the urinary drainage bag turning purple in patients on prolonged urinary catheterization, especially those in the bedridden state. It is associated with bacterial urinary tract infections caused by indigo-producing and indirubin-producing bacteria, usually affects women, and is associated with alkaline urine, constipation, and a high bacterial load in the urine. Almost all patients with purple urine bag syndrome are catheterized due to significant disability, and the urinary pH is 7.0 or more. In general, intensive treatment with antibiotics is not recommended. Purple urine bag syndrome per se almost always appears to be asymptomatic and harmless. However, caution is needed, because some cases have been reported to show progression to severe disease states, so further research into the morbidity and mortality of this infection is warranted.Keywords: purple urine, urinary catheterization, geriatrics, urinary tract infection

  18. Disaster resilience and population ageing: the 1995 Kobe and 2004 Chuetsu earthquakes in Japan.

    Science.gov (United States)

    Chen, Haili; Maki, Norio; Hayashi, Haruo

    2014-04-01

    This paper provides a framework for evaluating the effects of population ageing on disaster resilience. In so doing, it focuses on the 1995 Kobe and 2004 Chuetsu earthquakes, two major disasters that affected Japan before the 2011 Great East Japan earthquake. It analyses regional population recovery on the basis of pre-disaster and post-recovery demographic characteristics using defined transition patterns of population ageing. The evaluation framework demonstrates that various recovery measures make different contributions to disaster resilience for each transition pattern of population ageing. With reference to regional population ageing, the framework allows for a prediction of disaster resilience, facilitating place vulnerability assessments and potentially informing policy-making strategies for Japan and other countries with ageing populations. © 2014 The Author(s). Disasters © Overseas Development Institute, 2014.

  19. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Science.gov (United States)

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  20. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  1. The Ku70/80 ring in Non-Homologous End-Joining: easy to slip on, hard to remove.

    Science.gov (United States)

    Kragelund, Birthe B; Weterings, Eric; Hartmann-Petersen, Rasmus; Keijzers, Guido

    2016-01-01

    Non-homologous end-joining (NHEJ) is an essential DNA double strand break repair pathway during all cell cycle stages. Deficiency in NHEJ factors can lead to accumulation of unrepaired DNA breaks or faulty DNA repair, which may ultimately result in cell death, senescence or carcinogenesis. The Ku70/80 heterodimer is a key-player in the NHEJ pathway and binds to DNA termini with high affinity, where it helps to protect DNA ends from degradation and to recruit other NHEJ factors required for repair. The mechanism of Ku70/80 detachment from the DNA helix after completion of DNA repair is incompletely understood. Some data suggest that certain DNA repair factors are ubiquitylated and targeted for proteasomal degradation after repair. Recent studies suggest that Ku80 is conjugated to lysine48-linked ubiquitin chains by the Skp1-Cullin-F-box (SCF) complex and/or the RING finger protein 8 (RNF8) ubiquitin-protein ligases, followed by rapid proteasomal degradation. In this review we address the structure and function of the Ku70/80 heterodimer and how ubiquitylation may affect the release of Ku70/80 from chromatin and its subsequent degradation via the ubiquitin-proteasome system.

  2. An integrated Ka/Ku-band payload for personal, mobile and private business communications

    Science.gov (United States)

    Hayes, Edward J.; Keelty, J. Malcolm

    1991-01-01

    The Canadian Department of Communications has been studying options for a government-sponsored demonstration payload to be launched before the end of the century. A summary of the proposed system concepts and network architectures for providing an advanced private business network service at Ku-band and personal and mobile communications at Ka-band is presented. The system aspects addressed include coverage patterns, traffic capacity, and grade of service, multiple access options as well as special problems, such as Doppler in mobile applications. Earth terminal types and the advanced payload concept proposed in a feasibility study for the demonstration mission are described. This concept is a combined Ka-band/Ku-band payload which incorporates a number of advanced satellite technologies including a group demodulator to convert single-channel-per-carrier frequency division multiple access uplink signals to a time division multiplex downlink, on-board signal regeneration, and baseband switching to support packet switched data operation. The on-board processing capability of the payload provides a hubless VSAT architecture which permits single-hop full mesh interconnectivity. The Ka-band and Ku-band portions of the payload are fully integrated through an on-board switch, thereby providing the capability for fully integrated services, such as using the Ku-band VSAT terminals as gateway stations for the Ka-band personal and mobile communications services.

  3. Coexposure to benzo[a]pyrene plus UVA induced DNA double strand breaks: visualization of Ku assembly in the nucleus having DNA lesions

    International Nuclear Information System (INIS)

    Toyooka, Tatsushi; Ibuki, Yuko; Koike, Manabu; Ohashi, Norio; Takahashi, Sentaro; Goto, Rensuke

    2004-01-01

    Benzo[a]pyrene (BaP) is a ubiquitous environmental pollutant with potential carcinogenicity. It has been shown that BaP, upon UVA irradiation, synergistically induced oxidative DNA damage, but other DNA damage was not confirmed. In this study, we examined whether coexposure to BaP plus UVA induces double strand breaks (DSBs) using xrs-5 cells, deficient in the repair of DSBs (Ku80 mutant), and whether Ku translocates involving the formation of DSBs. BaP plus UVA had a significant cytotoxic effect on CHO-K1 cells and an even more drastic effect on Ku80-deficient, xrs-5 cells, suggesting that the DSBs were generated by coexposure to BaP plus UVA. The DSBs were repaired in CHO-K1 cells within 30 min, but not in xrs-5 cells, indicating the involvement of a non-homologous end joining, which needs Ku proteins. Furthermore, we succeeded in visualizing that Ku80 rapidly assembled to the exposed region, in which DSBs might be generated, and clarified that the presence of both Ku70 and Ku80 was important for their accumulation

  4. Radiation effects on radiation-hardened KU and KS-4V optical fibres

    International Nuclear Information System (INIS)

    Ivanov, A.A.; Tugarinov, S.N.; Kaschuck, Y.A.; Krasilnikov, A.V.; Bender, S.E.

    1999-01-01

    The aim of this work was to test the un-pretreated and the hardened (H 2 -loaded and pre-irradiated) KS-4V and KU optical fibres in reactor environment by in-situ measurements of both the radiation-induced loss and the luminescence in the visible spectral region. Both the radio-luminescent and the transmission spectra were in-situ detected during irradiation by charge-coupled-device (CCD) linear detector in the visible spectral region of 400 to 700 nm. The radiation induced loss spectra at the fast neutron fluence of 2*10 6 n/cm 2 shows the hardened, H 2 -loading and pre-irradiating effects in the both KU and KS-4V fibres. KU un-pretreated fibre shows a big radiation absorption band of non-bridging oxygen centered at the wavelength of 630 nm. It appears that the KS-4V hardened fibre has a specific point in the loss spectrum in the vicinity of 460 nm. Other measurements were performed, particularly after reactor shutdown and at 3 different neutron fluences with constant neutron flux after restarting

  5. On the data between the ratio of new supply houses at four tenures in Japan. At 47 prefectures and 80 cities; 300,000 and more population on 1995; Shinsetsu chako jutaku no riyo kankeibetsu deta. 47 todofuken and 80 toshi (jinko 300,000 nin 'heisei 7 {center_dot} kokucho' ijo narabini kencho shozaishi)(1993 {approx} 1997)

    Energy Technology Data Exchange (ETDEWEB)

    Iida, Toshihiko; Kojina, Kyoji

    1999-03-01

    On the owned tenure, the average construction-started ratio spreaded from 1.15 houses in Amagasaki-shi to 6.30 houses in Hamamatsu-shi during 1983 {approx} 1987, the same values spreaded from 1.42 houses in Amagasaki-shi to 5083 houses in Akita-shi during 1988 {approx} 1992 and the same values spreaded from 1.44 houses in Osaka-shi to 6.67 houses in Aomori-shi during 1993 {approx} 1997. 2nd on the rental tenure, the average construction-started ratio spreaded from 1.88 house in Sakai-shi to 14.32 houses in Ichikawa-shi during 1983 {approx} 1987, the same values spreaded from 3.72 houses in Sakai-shi to 13.93 houses in Kawasaki-shi during 1988 {approx} 1992 and from 2.82 houses in Yokosuka-shi to 9.88 houses in Sendai-shi during 1993 {approx} 1997, espicialy 13.17 houses in Nishinomiya-shi. 3rd on the issued tenure, the average construction-started ratio spreaded from 0.05 houses in Maebashi-shi 0.45 houses in Mito-shi during 1983 {approx} 1992 and from 0.02 houses in Naha-shi to 0.74 houses in Omiya-shi during 1993 {approx} 1997, espicialy 1.00 houses in Nishinomiya-shi. 4th on the for-sale tenure, the average construction-started ratio spraeded from 0.36 houses in Kurashiki-shi 5.65 houses in Kobe-shi during 1983 {approx} 1987, the same values spreaded from 0.89 houses in Iwaki-shi and Fukui-shi to 6.14 houses in Fukuoka-shi during 1988 {approx} 1992 and from 0.63 houses in Kurashiki-shi to 7.51 houses in Urawa-shi during 1993 {approx} 1997, especially 8.66 houses in Nishinomiya-shi. The construction-started hoses of the rental tenure were leading during this fifteen years, but the construction-started houses of the for-sale tenure were increasing recently in Japan, though the same values of the owned tenure were continuing during this periods. At 80 cities the construction-started ratio of the rental tenure spreaded from 2.61 houses in Kitakyushu-shi to 12.01 houses in Hachioji-shi on 1993, the same values spreaded from 2.41 houses in Toyota-shi to 9.98 houses in

  6. Hypoxia downregulates Ku70/80 expression in cervical carcinoma tumors

    International Nuclear Information System (INIS)

    Lara, Pedro Carlos; Lloret, Marta; Clavo, Bernardino; Apolinario, Rosa Maria; Bordon, Elisa; Rey, Agustin; Falcon, Orlando; Alonso, Ana Ruiz; Belka, Claus

    2008-01-01

    Hypoxia may inhibits the NHEJ DNA repair through downregulating Ku70/80 expression and combined with an increased angiogenesis and altered p53 expression would be responsible for tumor progression in cervical carcinoma

  7. The Ku Protein Complex Interacts with YY1, Is Up-Regulated in Human Heart Failure, and Represses α Myosin Heavy-Chain Gene Expression

    Science.gov (United States)

    Sucharov, Carmen C.; Helmke, Steve M.; Langer, Stephen J.; Perryman, M. Benjamin; Bristow, Michael; Leinwand, Leslie

    2004-01-01

    Human heart failure is accompanied by repression of genes such as α myosin heavy chain (αMyHC) and SERCA2A and the induction of fetal genes such as βMyHC and atrial natriuretic factor. It seems likely that changes in MyHC isoforms contribute to the poor contractility seen in heart failure, because small changes in isoform composition can have a major effect on the contractility of cardiac myocytes and the heart. Our laboratory has recently shown that YY1 protein levels are increased in human heart failure and that YY1 represses the activity of the human αMyHC promoter. We have now identified a region of the αMyHC promoter that binds a factor whose expression is increased sixfold in failing human hearts. Through peptide mass spectrometry, we identified this binding activity to be a heterodimer of Ku70 and Ku80. Expression of Ku represses the human αMyHC promoter in neonatal rat ventricular myocytes. Moreover, overexpression of Ku70/80 decreases αMyHC mRNA expression and increases skeletal α-actin. Interestingly, YY1 interacts with Ku70 and Ku80 in HeLa cells. Together, YY1, Ku70, and Ku80 repress the αMyHC promoter to an extent that is greater than that with YY1 or Ku70/80 alone. Our results suggest that Ku is an important factor in the repression of the human αMyHC promoter during heart failure. PMID:15367688

  8. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Directory of Open Access Journals (Sweden)

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  9. Alterations in cellular energy metabolism associated with the antiproliferative effects of the ATM inhibitor KU-55933 and with metformin.

    Directory of Open Access Journals (Sweden)

    Mahvash Zakikhani

    Full Text Available KU-55933 is a specific inhibitor of the kinase activity of the protein encoded by Ataxia telangiectasia mutated (ATM, an important tumor suppressor gene with key roles in DNA repair. Unexpectedly for an inhibitor of a tumor suppressor gene, KU-55933 reduces proliferation. In view of prior preliminary evidence suggesting defective mitochondrial function in cells of patients with Ataxia Telangiectasia (AT, we examined energy metabolism of cells treated with KU-55933. The compound increased AMPK activation, glucose uptake and lactate production while reducing mitochondrial membrane potential and coupled respiration. The stimulation of glycolysis by KU-55933 did not fully compensate for the reduction in mitochondrial functions, leading to decreased cellular ATP levels and energy stress. These actions are similar to those previously described for the biguanide metformin, a partial inhibitor of respiratory complex I. Both compounds decreased mitochondrial coupled respiration and reduced cellular concentrations of fumarate, malate, citrate, and alpha-ketogluterate. Succinate levels were increased by KU-55933 levels and decreased by metformin, indicating that the effects of ATM inhibition and metformin are not identical. These observations suggest a role for ATM in mitochondrial function and show that both KU-55933 and metformin perturb the TCA cycle as well as oxidative phosphorylation.

  10. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Science.gov (United States)

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  11. Prediction of velocity of the wind generation in Kobe City College of Technology; Kobe Kosen ni okeru furyoku hatsuden no yosoku

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, K; Kanemura, M; Amako, K

    1997-11-25

    Wind conditions, such as average wind velocity for 10 minutes, maximum instantaneous wind velocity and wind directions, are measured by the anemometer and anemoscope installed 3m above the roof of the Kobe City College of Technology`s Information Processing Center building, to collect the data necessary to validate possibility of wind power generation, if the wind system is installed in the college site. Monthly availability of power is estimated from the output power characteristics curve for a generator having a rated capacity of 200W and wind velocity data collected for 9 months. It will generate power of only 144kWh, even when operated to give the rated output, or approximately 8.5kWh at the highest in a month, because of availability of wind power limited to around 30% of the total as estimated from the relative frequency distribution. It is therefore desirable to install a number of units having a rated capacity of 200W or else a smaller number of larger units. Assuming that days that give the highest output for 24 hours last 1 month, a power of 54.3kWh will be generated. It is estimated, based on these results, that a hybrid unit, in which a wind power generator installed at a high place is combined with a solar unit, can provide power required for nighttime lighting, if a wind power unit having a rated capacity of 2kW is field-controlled under an optimum condition. 13 figs., 3 tabs.

  12. Klimatizace líhně kuřat

    OpenAIRE

    Petr, Lukáš

    2009-01-01

    Diplomová práce se zabývá návrhem systému klimatizačního zařízení pro prostory s líhněmi kuřat. Práce v úvodu krátce přibližuje problematiku klimatizace, představuje dispozice objektu a nastiňuje požadavky na mikroklima pro správnou inkubaci vajec a líhnutí kuřat. Praktická část diplomové práce se dělí na dva základní úseky, a to výpočtový a návrhový. Výpočtová část se zabývá stanovením množství přiváděného čerstvého klimatizačního vzduchu, výpočtem tepelných ztrát, tepelné zátěže a psychrome...

  13. Role of Ku80-dependent end-joining in delayed genomic instability in mammalian cells surviving ionizing radiation

    International Nuclear Information System (INIS)

    Suzuki, Keiji; Kodama, Seiji; Watanabe, Masami

    2010-01-01

    Ionizing radiation induces delayed destabilization of the genome in the progenies of surviving cells. This phenomenon, which is called radiation-induced genomic instability, is manifested by delayed induction of radiation effects, such as cell death, chromosome aberration, and mutation in the progeny of cells surviving radiation exposure. Previously, there was a report showing that delayed cell death was absent in Ku80-deficient Chinese hamster ovary (CHO) cells, however, the mechanism of their defect has not been determined. We found that delayed induction of DNA double strand breaks and chromosomal breaks were intact in Ku80-deficient cells surviving X-irradiation, whereas there was no sign for the production of chromosome bridges between divided daughter cells. Moreover, delayed induction of dicentric chromosomes was significantly compromised in those cells compared to the wild-type CHO cells. Reintroduction of the human Ku86 gene complimented the defective DNA repair and recovered delayed induction of dicentric chromosomes and delayed cell death, indicating that defective Ku80-dependent dicentric induction was the cause of the absence of delayed cell death. Since DNA-PKcs-defective cells showed delayed phenotypes, Ku80-dependent illegitimate rejoining is involved in delayed impairment of the integrity of the genome in radiation-survived cells.

  14. Role of Ku80-dependent end-joining in delayed genomic instability in mammalian cells surviving ionizing radiation

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Keiji, E-mail: kzsuzuki@nagasaki-u.ac.jp [Course of Life Sciences and Radiation Research, Graduate School of Biomedical Sciences, Nagasaki University, 1-12-4 Sakamoto, Nagasaki 852-8523 (Japan); Kodama, Seiji [Research Institute for Advanced Science and Technology, Osaka Prefecture University, 1-2 Gakuen-machi, Sakai 599-8570 (Japan); Watanabe, Masami [Kyoto University Research Reactor Institute, Kumatori-cho Sennan-gun, Osaka 590-0494 (Japan)

    2010-01-05

    Ionizing radiation induces delayed destabilization of the genome in the progenies of surviving cells. This phenomenon, which is called radiation-induced genomic instability, is manifested by delayed induction of radiation effects, such as cell death, chromosome aberration, and mutation in the progeny of cells surviving radiation exposure. Previously, there was a report showing that delayed cell death was absent in Ku80-deficient Chinese hamster ovary (CHO) cells, however, the mechanism of their defect has not been determined. We found that delayed induction of DNA double strand breaks and chromosomal breaks were intact in Ku80-deficient cells surviving X-irradiation, whereas there was no sign for the production of chromosome bridges between divided daughter cells. Moreover, delayed induction of dicentric chromosomes was significantly compromised in those cells compared to the wild-type CHO cells. Reintroduction of the human Ku86 gene complimented the defective DNA repair and recovered delayed induction of dicentric chromosomes and delayed cell death, indicating that defective Ku80-dependent dicentric induction was the cause of the absence of delayed cell death. Since DNA-PKcs-defective cells showed delayed phenotypes, Ku80-dependent illegitimate rejoining is involved in delayed impairment of the integrity of the genome in radiation-survived cells.

  15. Návrh zásobníku na sypký vápenný hydrát

    OpenAIRE

    Perna, Marek

    2009-01-01

    Tato diplomová práce řeší návrh hlubokého zásobníku na sypký vápenný hydrát pro technologická zařízení čistíren odpadních vod. Je zde proveden rozbor volby typu a konstrukce zásobníku, návrh rozměrů a pevnostní výpočet zásobníku. Je zde popsána možnost vzniku klenby při vyprazdňování a její potlačení pomocí aktivních a pasivních prvků napomáhající toku. Popis aktivních a pasivních stavů napjatosti materiálu v zásobníku. This diploma thesis is solving systems design of silo for a powdery li...

  16. SHiP: a new multipurpose beam-dump experiment at the SPS.

    CERN Document Server

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  17. Cosmic ray test system for the ATLAS thin gap chamber modules at KOBE

    CERN Document Server

    Suigmoto, T; Arataki, Y; Bando, T; Homma, Y; Ichimiya, R; Ikeno, M; Ishii, K; Ishino, M; Iwasaki, H; Kurashige, H; Mima, T; Miyazaki, Y; Nakagawa, Y; Nakaune, Y; Nozaki, M; Ohshita, H; Okumura, K; Sasaki, O; Suzuki, R; Takeda, H; Takeshita, T; Tanaka, S; Uda, J; Yokoyama, C

    2004-01-01

    Thin gap chamber modules giving function of forward muon trigger to the ATLAS detector in the LHC experiment have been constructed at High Energy Research Organization (KEK) in Japan and their performances have been checked at Kobe University. A large-scale test system specially designed for measuring uniformity of the detection efficiencies and the timing resolution of 8 TGC modules at the same time was successfully operated. Each TGC module had 72 anode wire channels and 64 cathode strip channels (in total 1088 readout channels for 8 modules). Drift tubes consisted of 12 layers (total 428 tubes), between which the TGC modules are put, determined trajectories of cosmic rays. Hit pattern and timing of all detector signals (Trigger counter. Drift tubes and TGCs) were measured by using VME modules. In regular data acquisition situation, i.e. about effective 19 Hz trigger rate from scintillation counters and 73% tracking efficiency by the drift tubes, the detection efficiency of each layer by 5 mm * 5 mm region ...

  18. Loss of MLH1 sensitizes colon cancer cells to DNA-PKcs inhibitor KU60648.

    Science.gov (United States)

    Hinrichsen, Inga; Ackermann, Anne; Düding, Tonja; Graband, Annika; Filmann, Natalie; Plotz, Guido; Zeuzem, Stefan; Brieger, Angela

    2017-07-01

    Germline mutations of MLH1 are responsible for tumor generation in nearly 50% of patients with Lynch Syndrome, and around 15% of sporadic colorectal cancers show MLH1-deficiency due to promotor hypermethylation. Although these tumors are of lower aggressiveness the benefit for these patients from standard chemotherapy is still under discussion. Recently, it was shown that the sensitivity to the DNA-PKcs inhibitor KU60648 is linked to loss of the MMR protein MSH3. However, loss of MSH3 is rather secondary, as a consequence of MMR-deficiency, and frequently detectable in MLH1-deficient tumors. Therefore, we examined the expression of MLH1, MSH2, MSH6, and MSH3 in different MMR-deficient and proficient cell lines and determined their sensitivity to KU60648 by analyzing cell viability and survival. MLH1-dependent ability of double strand break (DSB) repair was monitored after irradiation via γH2AX detection. A panel of 12 colon cancer cell lines, two pairs of cells, where MLH1 knock down was compared to controls with the same genetic background, and one MLH1-deficient cell line where MLH1 was overexpressed, were included. In summary, we found that MLH1 and/or MSH3-deficient cells exhibited a significantly higher sensitivity to KU60648 than MMR-proficient cells and that overexpression of MLH1 in MLH1-deficient cells resulted in a decrease of cell sensitivity. KU60648 efficiency seems to be associated with reduced DSB repair capacity. Since the molecular testing of colon tumors for MLH1 expression is a clinical standard we believe that MLH1 is a much better marker and a greater number of patients would benefit from KU60648 treatment. © 2017 Wiley Periodicals, Inc.

  19. A gamma-ray approach for hidden faults in the disaster zone of 1995 Kobe earthquake

    International Nuclear Information System (INIS)

    Terakado, Y.

    1997-01-01

    Gamma-ray intensities were measured of the ground on an eastern part of the Kobe urban area, where a strong earthquake occurred in January 1995 killing 6000 people, in order to investigate hidden faults and its relation to the damage of constructions. Several linear alignments of relatively high γ-ray intensity points were detected and at least some of them are considered to be ascribed to small-scale faults. It can be pointed out that the localities of such high γ-ray alignments are almost in accordance with those of relatively highly damaged zones. However, a long and distinct high γ-ray alignment as expected for a large fault which runs through the heavy damage belt does not exist beneath the area, supporting non-fault origin for the overall heavy damage belt. (author)

  20. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    DEFF Research Database (Denmark)

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  1. Experimental research on Ku-band magnetically insulated transmission line oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Tao; Zhang, Jiande; He, Juntao; Li, Zhiqiang; Ling, Junpu [College of Optoelectric Science and Engineering, National University of Defense Technology, Hunan 410073 (China)

    2015-10-15

    An improved Ku-band magnetically insulated transmission line oscillator is proposed and investigated experimentally. In the particle-in-cell simulation, the Ku-band MILO generates the microwave with a power of 1.62 GW and a frequency of 13 GHz at the input voltage of 474 kV. The device is fabricated based on the simulation results, and an experiment system is designed. In the preliminary experiments, output microwave with frequency of 13.02 GHz, power of 150 MW, and pulse width of 17 ns is generated, under the diode voltage of 450 kV. Analysis on the experiment results shows that plasma produced due to the large current hitting to the outside of the collection tank is the essential cause for the low amplitude of the microwave power and short pulse width.

  2. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    African Journals Online (AJOL)

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  3. Mre11 and Blm-Dependent Formation of ALT-Like Telomeres in Ku-Deficient Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    Eun Young Yu

    2015-10-01

    Full Text Available A subset of human cancer cells uses a specialized, aberrant recombination pathway known as ALT to maintain telomeres, which in these cells are characterized by complex aberrations including length heterogeneity, high levels of unpaired C-strand, and accumulation of extra-chromosomal telomere repeats (ECTR. These phenotypes have not been recapitulated in any standard budding or fission yeast mutant. We found that eliminating Ku70 or Ku80 in the yeast-like fungus Ustilago maydis results initially in all the characteristic telomere aberrations of ALT cancer cells, including C-circles, a highly specific marker of ALT. Subsequently the ku mutants experience permanent G2 cell cycle arrest, accompanied by loss of telomere repeats from chromosome ends and even more drastic accumulation of very short ECTRs (vsECTRs. The deletion of atr1 or chk1 rescued the lethality of the ku mutant, and "trapped" the telomere aberrations in the early ALT-like stage. Telomere abnormalities are telomerase-independent, but dramatically suppressed by deletion of mre11 or blm, suggesting major roles for these factors in the induction of the ALT pathway. In contrast, removal of other DNA damage response and repair factors such as Rad51 has disparate effects on the ALT phenotypes, suggesting that these factors process ALT intermediates or products. Notably, the antagonism of Ku and Mre11 in the induction of ALT is reminiscent of their roles in DSB resection, in which Blm is also known to play a key role. We suggest that an aberrant resection reaction may constitute an early trigger for ALT telomeres, and that the outcomes of ALT are distinct from DSB because of the unique telomere nucleoprotein structure.

  4. Mycobacterial UvrD1 is a Ku-dependent DNA helicase that plays a role in multiple DNA repair events, including double-strand break repair.

    Science.gov (United States)

    Sinha, Krishna Murari; Stephanou, Nicolas C; Gao, Feng; Glickman, Michael S; Shuman, Stewart

    2007-05-18

    Mycobacterium tuberculosis and other bacterial pathogens have a Ku-dependent nonhomologous end joining pathway of DNA double-strand break repair. Here we identify mycobacterial UvrD1 as a novel interaction partner for Ku in a genome-wide yeast two-hybrid screen. UvrD1 per se is a vigorous DNA-dependent ATPase but a feeble DNA helicase. Ku stimulates UvrD1 to catalyze ATP-dependent unwinding of 3'-tailed DNAs. UvrD1, Ku, and DNA form a stable ternary complex in the absence of ATP. The Ku binding determinants are located in the distinctive C-terminal segment of UvrD1. A second mycobacterial paralog, UvrD2, is a vigorous Ku-independent DNA helicase. Ablation of UvrD1 sensitizes Mycobacterium smegmatis to killing by ultraviolet and ionizing radiation and to a single chromosomal break generated by I-SceI endonuclease. The physical and functional interactions of bacterial Ku and UvrD1 highlight the potential for cross-talk between components of nonhomologous end joining and nucleotide excision repair pathways.

  5. The SHiP physics program

    Science.gov (United States)

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  6. Low density lipoprotein receptor gene Ava II polymorphism and serum lipid levels in the Guangxi Bai Ku Yao and Han populations

    Directory of Open Access Journals (Sweden)

    Wu Dong-Feng

    2011-02-01

    Full Text Available Abstract Background Several common genetic polymorphisms in the low density lipoprotein receptor (LDL-R gene have associated with modifications of serum total cholesterol (TC and low density lipoprotein cholesterol (LDL-C levels, but the results are not consistent in different populations. Bai Ku Yao is a special subgroup of the Yao minority in China. The present study was undertaken to detect the association of LDL-R gene Ava Ⅱ polymorphism and serum lipid levels in the Guangxi Bai Ku Yao and Han populations. Methods A total of 1024 subjects of Bai Ku Yao and 792 participants of Han Chinese were randomly selected from our previous stratified randomized cluster samples. Genotyping of the LDL-R gene Ava Ⅱ polymorphism was performed by polymerase chain reaction and restriction fragment length polymorphism combined with gel electrophoresis, and then confirmed by direct sequencing. Results The levels of serum TC, high density lipoprotein cholesterol (HDL-C, LDL-C, apolipoprotein (Apo A1 and the ratio of ApoA1 to ApoB were lower in Bai Ku Yao than in Han (P - and A+ alleles was 65.5% and 34.5% in Bai Ku Yao, and 80.7% and 19.3% in Han (P -A-, A-A+ and A+A+ genotypes was 42.6%, 45.9% and 11.5% in Bai Ku Yao, and 64.9%, 31.6% and 3.5% in Han (P P 3.20 mmol/L subgroups in Bai Ku Yao (P P P P +A+ genotype had higher serum LDL-C, TC, HDL-C or ApoA1 levels than the subjects with A-A+ and A-A- genotypes. Spearman rank correlation analysis revealed that the levels of LDL-C in Bai Ku Yao and HDL-C in Han were correlated with genotypes (P P Conclusions The association of LDL-R gene Ava Ⅱ polymorphism and serum lipid levels is different between the Bai Ku Yao and Han populations. The discrepancy might partly result from different LDL-R gene Ava Ⅱ polymorphism or LDL-R gene-enviromental interactions.

  7. DNA requirements for interaction of the C-terminal region of Ku80 with the DNA-dependent protein kinase catalytic subunit (DNA-PKcs).

    Science.gov (United States)

    Radhakrishnan, Sarvan Kumar; Lees-Miller, Susan P

    2017-09-01

    Non-homologous end joining (NHEJ) is the major pathway for the repair of ionizing radiation induced DNA double strand breaks (DSBs) in human cells. Critical to NHEJ is the DNA-dependent interaction of the Ku70/80 heterodimer with the DNA-dependent protein kinase catalytic subunit (DNA-PKcs) to form the DNA-PK holoenzyme. However, precisely how Ku recruits DNA-PKcs to DSBs ends to enhance its kinase activity has remained enigmatic, with contradictory findings reported in the literature. Here we address the role of the Ku80 C-terminal region (CTR) in the DNA-dependent interaction of Ku70/80 with DNA-PKcs using purified components and defined DNA structures. Our results show that the Ku80 CTR is required for interaction with DNA-PKcs on short segments of blunt ended 25bp dsDNA or 25bp dsDNA with a 15-base poly dA single stranded (ss) DNA extension, but this requirement is less stringent on longer dsDNA molecules (35bp blunt ended dsDNA) or 25bp duplex DNA with either a 15-base poly dT or poly dC ssDNA extension. Moreover, the DNA-PKcs-Ku complex preferentially forms on 25 bp DNA with a poly-pyrimidine ssDNA extension.Our work clarifies the role of the Ku80 CTR and dsDNA ends on the interaction of DNA-PKcs with Ku and provides key information to guide assembly and biology of NHEJ complexes. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Absence of hemolytic disease of fetus and newborn despite maternal high-titer IgG anti-Ku.

    Science.gov (United States)

    Kakaiya, R M; Whaley, A; Howard-Menk, C; Rami, J; Papari, M; Campbell-Lee, S; Malecki, Z

    2010-01-01

    Anti-Ku seen in K(o) (Kell-null) individuals has previously been shown to cause severe hemolytic transfusion reactions. Maternal anti-Ku can cause none or moderate to severe hemolytic disease of the fetus and newborn (HDFN). In two of four previously described HDFN cases, intrauterine transfusions were required because of severe anemia. We report a case in which maternal anti-Ku did not cause HDFN. Standard serologic methods were used for RBC antibody screening and identification, adsorption and elution of RBC antibodies, and antigen typing. A gravida 3, para 3 (G3P3) woman was first evaluated in 2006 and was found to have an IgG RBC antibody that reacted against all panel RBCs in the anti-human globulin phase. A panel of RBCs treated with DTT did not react with the antibody. The antibody failed to react with one example of K(o) RBCs. The patient’s RBCs typed negative for the following Kell blood group antigens: KEL1, KEL2, KEL3, KEL4, KEL6, KEL7, KEL11, KEL13, and KEL18. These results established the presence of anti-Ku in maternal serum. The newborn was group A, D+ and required phototherapy for hyperbilirubinemia, but did not require transfusion. The woman was seen again in January 2010 during the third trimester (G4P3). At this time, anti-Ku titer was 256. She delivered a healthy group O, D+ baby boy at 37 weeks' gestation. Cord RBCs were 4+ for IgG by DAT. An eluate reacted with all RBCs tested, but did not react when tested against a panel of DTT-treated RBCs. K(o) phenotype is rare to begin with, and the maternal anti-Ku formation may require more than one pregnancy. Therefore, cases that can be evaluated for anti-Ku–related HDFN are rare. Our case contributes to serologic and clinical aspects of such rare cases.

  9. Oxidative DNA Damage in Neurons: Implication of Ku in Neuronal Homeostasis and Survival

    Directory of Open Access Journals (Sweden)

    Daniela De Zio

    2012-01-01

    Full Text Available Oxidative DNA damage is produced by reactive oxygen species (ROS which are generated by exogenous and endogenous sources and continuously challenge the cell. One of the most severe DNA lesions is the double-strand break (DSB, which is mainly repaired by nonhomologous end joining (NHEJ pathway in mammals. NHEJ directly joins the broken ends, without using the homologous template. Ku70/86 heterodimer, also known as Ku, is the first component of NHEJ as it directly binds DNA and recruits other NHEJ factors to promote the repair of the broken ends. Neurons are particularly metabolically active, displaying high rates of transcription and translation, which are associated with high metabolic and mitochondrial activity as well as oxygen consumption. In such a way, excessive oxygen radicals can be generated and constantly attack DNA, thereby producing several lesions. This condition, together with defective DNA repair systems, can lead to a high accumulation of DNA damage resulting in neurodegenerative processes and defects in neurodevelopment. In light of recent findings, in this paper, we will discuss the possible implication of Ku in neurodevelopment and in mediating the DNA repair dysfunction observed in certain neurodegenerations.

  10. Superconducting magnet for a Ku-band maser.

    Science.gov (United States)

    Berwin, R.; Wiebe, E.; Dachel, P.

    1972-01-01

    A superconducting magnet to provide a uniform magnetic field of up to 8000 G in a 1.14-cm gap for the 15.3-GHz (Ku-band) traveling wave maser is described. The magnet operates in a persistent mode in the vacuum environment of a closed-cycle helium refrigerator (4.5 K). The features of a superconducting switch, which has both leads connected to 4.5 K heat stations and thereby does not receive heat generated by the magnet charging leads, are described.

  11. DASCH ON KU Cyg: A ∼ 5 YEAR DUST ACCRETION EVENT IN ∼ 1900

    International Nuclear Information System (INIS)

    Tang Sumin; Grindlay, Jonathan; Los, Edward; Servillat, Mathieu

    2011-01-01

    KU Cyg is an eclipsing binary consisting of an F-type star accreting through a large accretion disk from a K5III red giant. Here we present the discovery of a 5 year dip around 1900 found from its 100 year DASCH light curve. It showed a ∼0.5 mag slow fading from 1899 to 1903 and brightened back around 1904 on a relatively shorter timescale. The light curve shape of the 1899-1904 fading-brightening event differs from the dust production and dispersion process observed in R Coronae Borealis stars, which usually has a faster fading and slower recovery, and for KU Cyg is probably related to the accretion disk surrounding the F star. The slow fading in KU Cyg is probably caused by increases in dust extinction in the disk, and the subsequent quick brightening may be due to the evaporation of dust transported inward through the disk. The extinction excess which caused the fading may arise from increased mass transfer rate in the system or from dust clump ejections from the K giant.

  12. Characterization of the roles of the catalytic domains of Mycobacterium tuberculosis ligase D in Ku-dependent error-prone DNA end joining.

    Science.gov (United States)

    Wright, Douglas; DeBeaux, Austin; Shi, Runhua; Doherty, Aidan J; Harrison, Lynn

    2010-09-01

    We previously established an Escherichia coli strain capable of re-circularizing linear plasmid DNA by expressing the Mycobacterium tuberculosis Ku (Mt-Ku) and Mycobacterium tuberculosis ligase D (Mt-LigD) proteins from the E.coli chromosome. Repair was predominately mutagenic due to deletions at the termini. We hypothesized that these deletions could be due to a nuclease activity of Mt-LigD that was previously detected in vitro. Mt-LigD has three domains: an N-terminal polymerase domain (PolDom), a central domain with 3'-phosphoesterase and nuclease activity and a C-terminal ligase domain (LigDom). We generated bacterial strains expressing Mt-Ku and mutant versions of Mt-LigD. Plasmid re-circularization experiments in bacteria showed that the PolDom alone had no re-circularization activity. However, an increase in the total and accurate repair was found when the central domain was deleted. This provides further evidence that this central domain does have nuclease activity that can generate deletions during repair. Deletion of only the PolDom of Mt-LigD resulted in a complete loss of accurate repair and a significant reduction in total repair. This is in agreement with published in vitro work indicating that the PolDom is the major Mt-Ku-binding site. Interestingly, the LigDom alone was able to re-circularize plasmid DNA but only in an Mt-Ku-dependent manner, suggesting a potential second site for Ku-LigD interaction. This work has increased our understanding of the mutagenic repair by Mt-Ku and Mt-LigD and has extended the in vitro biochemical experiments by examining the importance of the Mt-LigD domains during repair in bacteria.

  13. Oil Slick Observation at Low Incidence Angles in Ku-Band

    Science.gov (United States)

    Panfilova, M. A.; Karaev, V. Y.; Guo, Jie

    2018-03-01

    On the 20 April 2010 the oil platform Deep Water Horizon in the Gulf of Mexico suffered an explosion during the final phases of drilling an exploratory well. As a result, an oil film covered the sea surface area of several thousand square kilometers. In the present paper the data of the Ku-band Precipitation Radar, which operates at low incidence angles, were used to explore the oil spill event. The two-scale model of the scattering surface was used to describe radar backscatter from the sea surface. The algorithm for retrieval of normalized radar cross section at nadir and the total slope variance of large-scale waves compared to the wavelength of electromagnetic wave (22 mm) was developed for the Precipitation Radar swath. It is shown that measurements at low incidence angles can be used for oil spill detection. This is the first time that the dependence of mean square slope of large-scale waves on wind speed has been obtained for oil slicks from Ku-band data, and compared to mean square slope obtained by Cox and Munk from optical data.

  14. Ku70 is required for late B cell development and immunoglobulin heavy chain class switching.

    Science.gov (United States)

    Manis, J P; Gu, Y; Lansford, R; Sonoda, E; Ferrini, R; Davidson, L; Rajewsky, K; Alt, F W

    1998-06-15

    Immunoglobulin (Ig) heavy chain (HC) class switch recombination (CSR) is a late B cell process that involves intrachromosomal DNA rearrangement. Ku70 and Ku80 form a DNA end-binding complex required for DNA double strand break repair and V(D)J recombination. Ku70(-/-) (K70T) mice, like recombination activating gene (RAG)-1- or RAG-2-deficient (R1T or R2T) mice, have impaired B and T cell development at an early progenitor stage, which is thought to result at least in part from defective V(D)J recombination (Gu, Y., K.J. Seidl, G.A. Rathbun, C. Zhu, J.P. Manis, N. van der Stoep, L. Davidson, H.L. Cheng, J.M. Sekiguchi, K. Frank, et al. 1997. Immunity. 7:653-665; Ouyang, H., A. Nussenzweig, A. Kurimasa, V.C. Soares, X. Li, C. Cordon-Cardo, W. Li, N. Cheong, M. Nussenzweig, G. Iliakis, et al. 1997. J. Exp. Med. 186:921-929). Therefore, to examine the potential role of Ku70 in CSR, we generated K70T mice that carry a germline Ig HC locus in which the JH region was replaced with a functionally rearranged VH(D)JH and Ig lambda light chain transgene (referred to as K70T/HL mice). Previously, we have shown that B cells from R1T or R2T mice carrying these rearranged Ig genes (R1T/HL or R2T/HL mice) can undergo CSR to IgG isotypes (Lansford, R., J. Manis, E. Sonoda, K. Rajewsky, and F. Alt. 1998. Int. Immunol. 10:325-332). K70T/HL mice had significant numbers of peripheral surface IgM+ B cells, which generated serum IgM levels similar to those of R2T/HL mice. However, in contrast to R2T/HL mice, K70T/HL mice had no detectable serum IgG isotypes. In vitro culture of K70T/HL B cells with agents that induce CSR in normal or R2T/HL B cells did lead to the induction of germline CH transcripts, indicating that initial signaling pathways for CSR were intact in K70T/HL cells. However, treatment with such agents did not lead to detectable CSR by K70T/HL B cells, and instead, led to cell death within 72 h. We conclude that Ku70 is required for the generation of B cells that have

  15. 'SON-GO-KU' : a dream of automated library

    Science.gov (United States)

    Sato, Mamoru; Kishimoto, Juji

    In the process of automating libraries, the retrieval of books through the browsing of shelves is being overlooked. The telematic library is a document based DBMS which can deliver the content of books by simulating the browsing process. The retrieval actually simulates the process a person would use in selecting a book in a real library, where a visual presentation using a graphic display is substituted. The characteristics of prototype system "Son-Go-Ku" for such retrieval implemented in 1988 are mentioned.

  16. Design of a Ku band miniature multiple beam klystron

    Energy Technology Data Exchange (ETDEWEB)

    Bandyopadhyay, Ayan Kumar, E-mail: ayan.bandyopadhyay@gmail.com; Pal, Debasish; Kant, Deepender [Microwave Tubes Division, CSIR-CEERI, Pilani, Rajasthan-333031 (India); Saini, Anil; Saha, Sukalyan; Joshi, Lalit Mohan

    2016-03-09

    The design of a miniature multiple beam klystron (MBK) working in the Ku-band frequency range is presented in this article. Starting from the main design parameters, design of the electron gun, the input and output couplers and radio frequency section (RF-section) are presented. The design methodology using state of the art commercial electromagnetic design tools, analytical formulae as well as noncommercial design tools are briefly presented in this article.

  17. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Directory of Open Access Journals (Sweden)

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  18. Analysis of metals in asphaltenes of KU-46 by PIXE analysis; Analisis de metales en asfaltenos de crudo mexicano KU-46 por PIXE

    Energy Technology Data Exchange (ETDEWEB)

    Navidad G, P.; Pina L, L.I.; Lopez M, J.; Ramirez T, J.J.; Aspiazu F, J.A.; Romero G, E.T. [Gerencia de Ciencias Basicas, Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2002-07-01

    The content of metals of the asphaltenes obtained from the KU-46 mexican crude with n-heptane was evaluated. The found metals in higher concentration are transition metals as well as the vanadium, nickel, copper and zinc. Moreover the sulfur in high concentrations was quantified. The metallic content of the asphaltenes revealed that the crude contains a lower quantity of metals unlike the vacuum residue previously analysed. (Author)

  19. Neutrino physics with the SHiP experiment

    CERN Document Server

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  20. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  1. The SHiP project at CERN

    Science.gov (United States)

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  2. The SHiP experiment at CERN

    Science.gov (United States)

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  3. Analysis of a Compact Wideband Slotted Antenna for Ku Band Applications

    Directory of Open Access Journals (Sweden)

    M. R. Ahsan

    2014-01-01

    Full Text Available The design procedure and physical module of a compact wideband patch antenna for Ku band application are presented in this paper. Finite element method based on 3D electromagnetic field solver has been utilized for the designing and analyzing process of proposed microstrip line fed modified E-H shaped electrically small patch antenna. After successful completion of the design process through various simulations, the proposed antenna has been fabricated on printed circuit board (PCB and its characteristics have been studied. The parameters of the proposed antenna prototype have been measured in standard far-field rectangular shape anechoic measurement compartment. It is apparent from the measured antenna parameters that the proposed antenna achieved almost stable variation of radiation pattern over the entire operational band with 1380 MHz of -10 dB return loss bandwidth. The maximum gain of 7.8 dBi and 89.97% average efficiency within the operating band from 17.15 GHz to 18.53 GHz ensure the suitability of the proposed antenna for Ku band applications.

  4. Kuřim–the largest small town in the South-Moravian Region (Czechia)

    Czech Academy of Sciences Publication Activity Database

    Vaishar, Antonín

    2015-01-01

    Roč. 8, č. 8 (2015), s. 135-147 ISSN 2084-5456 Institutional support: RVO:68145535 Keywords : small town * suburbanization * Kuřim Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://annalesgeo.up.krakow.pl/article/view/2839/2502

  5. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Institute of Scientific and Technical Information of China (English)

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  6. Synergistic effects of methyl methanesulfonate and X rays in inducing somatic mutations in the stamen hairs of Tradescantia clones, KU 27 and BNL 4430

    International Nuclear Information System (INIS)

    Ichikawa, Sadao; Yamaguchi, Akihiko; Okumura, Mikiko

    1993-01-01

    Young influorescences of Tradescantia clones KU 27 and BNL 4430, the both of which are blue/pink heterozygotes and have been demonstrated to be highly sensitive to alkylating agents, were exposed either to aqueous solutions of methyl methanesulfonate (MMS) for 16 hr alone (at 0.005 to 0.02% for KU 27 and at 0.005% for BNL 4430) or to acute 150 kVp X rays alone (161 to 531 mGy for Ku 27 and 501 to 976 mGy for BNL 4430), or in combinations (134 to 448 mGy for KU 27 and 458 to 865 mGy for BNL 4430 after the 0.005% MMS treatment). The induced somatic pink mutation frequencies per hair-cell division were studied and compared, and clone BNL 4430 was found to be nearly two times more sensitive to MMS than clone KU 27, while the X-ray-induced mutation frequencies in the latter was about 1.5 times higher than those in the former. The lower sensitivity to MMS of clone KU 27 (as compared with BNL 4430) was nevertheless about 5.6 times higher as compared with the responses of clone BNL 02 to MMS reported earlier, proving the high sensitivities of the two clones used in the present study. Clear synergistic effects of MMS and X rays were observed in the both clones, indicating that the mechanisms of inducing mutations are common at least in part between MMS and X rays. (author)

  7. Search for hidden particles with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  8. The SHiP experiment at CERN SPS

    CERN Document Server

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  9. Vecāku pedagoģiskās kompetences pilnveide pirmsskolas izglītības iestāde

    OpenAIRE

    Vītola, Aija

    2015-01-01

    Maģistra darba autore Aija Vītola. Maģistra darba nosaukums „Vecāku pedagoģiskās kompetences pilnveide pirmsskolas izglītības iestādē”. Maģistra darba mērķis: izpētīt vecāku pedagoģiskās kompetences pilnveides iespējas pirmsskolas izglītības iestādē. Darba zinātniski teorētisko daļu veido: 1,5 – 3 gadus vecu bērnu personības attīstības likumsakarības, problēmas, ar kurām vecāki sastopas, bērnam uzsākot gaitas pirmsskolas izglītības iestādē, kompetences jēdziens, būtība, veidi, vecāku ...

  10. Differential gene expression in a DNA double-strand-break repair mutant XRS-5 defective in Ku80. Analysis by cDNA microarray

    International Nuclear Information System (INIS)

    Chan, John Y.H.; Chen, Lung-Kun; Chang, Jui-Feng

    2001-01-01

    The ability of cells to rejoin DNA double-strand breaks (DSBs) usually correlates with their radiosensitivity. This correlation has been demonstrated in radiosensitive cells, including the Chinese hamster ovary mutant XRS-5. XRS-5 is defective in a DNA end-binding protein, Ku80, which is a component of a DNA-dependent protein kinase complex used for joining strand breaks. However, Ku80-deficient cells are known to be retarded in cell proliferation and growth as well as other yet to be identified defects. Using custom-made 600-gene cDNA microarray filters, we found differential gene expressions between the wild-type and XRS-5 cells. Defective Ku80 apparently affects the expression of several repair genes, including topoisomerase-I and -IIA, ERCC5, MLH1, and ATM. In contrast, other DNA repair-associated genes, such as GADD45A, EGR1 MDM2 and p53, were not affected. In addition, for large numbers of growth-associated genes, such as cyclins and clks, the growth factors and cytokines were also affected. Down-regulated expression was also found in several categories of seemingly unrelated genes, including apoptosis, angiogenesis, kinase and signaling, phosphatase, stress protein, proto-oncogenes and tumor suppressors, transcription and translation factors. A RT-PCR analysis confirmed that the XRS-5 cells used were defective in Ku80 expression. The diversified groups of genes being affected could mean that Ku80, a multi-functional DNA-binding protein, not only affects DNA repair, but is also involved in transcription regulation. Our data, taken together, indicate that there are specific genes being modulated in Ku80- deficient cells, and that some of the DNA repair pathways and other biological functions are apparently linked, suggesting that a defect in one gene could have global effects on many other processes. (author)

  11. Differential gene expression in a DNA double-strand-break repair mutant XRS-5 defective in Ku80. Analysis by cDNA microarray

    Energy Technology Data Exchange (ETDEWEB)

    Chan, John Y.H.; Chen, Lung-Kun; Chang, Jui-Feng [National Yang Ming Univ., Taipei, Taiwan (China). Inst. of Radiological Sciences] (and others)

    2001-12-01

    The ability of cells to rejoin DNA double-strand breaks (DSBs) usually correlates with their radiosensitivity. This correlation has been demonstrated in radiosensitive cells, including the Chinese hamster ovary mutant XRS-5. XRS-5 is defective in a DNA end-binding protein, Ku80, which is a component of a DNA-dependent protein kinase complex used for joining strand breaks. However, Ku80-deficient cells are known to be retarded in cell proliferation and growth as well as other yet to be identified defects. Using custom-made 600-gene cDNA microarray filters, we found differential gene expressions between the wild-type and XRS-5 cells. Defective Ku80 apparently affects the expression of several repair genes, including topoisomerase-I and -IIA, ERCC5, MLH1, and ATM. In contrast, other DNA repair-associated genes, such as GADD45A, EGR1 MDM2 and p53, were not affected. In addition, for large numbers of growth-associated genes, such as cyclins and clks, the growth factors and cytokines were also affected. Down-regulated expression was also found in several categories of seemingly unrelated genes, including apoptosis, angiogenesis, kinase and signaling, phosphatase, stress protein, proto-oncogenes and tumor suppressors, transcription and translation factors. A RT-PCR analysis confirmed that the XRS-5 cells used were defective in Ku80 expression. The diversified groups of genes being affected could mean that Ku80, a multi-functional DNA-binding protein, not only affects DNA repair, but is also involved in transcription regulation. Our data, taken together, indicate that there are specific genes being modulated in Ku80- deficient cells, and that some of the DNA repair pathways and other biological functions are apparently linked, suggesting that a defect in one gene could have global effects on many other processes. (author)

  12. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Science.gov (United States)

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  13. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Science.gov (United States)

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  14. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  15. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  16. The radiosensitizing effect of Ku70/80 knockdown in MCF10A cells irradiated with X-rays and p(66)+Be(40) neutrons.

    Science.gov (United States)

    Vandersickel, Veerle; Mancini, Monica; Slabbert, Jacobus; Marras, Emanuela; Thierens, Hubert; Perletti, Gianpaolo; Vral, Anne

    2010-04-27

    A better understanding of the underlying mechanisms of DNA repair after low- and high-LET radiations represents a research priority aimed at improving the outcome of clinical radiotherapy. To date however, our knowledge regarding the importance of DNA DSB repair proteins and mechanisms in the response of human cells to high-LET radiation, is far from being complete. We investigated the radiosensitizing effect after interfering with the DNA repair capacity in a human mammary epithelial cell line (MCF10A) by lentiviral-mediated RNA interference (RNAi) of the Ku70 protein, a key-element of the nonhomologous end-joining (NHEJ) pathway. Following irradiation of control and Ku-deficient cell lines with either 6 MV X-rays or p(66)+Be(40) neutrons, cellular radiosensitivity testing was performed using a crystal violet cell proliferation assay. Chromosomal radiosensitivity was evaluated using the micronucleus (MN) assay. RNAi of Ku70 caused downregulation of both the Ku70 and the Ku80 proteins. This downregulation sensitized cells to both X-rays and neutrons. Comparable dose modifying factors (DMFs) for X-rays and neutrons of 1.62 and 1.52 respectively were obtained with the cell proliferation assay, which points to the similar involvement of the Ku heterodimer in the cellular response to both types of radiation beams. After using the MN assay to evaluate chromosomal radiosensitivity, the obtained DMFs for X-ray doses of 2 and 4 Gy were 2.95 and 2.66 respectively. After neutron irradiation, the DMFs for doses of 1 and 2 Gy were 3.36 and 2.82 respectively. The fact that DMFs are in the same range for X-rays and neutrons confirms a similar importance of the NHEJ pathway and the Ku heterodimer for repairing DNA damage induced by both X-rays and p(66)+Be(40) neutrons. Interfering with the NHEJ pathway enhanced the radiosensitivity of human MCF10A cells to low-LET X-rays and high-LET neutrons, pointing to the importance of the Ku heterodimer for repairing damage induced by both

  17. A novel coaxial Ku-band transit radiation oscillator without external guiding magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Junpu, E-mail: lingjunpu@163.com; Zhang, Jiande; He, Juntao; Jiang, Tao [College of Photoelectric Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

    2014-02-15

    A novel coaxial transit radiation oscillator without external guiding magnetic field is designed to generate high power microwave at Ku-band. By using a coaxial structure, the space-charge potential energy is suppressed significantly, that is good for enhancing efficient beam-wave interaction. In order to improve the transmission stability of the unmagnetized intense relativistic electron beam, a Pierce-like cathode is employed in the novel device. By contrast with conventional relativistic microwave generators, this kind of device has the advantages of high stability, non-guiding magnetic field, and high efficiency. Moreover, with the coaxial design, it is possible to improve the power-handing capacity by increasing the radial dimension of the Ku-band device. With a 550 keV and 7.5 kA electron beam, a 1.25 GW microwave pulse at 12.08 GHz has been obtained in the simulation. The power conversion efficiency is about 30%.

  18. Oral hyaluronan relieves wrinkles: a double-blinded, placebo-controlled study over a 12-week period

    OpenAIRE

    Oe, Mariko; Sakai, Seigo; Yoshida, Hideto; Okado, Nao; Kaneda, Haruna; Masuda, Yasunobu; Urushibata, Osamu

    2017-01-01

    Mariko Oe,1 Seigo Sakai,1 Hideto Yoshida,1 Nao Okado,1 Haruna Kaneda,1 Yasunobu Masuda,1 Osamu Urushibata2 1R&D Division, Kewpie Corporation, Sengawa-cho, Chofu-shi, 2Department of Dermatology, Toho University Ohashi Medical Center, Ohashi, Meguro-ku, Tokyo, Japan Background: Hyaluronan (HA) has critical moisturizing property and high water retention capacity especially for human skin. This study aimed to evaluate the effect of oral intake of HA. Methods: The mean molecular weight (MW...

  19. PAXX Is an Accessory c-NHEJ Factor that Associates with Ku70 and Has Overlapping Functions with XLF

    Directory of Open Access Journals (Sweden)

    Satish K. Tadi

    2016-10-01

    Full Text Available In mammalian cells, classical non-homologous end joining (c-NHEJ is critical for DNA double-strand break repair induced by ionizing radiation and during V(DJ recombination in developing B and T lymphocytes. Recently, PAXX was identified as a c-NHEJ core component. We report here that PAXX-deficient cells exhibit a cellular phenotype uncharacteristic of a deficiency in c-NHEJ core components. PAXX-deficient cells display normal sensitivity to radiomimetic drugs, are proficient in transient V(DJ recombination assays, and do not shift toward higher micro-homology usage in plasmid repair assays. Although PAXX-deficient cells lack c-NHEJ phenotypes, PAXX forms a stable ternary complex with Ku bound to DNA. Formation of this complex involves an interaction with Ku70 and requires a bare DNA extension for stability. Moreover, the relatively weak Ku-dependent stimulation of LIG4/XRCC4 activity by PAXX is unmasked by XLF ablation. Thus, PAXX plays an accessory role during c-NHEJ that is largely overlapped by XLF’s function.

  20. Pirmsskolas vecuma bērnu vecāku emocionālais intelekts un stresa līmenis saistībā ar vecāku audzināšanas pieejām

    OpenAIRE

    Pastare, Ilze

    2007-01-01

    Rezumējums Pētījuma mērķis bija noskaidrot pirmsskolas vecuma bērnu vecāku emocionālā intelekta un stresa līmeņa rādītāju saistību ar audzināšanas pieejām. Kopā pētījumā piedalījās 41 māte. Vidējais vecums mātēm – 33 gadi, bērnu vidējais vecums – 5 gadi. Pētījumā tika izmantotas šādas metodes: “ Bar-On Emocionālā intelekta aptauja”, “Vecāku stresa indekss”, “ Alabamas audzināšanas aptaujas pirmsskolas versija”. Pētījumā tika noskaidrots, ka pastāv statistiski nozīmīga po...

  1. Volba řešitelských strategií v závislosti na věku

    Directory of Open Access Journals (Sweden)

    Petr Eisenmann

    2017-12-01

    Full Text Available Příspěvek popisuje experiment, který byl součástí dlouhodobého výzkumu Rozvíjení kultury řešení matematických problémů ve školské praxi. Experiment byl proveden na vzorku celkem 584 respondentů ve věku 11–17 let a mapuje vývoj ve volbě řešitelských strategií matematických úloh u různých věkových skupin žáků. Žákům 6. a 8. ročníku základní školy, I. a III. ročníku střední školy byly předloženy tři úlohy, které se dají efektivně řešit pomocí heuristických strategií. Kromě úspěšnosti řešení úloh byla věnována pozornost také způsobu jejich řešení. Výsledkem experimentu je zjištění, že existují heuristické strategie, které žáci použili při řešení úloh i přesto, že s nimi ve výuce nebyli seznámeni. U některých z nich se jejich výskyt nemění v závislosti na věku.

  2. SHiP: a new facility to search for heavy neutrinos and study $\

    CERN Document Server

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  3. Analysis of metals in asphaltenes of KU-46 by PIXE analysis

    International Nuclear Information System (INIS)

    Navidad G, P.; Pina L, L.I.; Lopez M, J.; Ramirez T, J.J.; Aspiazu F, J.A.; Romero G, E.T.

    2002-01-01

    The content of metals of the asphaltenes obtained from the KU-46 mexican crude with n-heptane was evaluated. The found metals in higher concentration are transition metals as well as the vanadium, nickel, copper and zinc. Moreover the sulfur in high concentrations was quantified. The metallic content of the asphaltenes revealed that the crude contains a lower quantity of metals unlike the vacuum residue previously analysed. (Author)

  4. Isolation and characterization of cDNA encoding the 80-kDa subunit protein of the human autoantigen Ku (p70/p80) recognized by autoantibodies from patients with scleroderma-polymyositis overlap syndrome

    International Nuclear Information System (INIS)

    Mimori, Tsuneyo; Ohosone, Yasuo; Hama, Nobuaki; Suwa, Akira; Akizuki, Masashi; Homma, Mitsuo; Griffith, A.J.; Hardin, J.A.

    1990-01-01

    Anti-Ku (p70/p80) autoantibodies in patients with scleroderma-polymyositis overlap syndrome recognize a 70-kDa/80-kDa protein heterodimer which binds to terminal regions of double-stranded DNA. In the present study, the authors isolated full-length cDNAs that encode the 80-kDa Ku subunit. Initial screening of a human spleen cDNA library with anti-Ku antibodies yielded a cDNA of 1.0 kilobase (kb) (termed K71) encoding a portion of the 80-kDa Ku polypeptide (identification based on immunological criteria). In RNA blots, this cDNA hybridized with two mRNAs of 3.4 and 2.6 kb. In vitro transcription and translation experiments produced an immunoprecipitable polypeptide which comigrated with the 80-kDa Ku subunit. The Ku80-6 cDNA proved to be 3304 nucleotides in length, with an additional poly(A) tail, closely approximating the size of the larger mRNA. It contains a single long open reading frame encoding 732 amino acids. The putative polypeptide has a high content of acidic amino acids and a region with periodic repeat of leucine in every seventh position which may form the leucine zipper structure. In genomic DNA blots, probes derived from the opposite ends of cDNA Ku80-6 hybridized with several nonoverlapping restriction fragments from human leukocyte DNA, indicating that the gene encoding the 80-kDa Ku polypeptide is divided into several exons by intervening sequences

  5. Renewal of KU-FEL Facility

    CERN Document Server

    Kii, Toshiteru; Masuda, Kai; Murakami, Shio; Ohgaki, Hideaki; Yamazaki, Tetsuo; Yoshikawa, Kiyoshi; Zen, Heishun

    2004-01-01

    Users demands to a high power tunable IR laser are increasing in Japan in energy-related science, such as basic study of high-efficiency solar cells, generation of new energy source of alcohol and/or H2 from polluted gas, and separation of DNA and/or RNA. To satisfy these demands, we decided to renew our FEL facility more user friendly and to operate more flexibly. Construction and fundamental studies on the KU-FEL have been carried out at a building of Institute of Chemical Research where few other accelerators are operating. Therefore, available machine time for our experiments is quite limited. We are now modifying the room by adding concrete walls of 2-m thickness and some space for users will be available. The present FEL system will be moved to the room A photocathode RF-gun system will be nearly added to the system and the present thermionic RF-gun will be used ternatively according to the demands of users. The photocathode material will be Cs2Te. The room with the shielding will be completed in June, ...

  6. Why investors shy away from coal

    International Nuclear Information System (INIS)

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  7. Experimental demonstration of a Ku-band radial-line relativistic klystron oscillator based on transition radiation

    Science.gov (United States)

    Dang, Fangchao; Zhang, Xiaoping; Zhang, Jun; Ju, Jinchuan; Zhong, Huihuang

    2017-03-01

    We report on a radial-line relativistic klystron oscillator (RL-RKO), which is physically designed to generate gigawatt-level high power microwaves (HPMs) at Ku-band. The 3π/4 mode of a four-gap buncher is selected to highly modulate the radially propagating intense relativistic electron beam (IREB). A three-gap extractor operating at the π mode is employed to extract the radio-frequency energy efficiently. The Ku-band RL-RKO is investigated experimentally on an intense-current electron beam accelerator. The radially propagating IREB is well focused with an axial-width of 2 mm by a radial magnetic field of 0.4 T. Microwaves with a frequency of 14.86 GHz and a power of 1.5 GW are generated, corresponding to an efficiency of 24%, which indicates a significant advance for the research of radial-line HPM sources.

  8. [Professor Wacław Kuśnierczyk (1908-1997)--Pro Memoria in the century of birthday].

    Science.gov (United States)

    Brozek, Krzysztof; Kozakiewicz, Jacek; Kierzek, Andrzej

    2009-01-01

    Wacław Kuśnierczyk was born in 1908 in Sniatyń. He received the degree in medicine at Jan Kazimierz University in Lwów in 1932. He did his PhD degree under Professor Zaleski supervision in 1938 at Jan Kazimierz University. At that time he concentrated his scientific activity on research on tuberculosis. In 1953 he obtained the title of second degree specialist in ear, nose and throat diseases. He became a chief of Otolaryngology at Urban Hospital No 4 in Katowice in 1960. Since then this eminent physician was working on tumours located in upper respiratory tract and the possibility of its endoscopic diagnosis at Silesian Academy of Medicine in Katowice. As one of the first he pointed out the negative influence of smoking cigarettes on cancer of larynx. It was Wacław Kuśnierczyk who implemented new priorities for integrated programs in patient care, research, education and cancer prevention. He has published widely in peer reviewed journals and has edited or contributed to many books. He has given many major lectures and is the recipient of numerous prestigious awards for his scientific accomplishments. The achievement of Professor Kuśnierczyk were the valuable source of information for the physicians. In 1997, on the 31st of January he died in Katowice.

  9. Effect of Ku80 deficiency on mutation frequencies and spectra at a LacZ reporter locus in mouse tissues and cells.

    Directory of Open Access Journals (Sweden)

    Rita A Busuttil

    Full Text Available Non-homologous end joining (NHEJ is thought to be an important mechanism for preventing the adverse effects of DNA double strand breaks (DSBs and its absence has been associated with premature aging. To investigate the effect of inactivated NHEJ on spontaneous mutation frequencies and spectra in vivo and in cultured cells, we crossed a Ku80-deficient mouse with mice harboring a lacZ-plasmid-based mutation reporter. We analyzed various organs and tissues, as well as cultured embryonic fibroblasts, for mutations at the lacZ locus. When comparing mutant with wild-type mice, we observed a significantly higher number of genome rearrangements in liver and spleen and a significantly lower number of point mutations in liver and brain. The reduced point mutation frequency was not due to a decrease in small deletion mutations thought to be a hallmark of NHEJ, but could be a consequence of increased cellular responses to unrepaired DSBs. Indeed, we found a substantial increase in persistent 53BP1 and gammaH2AX DNA damage foci in Ku80-/- as compared to wild-type liver. Treatment of cultured Ku80-deficient or wild-type embryonic fibroblasts, either proliferating or quiescent, with hydrogen peroxide or bleomycin showed no differences in the number or type of induced genome rearrangements. However, after such treatment, Ku80-deficient cells did show an increased number of persistent DNA damage foci. These results indicate that Ku80-dependent repair of DNA damage is predominantly error-free with the effect of alternative more error-prone pathways creating genome rearrangements only detectable after extended periods of time, i.e., in young adult animals. The observed premature aging likely results from a combination of increased cellular senescence and an increased load of stable, genome rearrangements.

  10. Ku-band electromagnetic wave absorbing properties of polysiloxane derived Si-O-C bulk ceramics

    Science.gov (United States)

    Ding, Donghai; Li, Zipei; Xiao, Guoqing; Yang, Shaoyu

    2018-02-01

    The bulk Si-O-C ceramics were prepared by polymer derived ceramics (PDCs) route using polysiloxane as precursor and their properties were investigated for electromagnetic wave absorbing in the frequency range of 12.4-18 GHz (Ku-band). It was found that the catalytic pyrolysis can enhance substantially the absorbing properties by in situ formation of turbostratic carbon network, ordered carbon, and multi-wall carbon nanotubes. The matching thickness of sample containing 1.5 wt% FeCl3 (FPSO-1.5) is 2.2 mm, and its reflection loss exceeds -10 dB in the whole Ku-band with an absorption peak of -35.48 dB at 14.16 GHz. For sample containing 1.5 wt% FeCl3, its absorption peak increases to -15.78 dB, but its matching thickness decreases significantly to 2.2 mm. The polymer derived Si-O-C ceramics could be used as excellent electromagnetic functional devices working in harsh environments.

  11. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    International Nuclear Information System (INIS)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  12. NEDO Forum 2001. Session on development of geothermal energy (Prospect of geothermal energy); NEDO Forum 2001. Chinetsu kaihatsu session (chinetsu energy no tenbo)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-09-20

    The presentations made at the above-named session of the NEDO (New Energy and Industrial Technology Development Organization) forum held in Tokyo on September 20, 2001, are collected in this report. Director Noda of Institute for Geo-Resources and Environment, National Institute of Advanced Industrial Science and Technology, delivered a lecture entitled 'Future course of geothermal technology development,' and Executive Director Iikura of Tokyo Toshi Kaihatsu, Inc., a lecture entitled 'Thinking of geothermal energy.' Described in an achievement report entitled 'Present state and future trend of geothermal development' were the present state of geothermal power generation and characteristics of geothermal energy, signification of the introduction of binary cycle power generation, and the promotion of the introduction of ground heat utilizing heat pump systems. Stated in a lecture entitled 'Geothermal development promotion survey' were the geothermal development promotion survey and its result and how to implement such surveys in the future. Reported in a lecture entitled 'Verification survey of geothermal energy probing technology and the like and the development of geothermal water utilizing power plant and the like' were reservoir fluctuation probing, deep-seated thermal resource probing and collecting, 10-MW class demonstration plant, Measurement While Drilling System, and a hot rock power generation system. (NEDO)

  13. Suppression of the asymmetric competition mode in the relativistic Ku-band coaxial transit-time oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Junpu; He, Juntao; Zhang, Jiande; Jiang, Tao; Wang, Lei [College of Optoelectronic Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

    2014-10-15

    A relativistic Ku-band coaxial transit-time oscillator has been proposed in our previous work. In the experiments, we find that the asymmetric competition mode in the device limits the microwave power with the increase of the input electric power. For solving such a problem, the methods for analysis and suppression of the asymmetric competition mode in the device are investigated theoretically and experimentally. It is shown that the structure and the material of the collector, the concentricity, and the electron emission uniformity play an important part in the suppression of the asymmetric competition mode in the relativistic Ku-band transit-time oscillator. In the subsequent experiments, the asymmetric mode was suppressed effectively. At a low guiding magnetic field of 0.7 T, a microwave pulse with power of 1 GW, frequency of 14.3 GHz close to the simulation one, and efficiency of 20% was generated.

  14. Expression of Mycobacterium tuberculosis Ku and Ligase D in Escherichia coli results in RecA and RecB-independent DNA end-joining at regions of microhomology.

    Science.gov (United States)

    Malyarchuk, Svitlana; Wright, Douglas; Castore, Reneau; Klepper, Emily; Weiss, Bernard; Doherty, Aidan J; Harrison, Lynn

    2007-10-01

    Unlike Escherichia coli, Mycobacterium tuberculosis (Mt) expresses a Ku-like protein and an ATP-dependent DNA ligase that can perform non-homologous end-joining (NHEJ). We have expressed the Mt-Ku and Mt-Ligase D in E. coli using an arabinose-inducible promoter and expression vectors that integrate into specific sites in the E. coli chromosome. E. coli strains have been generated that express the Mt-Ku and Mt-Ligase D on a genetic background that is wild-type for repair, or deficient in either the RecA or RecB protein. Transformation of these strains with linearized plasmid DNA containing a 2bp overhang has demonstrated that expression of both the Mt-Ku and Mt-Ligase D is required for DNA end-joining and that loss of RecA does not prevent this double-strand break repair. Analysis of the re-joined plasmid has shown that repair is predominantly inaccurate and results in the deletion of sequences. Loss of RecB did not prevent the formation of large deletions, but did increase the amount of end-joining. Sequencing the junctions has revealed that the majority of the ligations occurred at regions of microhomology (1-4bps), eliminating one copy of the homologous sequence at the junction. The Mt-Ku and Mt-Ligase D can therefore function in E. coli to re-circularize linear plasmid.

  15. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  16. Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.

    Science.gov (United States)

    Hu, Chih-Bo; Malaphan, Wanna; Zendo, Takeshi; Nakayama, Jiro; Sonomoto, Kenji

    2010-07-01

    Enterocin X, composed of two antibacterial peptides (Xalpha and Xbeta), is a novel class IIb bacteriocin from Enterococcus faecium KU-B5. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually. In E. faecium strains that produce enterocins A and B, such as KU-B5, only one additional bacteriocin had previously been known.

  17. Initial assessment of an airborne Ku-band polarimetric SAR.

    Energy Technology Data Exchange (ETDEWEB)

    Raynal, Ann Marie; Doerry, Armin Walter

    2013-02-01

    Polarimetric synthetic aperture radar (SAR) has been used for a variety of dual-use research applications since the 1940s. By measuring the direction of the electric field vector from radar echoes, polarimetry may enhance an analysts understanding of scattering effects for both earth monitoring and tactical surveillance missions. Polarimetry may provide insight into surface types, materials, or orientations for natural and man-made targets. Polarimetric measurements may also be used to enhance the contrast between scattering surfaces such as man-made objects and their surroundings. This report represents an initial assessment of the utility of, and applications for, polarimetric SAR at Ku-band for airborne or unmanned aerial systems.

  18. Izrada 3D modela kućišta centrifugalne pumpe

    OpenAIRE

    Hršak, Božidar; Golubić, Stjepan; Carek, Dalibor

    2012-01-01

    Prikazana je izrada 3D modela kućišta centrifugalne pumpe na temelju postojećeg 2D nacrta gotovog proizvoda primjenom sinkrone tehnologije 3D modeliranja, i reverzibilnog inženjeringa. Na temelju kreiranog 3D modela, predložene su moguće modifikacije postojeće izvedbe proizvoda. Provedene su analize zakrivljenosti površina, Bézierove krivulje modela i 3D geometrije. Prikazana je i mogućnost vizualizacije gotovog 3D modela na Web stranicama u cilju prezentiranja proizvoda budućim kupcima primj...

  19. Enterocin X, a Novel Two-Peptide Bacteriocin from Enterococcus faecium KU-B5, Has an Antibacterial Spectrum Entirely Different from Those of Its Component Peptides▿

    Science.gov (United States)

    Hu, Chih-Bo; Malaphan, Wanna; Zendo, Takeshi; Nakayama, Jiro; Sonomoto, Kenji

    2010-01-01

    Enterocin X, composed of two antibacterial peptides (Xα and Xβ), is a novel class IIb bacteriocin from Enterococcus faecium KU-B5. When combined, Xα and Xβ display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually. In E. faecium strains that produce enterocins A and B, such as KU-B5, only one additional bacteriocin had previously been known. PMID:20418437

  20. EPR study of gamma and neutron irradiation effects on KU1, KS-4V and Infrasil 301 silica glasses

    International Nuclear Information System (INIS)

    Lagomacini, Juan C.; Bravo, David; Leon, Monica; Martin, Piedad; Ibarra, Angel; Martin, Agustin; Lopez, Fernando J.

    2011-01-01

    Electron paramagnetic resonance (EPR) studies have been carried out on KU1 and KS-4V high purity quartz glasses and commercial silica Infrasil 301, irradiated with gamma rays up to a dose of 11.6 MGy and neutron fluences of 10 21 and 10 22 n/m 2 . Gamma irradiations produce a much higher concentration of defect centres (mainly E', POR and NBOHC) for KU1 and I301 than for KS-4V silica. In contrast, neutron irradiation at the highest fluence produces similar concentrations in all silica types. These results agree to a good extent with those obtained in previous optical absorption measurements. Moreover, oxygen-related centres (POR and NBOHC) have been well characterized by means of electron paramagnetic resonance.

  1. EPR study of gamma and neutron irradiation effects on KU1, KS-4V and Infrasil 301 silica glasses

    Energy Technology Data Exchange (ETDEWEB)

    Lagomacini, Juan C., E-mail: jc.lagomacini@uam.es [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Bravo, David [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Leon, Monica; Martin, Piedad; Ibarra, Angel [Materiales para Fusion, CIEMAT, Avda. Complutense 22, E-28040 Madrid (Spain); Martin, Agustin [Dept. Fisica e Instalaciones, ETS Arquitectura UPM, E-28040 Madrid (Spain); Lopez, Fernando J. [Dept. Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain)

    2011-10-01

    Electron paramagnetic resonance (EPR) studies have been carried out on KU1 and KS-4V high purity quartz glasses and commercial silica Infrasil 301, irradiated with gamma rays up to a dose of 11.6 MGy and neutron fluences of 10{sup 21} and 10{sup 22} n/m{sup 2}. Gamma irradiations produce a much higher concentration of defect centres (mainly E', POR and NBOHC) for KU1 and I301 than for KS-4V silica. In contrast, neutron irradiation at the highest fluence produces similar concentrations in all silica types. These results agree to a good extent with those obtained in previous optical absorption measurements. Moreover, oxygen-related centres (POR and NBOHC) have been well characterized by means of electron paramagnetic resonance.

  2. The Shock and Vibration Digest. Volume 16, Number 6

    Science.gov (United States)

    1984-06-01

    Meuurement of Rigid Body Modes for Dynamic Deagn N. Okuboand T. Furukawa CAMAL Chuo Univ., Tokyo, Japan, Intl. Modal Analysis Conf., Proc. 2nd, Orlando... CAMAL , Chuo Univ., Tokyo, Japan, Intl. VV :ä\\ Analysis Conf., Proc. 2nd, Orlando, FL, Feh ö-Q. 1984, Spons. by Union College

  3. Comparative Assessment of Women Farmers' Status in Japan and ...

    African Journals Online (AJOL)

    The research compared the status of Japanese and Nigerian women farmers. The study was conducted in Sera Chuo, Hiroshima and Ohnan Chuo, Shimane prefecture, Chugoku region of Japan and Southwestern part of Nigeria covering three locations (Omi-Adio, Ijaye and Kila) within the suburban area of Ibadan ...

  4. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Science.gov (United States)

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  5. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Science.gov (United States)

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  6. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Science.gov (United States)

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  7. Alternative end-joining catalyzes robust IgH locus deletions and translocations in the combined absence of ligase 4 and Ku70.

    Science.gov (United States)

    Boboila, Cristian; Jankovic, Mila; Yan, Catherine T; Wang, Jing H; Wesemann, Duane R; Zhang, Tingting; Fazeli, Alex; Feldman, Lauren; Nussenzweig, Andre; Nussenzweig, Michel; Alt, Frederick W

    2010-02-16

    Class switch recombination (CSR) in B lymphocytes is initiated by introduction of multiple DNA double-strand breaks (DSBs) into switch (S) regions that flank immunoglobulin heavy chain (IgH) constant region exons. CSR is completed by joining a DSB in the donor S mu to a DSB in a downstream acceptor S region (e.g., S gamma1) by end-joining. In normal cells, many CSR junctions are mediated by classical nonhomologous end-joining (C-NHEJ), which employs the Ku70/80 complex for DSB recognition and XRCC4/DNA ligase 4 for ligation. Alternative end-joining (A-EJ) mediates CSR, at reduced levels, in the absence of C-NHEJ, even in combined absence of Ku70 and ligase 4, demonstrating an A-EJ pathway totally distinct from C-NHEJ. Multiple DSBs are introduced into S mu during CSR, with some being rejoined or joined to each other to generate internal switch deletions (ISDs). In addition, S-region DSBs can be joined to other chromosomes to generate translocations, the level of which is increased by absence of a single C-NHEJ component (e.g., XRCC4). We asked whether ISD and S-region translocations occur in the complete absence of C-NHEJ (e.g., in Ku70/ligase 4 double-deficient B cells). We found, unexpectedly, that B-cell activation for CSR generates substantial ISD in both S mu and S gamma1 and that ISD in both is greatly increased by the absence of C-NHEJ. IgH chromosomal translocations to the c-myc oncogene also are augmented in the combined absence of Ku70 and ligase 4. We discuss the implications of these findings for A-EJ in normal and abnormal DSB repair.

  8. [Association between daily lifestyle and the risk of metabolic syndrome among young adults in Japan. An analysis of Kobe city young adult health examination data].

    Science.gov (United States)

    Soga, Youji; Shirai, Chika; Ijichi, Akihiro

    2013-02-01

    Appropriate lifestyle modifications through health guidance and other methods are known to be effective in preventing lifestyle-related diseases. Furthermore, early intervention is key. To examine the association between daily lifestyle and the risk of metabolic syndrome among young adults in Japan, we analyzed data from the Kobe City Young Adult Health Examination. We examined 4,912 adults aged 30 to 39 years to identify the association between daily lifestyle and the risk of metabolic syndrome. Daily lifestyle was assessed from 11 lifestyle-related items in the questionnaire administered during the health exam. The Standard Health Exam and Guidance Program by the Ministry of Health and Labor was used to determine the risks of abdominal obesity, hypertension, diabetes, and hypercholesterolemia. Having a risk related to metabolic syndrome was defined as having a risk of abdominal obesity combined with a risk of hypertension, diabetes, or hypercholesterolemia. We also evaluated the stages of behavioral change in those who possessed a risk of metabolic syndrome, as well as their willingness to receive health guidance. Eating quickly had a significantly greater association with-risk of metabolic syndrome, for both sexes, than eating slowly or at a normal pace. For women, smoking, skipping breakfast more than three days a week, and eating supper within two hours before going to bed for more than three days a week were associated with risk of metabolic syndrome. A multiple regression analysis showed that skipping breakfast (P adults in their thirties in Kobe, irregular eating habits seemed to be associated with risk of metabolic syndrome. Furthermore, their intention to/awareness of the need to change their behavior and their willingness to receive health guidance were rather strong. Thus, for the "Tokutei kenshin (specific national health checkup system)" to achieve its objective of preventing lifestyle-related diseases more effectively than at present, the target

  9. A wideband superconducting filter at Ku-band based on interdigital coupling

    Science.gov (United States)

    Jiang, Ying; Wei, Bin; Cao, Bisong; Li, Qirong; Guo, Xubo; Jiang, Linan; Song, Xiaoke; Wang, Xiang

    2018-04-01

    In this paper, an interdigital-type resonator with strong electric coupling is proposed for the wideband high-frequency (>10 GHz) filter design. The proposed microstrip resonator consists of an H-shaped main line part with its both ends installed with interdigital finger parts. Strong electric coupling is achieved between adjacent resonators. A six-pole high-temperature superconducting filter at Ku-band using this resonator is designed and fabricated. The filter has a center frequency of 15.11 GHz with a fractional bandwidth of 30%. The insertion loss of the passband is less than 0.3 dB, and the return loss is greater than 14 dB without any tuning.

  10. A creative approach to the development of an agenda for knowledge utilization: outputs from the 11th international knowledge utilization colloquium (KU 11).

    Science.gov (United States)

    Wilkinson, Joyce E; Rycroft-Malone, Jo; Davies, Huw T O; McCormack, Brendan

    2012-12-01

    A group of researchers and practitioners interested in advancing knowledge utilization met as a colloquium in Belfast (KU 11) and used a "world café" approach to exploit the social capital and shared understanding built up over previous events to consider the research and practice agenda. We considered three key areas of relevance to knowledge use: (1) understanding the nature of research use, influence and impact; (2) blended and collaborative approaches to knowledge production and use; and (3) supporting sustainability and spread of evidence-informed innovations. The approach enabled the development of artifacts that reflected the three areas and these were analyzed using a creative hermeneutic approach. The themes that emerged and which are outlined in this commentary are not mutually exclusive. There was much overlap in the discussions and therefore of the themes, reflecting the complex nature of knowledge translation work. The agenda that has emerged from KU 11 also reflects the participatory and creative approach in which the meeting was structured and focused, and therefore emphasizes the processual, relational and contingent nature of some of the challenges we face. The past 20 years has seen an explosion in activity around understanding KU, and we have learned much about the difficulties. Whilst the agenda for the next decade may be becoming clearer, colloquia such as KU 11, using creative and engaging approaches, have a key role to play in dissecting, articulating and sharing that agenda. In this way, we also build an ever-expanding international community that is dedicated to working towards increasing the chances of success for better patient care. © 2012 Sigma Theta Tau International.

  11. First reliability test of a surface micromachined microengine using SHiMMeR

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  12. Study of sea-surface slope distribution and its effect on radar backscatter based on Global Precipitation Measurement Ku-band precipitation radar measurements

    Science.gov (United States)

    Yan, Qiushuang; Zhang, Jie; Fan, Chenqing; Wang, Jing; Meng, Junmin

    2018-01-01

    The collocated normalized radar backscattering cross-section measurements from the Global Precipitation Measurement (GPM) Ku-band precipitation radar (KuPR) and the winds from the moored buoys are used to study the effect of different sea-surface slope probability density functions (PDFs), including the Gaussian PDF, the Gram-Charlier PDF, and the Liu PDF, on the geometrical optics (GO) model predictions of the radar backscatter at low incidence angles (0 deg to 18 deg) at different sea states. First, the peakedness coefficient in the Liu distribution is determined using the collocations at the normal incidence angle, and the results indicate that the peakedness coefficient is a nonlinear function of the wind speed. Then, the performance of the modified Liu distribution, i.e., Liu distribution using the obtained peakedness coefficient estimate; the Gaussian distribution; and the Gram-Charlier distribution is analyzed. The results show that the GO model predictions with the modified Liu distribution agree best with the KuPR measurements, followed by the predictions with the Gaussian distribution, while the predictions with the Gram-Charlier distribution have larger differences as the total or the slick filtered, not the radar filtered, probability density is included in the distribution. The best-performing distribution changes with incidence angle and changes with wind speed.

  13. Wpływ wysiłku fizycznego na funkcję układu oddechowego w twardzinie układowej

    Directory of Open Access Journals (Sweden)

    Stanisław Sierakowski

    2010-12-01

    Full Text Available Cel: Powikłania ze strony układu oddechowego stanowią główną przyczynę zgonów pacjentów z twardziną układową (TU. Tętniczenadciśnienie płucne i śródmiąższowa choroba płuc stanowią najistotniejszez nich. Pacjenci są jednak często zdiagnozowani dopierow późnym okresie choroby, dlatego też istotne jest opracowaniemetody diagnostycznej do wczesnego wykrywania tych powikłań.Celem pracy była ocena wpływu wysiłku fizycznego na zmiany parametrówoddechowych. Materiały i metody: Badania przeprowadzono wśród 32 pacjentów zezdiagnozowaną TU; 72% pacjentów miało postać ograniczoną TU,28% postać uogólnioną. Wykonywano pomiar zdolności dyfuzyjnejpłuc dla tlenku węgla (DLCO, natężonej pojemności życiowej (FVC,natężonej objętości wydechowej pierwszosekundowej (FEV1 orazcałkowitej pojemności płuc (TLC w spoczynku oraz bezpośrednio pozakończeniu wysiłku fizycznego. Wyniki: Pod wpływem wysiłku fizycznego obserwowano wzrostDLCO od 59,7% do 68,1% wartości należnej (p < 0,005. Nie stwierdzononatomiast istotnych statystycznie zmian wartości FVC, FEV1oraz TLC. Wnioski: U chorych na TU zdolność dyfuzyjna płuc dla tlenku węglapo wysiłku fizycznym uległa istotnej statystycznie poprawiew porównaniu z wartościami spoczynkowymi. Związane jest toz koniecznością zapewnienia właściwego utlenowania krwi tętniczeji wynika m.in. ze zwiększenia pojemności łożyska naczyniowego.W klinicznej interpretacji wartości DLCO należy uwzględniać opróczstężenia hemoglobiny i objętości pęcherzykowej także wpływ wysiłkuoraz związane z nim zmiany wielkości objętości rzutu serca.

  14. Evaluation of genetic alteration induced by radon gas using the micronucleus test (Tradescantia sp. clone KU-20)

    International Nuclear Information System (INIS)

    Bruschi, Armando L.; Azevedo, Heliana de; Macacini, Jose F.; Roque, Claudio V.

    2011-01-01

    The first observations over the existence of radon gas (Rn), initially known as 'thorium emanation', were carried out between the end of 19 th and beginning of 20 th centuries. A result of uranium-238 (U 238 ) radioactive decay, radon is a tasteless, odorless and colorless gas under room temperature, with a 3.825-day half life and particle α emission in its decay, and as final product of its disintegration, the stable lead-206 isotope (Pb 206 ). Being it is the gas with the highest density known, closed and poor ventilated environments are favorable to its accumulation, with its inhalation being the highest health risk. The use of vegetal bioindicators has shown to be excellent on the monitoring of air quality and on mutagenic potential of various pollutants contained in the atmosphere. Within this context, the objective of this study was to evaluate the micronucleus test application potential utilizing the Tradescantia sp. clone KU-20, in order to evaluate genetic alterations induced by radon gas. Stems of Tradescantia sp. clone KU-20, previously immerse in Hoagland solution, were introduced in a radon detection equipment's calibration chamber (Alphaguard), containing radium salt. Afterwards, the accommodated stems were exposed to radon gas (the average radon concentration was 7.639 KBq/m3) for 24 hours. The results demonstrated an increase on micronucleus formation (39.23 + 2.143 MCN/100 tetrads) in stems exposed in relation to the negative control (18.00 + 1.396 MCN/100 tetrads). The difference between the values indicated a significant increase on micronucleus frequency in the inflorescences subjected to radon gas. The presented results demonstrated the micronucleus test application potential using Tradescantia clone KU-20 to evaluate genetic effects induced by radon gas. (author)

  15. Improved foilless Ku-band transit-time oscillator for generating gigawatt level microwave with low guiding magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Junpu; He, Juntao, E-mail: hejuntao12@163.com; Zhang, Jiande; Jiang, Tao; Hu, Yi [College of Optoelectronic Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

    2014-09-15

    An improved foilless Ku-band transit-time oscillator with low guiding magnetic field is proposed and investigated in this paper. With a non-uniform buncher and a coaxial TM{sub 02} mode dual-resonant reflector, this improved device can output gigawatt level Ku-band microwave with relatively compact radial dimensions. Besides the above virtue, this novel reflector also has the merits of high TEM reflectance, being more suitable for pre-modulating the electron beam and enhancing the conversion efficiency. Moreover, in order to further increase the conversion efficiency and lower the power saturation time, a depth-tunable coaxial collector and a resonant cavity located before the extractor are employed in our device. Main structure parameters of the device are optimized by particle in cell simulations. The typical simulation result is that, with a 380 kV, 8.2 kA beam guided by a magnetic field of about 0.6 T, 1.15 GW microwave pulse at 14.25 GHz is generated, yielding a conversion efficiency of about 37%.

  16. Apigenin induces apoptosis by targeting inhibitor of apoptosis proteins and Ku70–Bax interaction in prostate cancer

    Science.gov (United States)

    Shukla, Sanjeev; Fu, Pingfu; Gupta, Sanjay

    2014-01-01

    Dysfunction of the apoptotic pathway in prostate cancer cells confers apoptosis resistance towards various therapies. A novel strategy to overcome resistance is to directly target the apoptotic pathway in cancer cells. Apigenin, an anticancer agent, selectively toxic to cancer cells induces cell cycle arrest and apoptosis through mechanisms which are not fully explored. In the present study we provide novel insight into the mechanisms of apoptosis induction by apigenin. Treatment of androgen-refractory human prostate cancer PC-3 and DU145 cells with apigenin resulted in dose-dependent suppression of XIAP, c-IAP1, c-IAP2 and survivin protein levels. Apigenin treatment resulted in significant decrease in cell viability and apoptosis induction with the increase of cytochrome C in time-dependent manner. These effects of apigenin were accompanied by decrease in Bcl-xL and Bcl-2 and increase in the active form of Bax protein. The apigenin-mediated increase in Bax was due to dissociation of Bax from Ku70 which is essential for apoptotic activity of Bax. Apigenin treatment resulted in the inhibition of class I histone deacetylases and HDAC1 protein expression, thereby increasing the acetylation of Ku70 and the dissociation of Bax resulting in apoptosis of cancer cells. Furthermore, apigenin significantly reduced HDAC1 occupancy at the XIAP promoter, suggesting that histone deacetylation might be critical for XIAP downregulation. These results suggest that apigenin targets inhibitor of apoptosis proteins and Ku70–Bax interaction in the induction of apoptosis in prostate cancer cells and in athymic nude mouse xenograft model endorsing its in vivo efficacy. PMID:24563225

  17. Rapid Recruitment of BRCA1 to DNA Double-Strand Breaks Is Dependent on Its Association with Ku80▿ †

    Science.gov (United States)

    Wei, Leizhen; Lan, Li; Hong, Zehui; Yasui, Akira; Ishioka, Chikashi; Chiba, Natsuko

    2008-01-01

    BRCA1 is the first susceptibility gene to be linked to breast and ovarian cancers. Although mounting evidence has indicated that BRCA1 participates in DNA double-strand break (DSB) repair pathways, its precise mechanism is still unclear. Here, we analyzed the in situ response of BRCA1 at DSBs produced by laser microirradiation. The amino (N)- and carboxyl (C)-terminal fragments of BRCA1 accumulated independently at DSBs with distinct kinetics. The N-terminal BRCA1 fragment accumulated immediately after laser irradiation at DSBs and dissociated rapidly. In contrast, the C-terminal fragment of BRCA1 accumulated more slowly at DSBs but remained at the sites. Interestingly, rapid accumulation of the BRCA1 N terminus, but not the C terminus, at DSBs depended on Ku80, which functions in the nonhomologous end-joining (NHEJ) pathway, independently of BARD1, which binds to the N terminus of BRCA1. Two small regions in the N terminus of BRCA1 independently accumulated at DSBs and interacted with Ku80. Missense mutations found within the N terminus of BRCA1 in cancers significantly changed the kinetics of its accumulation at DSBs. A P142H mutant failed to associate with Ku80 and restore resistance to irradiation in BRCA1-deficient cells. These might provide a molecular basis of the involvement of BRCA1 in the NHEJ pathway of the DSB repair process. PMID:18936166

  18. Izrada 3D modela kućišta ravnog ventila DN 50

    OpenAIRE

    Hršak, Božidar; Golubić, Stjepan; Bošnjak, Matej

    2012-01-01

    Prikazana je izrada 3D modela kućišta centrifugalne pumpe na temelju postojećeg 2D nacrta gotovog proizvoda primjenom sinkrone tehnologije 3D modeliranja, i reverzibilnog inženjeringa. Na temelju kreiranog 3D modela, predložene su moguće modifikacije postojeće izvedbe proizvoda. Provedene su analize zakrivljenosti površina, Bézierove krivulje modela i 3D geometrije. Prikazana je i mogućnost vizualizacije gotovog 3D modela na Web stranicama u cilju prezentiranja proizvoda budućim kupcima primj...

  19. Shuttle Ku-band bent-pipe implementation considerations. [for Space Shuttle digital communication systems

    Science.gov (United States)

    Batson, B. H.; Seyl, J. W.; Huth, G. K.

    1977-01-01

    This paper describes an approach for relay of data-modulated subcarriers from Shuttle payloads through the Shuttle Ku-band communications subsystem (and subsequently through a tracking and data relay satellite system to a ground terminal). The novelty is that a channel originally provided for baseband digital data is shown to be suitable for this purpose; the resulting transmission scheme is referred to as a narrowband bent-pipe scheme. Test results demonstrating the validity of the narrowband bent-pipe mode are presented, and limitations on system performance are described.

  20. Detailed modeling of local anisotropy and transverse Ku interplay regarding hysteresis loop in FeCuNbSiB nanocrystalline ribbons

    Science.gov (United States)

    Geoffroy, Olivier; Boust, Nicolas; Chazal, Hervé; Flury, Sébastien; Roudet, James

    2018-04-01

    This article focuses on the modeling of the hysteresis loop featured by Fe-Cu-Nb-Si-B nanocrystalline alloys with transverse induced anisotropy. The magnetization reversal process of a magnetic correlated volume (CV), characterized by the induced anisotropy Ku, and a deviation of the local easy magnetization direction featuring the effect of a local incoherent anisotropy Ki, is analyzed, taking account of magnetostatic interactions. Solving the equations shows that considering a unique typical kind of CV does not enable accounting for both the domain pattern and the coercivity. Actually, the classical majority CVs obeying the random anisotropy model explains well the domain pattern but considering another kind of CVs, minority, mingled with classical ones, featuring a magnitude of Ki comparable to Ku, is necessary to account for coercivity. The model has been successfully compared with experimental data.

  1. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Science.gov (United States)

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  2. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Directory of Open Access Journals (Sweden)

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  3. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    Science.gov (United States)

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  4. Origin of absorption peaks in reflection loss spectrum in Ku- frequency band of Co-Zr substituted strontium hexaferrites prepared using sucrose precursor

    Energy Technology Data Exchange (ETDEWEB)

    Narang, Sukhleen Bindra, E-mail: sukhleen2@yahoo.com [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India); Pubby, Kunal, E-mail: kunalpubby02@gmail.com [Department of Electronics Technology, Guru Nanak Dev University, Amritsar (India); Chawla, S.K., E-mail: sschawla118@gmail.com [Department of Chemistry, Centre for Advanced Studies-I, Guru Nanak Dev University, Amritsar (India); Kaur, Prabhjyot, E-mail: prabhjyot.2525@gmail.com [Department of Chemistry, Centre for Advanced Studies-I, Guru Nanak Dev University, Amritsar (India)

    2017-03-15

    This study presents the detailed explanation of the factors, contributing towards the absorption peaks in reflection loss spectrum of hexaferrites. Cobalt-Zirconium substituted strontium hexaferrites, synthesized using sucrose precursor sol-gel technique, were analyzed in 12.4–18 GHz frequency range. The concepts of impedance matching through quarter wavelength condition, complex thickness, dielectric phase angle and attenuation constant have been used to determine the location as well as intensity of absorption peaks. This study also demonstrates the potential application of three compositions of this series with doping content (x)==0.0, 0.6 and 0.8 as an effective microwave absorbers in Ku-frequency band. - Highlights: • EM analysis of Sr Hexaferrites in Ku-band. • Factors towards absorption peak intensity & location.

  5. Analysis of Standards Efficiency in Digital Television Via Satellite at Ku and Ka Bands

    Directory of Open Access Journals (Sweden)

    Landeros-Ayala Salvador

    2013-06-01

    Full Text Available In this paper, an analysis on the main technical features of digital television standards for satellite transmission is carried out. Based on simulations and link budgets, the standard with the best operational performance is defined, based on simulations and link budget analysis, as well as a comparative efficiency analysis is conducted for the Ku and Ka bands for both transparent and regenerative transponders in terms of power, bandwidth, information rate and link margin, including clear sky, uplink rain, downlink rain and rain in both.

  6. Investigation on the performance of an optically generated RF local oscillator signal in Ku-band DVB-S systems

    NARCIS (Netherlands)

    Khan, M.R.H.; Marpaung, D.A.I.; Burla, M.; Roeloffzen, C.G.H.; Bernhardi, Edward; de Ridder, R.M.

    2011-01-01

    We investigate a way to externally generate the local oscillator (LO) signal used for downconversion of the Ku-band (10.7 − 12.75 GHz) RF signal received from a phased array antenna (PAA). The signal is then translated to an intermediate frequency (950 − 2150 MHz) at the output of the mixer of

  7. The pretreatment of corn stover with Gloeophyllum trabeum KU-41 for enzymatic hydrolysis

    Directory of Open Access Journals (Sweden)

    Gao Ziqing

    2012-05-01

    Full Text Available Abstract Background Pretreatment is an essential step in the enzymatic hydrolysis of biomass for bio-ethanol production. The dominant concern in this step is how to decrease the high cost of pretreatment while achieving a high sugar yield. Fungal pretreatment of biomass was previously reported to be effective, with the advantage of having a low energy requirement and requiring no application of additional chemicals. In this work, Gloeophyllum trabeum KU-41 was chosen for corn stover pretreatment through screening with 40 strains of wood-rot fungi. The objective of the current work is to find out which characteristics of corn stover pretreated with G. trabeum KU-41 determine the pretreatment method to be successful and worthwhile to apply. This will be done by determining the lignin content, structural carbohydrate, cellulose crystallinity, initial adsorption capacity of cellulase and specific surface area of pretreated corn stover. Results The content of xylan in pretreated corn stover was decreased by 43% in comparison to the untreated corn stover. The initial cellulase adsorption capacity and the specific surface area of corn stover pretreated with G. trabeum were increased by 7.0- and 2.5-fold, respectively. Also there was little increase in the cellulose crystallinity of pretreated corn stover. Conclusion G. trabeum has an efficient degradation system, and the results indicated that the conversion of cellulose to glucose increases as the accessibility of cellulose increases due to the partial removal of xylan and the structure breakage of the cell wall. This pretreatment method can be further explored as an alternative to the thermochemical pretreatment method.

  8. Study of the Effect of Simulated Rain on the Offset Parabolic Antenna at Ku-Band with Different Elevation Angles

    Directory of Open Access Journals (Sweden)

    H. Mostafa

    2007-01-01

    Full Text Available Effect of rain on the receiver antenna is a major factor to degrade the system performance in a frequency above 10 GHz. This paper deals with the wet antenna attenuation at Ku-band with three different frequencies at different rain rates. During the Ku-band propagation experiment, it was discovered that rain water on the antenna caused a significant attenuation. It is necessary to estimate the losses caused by water on the antenna in order to separate these losses from the atmospheric propagation losses. The experiment was done at USM Engineering Campus to study the attenuation for these physical parameters. A Ku-band RF signal was generated by a signal generator and transmitted via horn antenna. The signal was received using a smooth offset antenna of 60 cm by 54 cm (Astro dish and measured using spectrum analyzer. In order to simulate a rain, pipes with bores of a same distance were implemented. Three cases were considered: in the first case one pipe was used to simulate low rain rate, the second case two pipes were used to simulate medium rain rate, and the third case three pipes were used to simulate heavy rain rate. In addition, the tap was used to control the flow of water in order to get more values of rain rate. The total attenuation of RF signals due to water layer on the feed and on the reflector feed was found to be 3.1 dB at worst case. On the other hand, the attenuation of RF signal due to the feed only was 2.83 dB, so the major attenuation occur was due to feed.

  9. New uranium chalcoantimonates, RbU{sub 2}SbS{sub 8} and KU{sub 2}SbSe{sub 8}, with a polar noncentrosymmetric structure

    Energy Technology Data Exchange (ETDEWEB)

    Choi, K S; Kanatzidis, M G

    1999-09-01

    The new compounds, RbU{sub 2}SbS{sub 8} and KU{sub 2}SbSe{sub 8}, were prepared as golden-black, blocklike crystals by the polychalcogenide molten flux method. RbU{sub 2}SbS{sub 8} has a two-dimensional character with layers running perpendicular to the c-axis. The coordination geometry around the U{sup 4+} atoms is best described as a bicapped trigonal prism. The trigonal prisms share triangular faces with neighboring prisms, forming one-dimensional columns along the a-axis. The columns are then joined to construct sheets by sharing capping S atoms. Sb{sup 3+} ions are sitting at the center of a slightly distorted seesaw coordination environment (CN = 4). Rb{sup +} ions are stabilized in 8-coordinate bicapped trigonal prismatic sites. KU{sub 2}SbSe{sub 8} has essentially the same structure as RbU{sub 2}SbS{sub 8}. However, Sb{sup 3+} and K{sup +} ions appear disordered in every other layer resulting in a different unit cell. RbU{sub 2}SbS{sub 8} is a semiconductor with a band gap of 1.38 eV. The band gap of KU{sub 2}SbSe{sub 8} could not be determined precisely due to the presence of overlapping intense f-f transitions in the region (0.5--1.1 eV). The Raman spectra show the disulfide stretching vibration in RbU{sub 2}SbS{sub 8} at 479 cm{sup {minus}1} and the diselenide stretching vibration in KU{sub 2}SbSe{sub 8} at 252 cm{sup {minus}1}. Magnetic susceptibility measurements indicate the presence of U{sup 4+} centers in the compounds. The compounds do not melt below 1,000 C under vacuum.

  10. STS-79 Ku-band antenna, ODS and Spacehab module at PCR

    Science.gov (United States)

    1996-01-01

    The orbiter Ku-band antenna looms large in this view of the Space Shuttle Atlantis' payload bay. Visible just past the antenna system -- stowed on the starboard side of the payload bay wall -- is the Orbiter Docking System (ODS), and connected to the ODS via a tunnel is the Spacehab Double Module in the aft area of the payload bay. This photograph was taken from the starboard wing platform on the fifth level of the Payload Changeout Room (PCR) at Launch Pad 39A. Work is under way in the PCR to close Atlantis' payload bay doors for flight. Atlantis currently is being targeted for liftoff on Mission STS-79, the fourth docking of the U.S. Shuttle to the Russian Space Station Mir, around September 12.

  11. Analysis of Fade Dynamic at Ku-Band in Malaysia

    Directory of Open Access Journals (Sweden)

    Siat Ling Jong

    2014-01-01

    Full Text Available This work investigates fade dynamics of satellite communication systems in equatorial heavy rain region based on a one year of Ku-band propagation measurement campaign carried out in Universiti Teknologi Malaysia (UTM, Johor, Malaysia. First order statistics of rain attenuation are deduced and the results are found to be in good agreement with those obtained from other beacon measurements gathered within the same area (Kuala Lumpur. Moreover, the fade duration and slope statistics of the satellite signal variations are also carefully derived and subsequently compared with the ITU-R recommendation model. Such information is useful for the system operator and radio communication engineer for the design of appropriate fade mitigation techniques as well as the quality of service that could be offered to the user (according to the time interval for a typical day. Further evaluation on the performances of several ITU-R models in the heavy rain region are needed based on the measurement database available of this climatic region.

  12. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    Directory of Open Access Journals (Sweden)

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  13. 55K isoform of CDK9 associates with Ku70 and is involved in DNA repair

    International Nuclear Information System (INIS)

    Liu, Hongbing; Herrmann, Christine H.; Chiang, Karen; Sung, Tzu-Ling; Moon, Sung-Hwan; Donehower, Lawrence A.; Rice, Andrew P.

    2010-01-01

    Positive elongation factor b (P-TEFb) is a cellular protein kinase that is required for RNA polymerase II (RNAP II) transcriptional elongation of protein coding genes. P-TEFb is a set of different molecular complexes, each containing CDK9 as the catalytic subunit. There are two isoforms of the CDK9 protein - the major 42 KDa CDK9 isoform and the minor 55KDa isoform that is translated from an in-frame mRNA that arises from an upstream transcriptional start site. We found that shRNA depletion of the 55K CDK9 protein in HeLa cells induces apoptosis and double-strand DNA breaks (DSBs). The levels of apoptosis and DSBs induced by the depletion were reduced by expression of a 55K CDK9 protein variant resistant to the shRNA, indicating that these phenotypes are the consequence of depletion of the 55K protein and not off-target effects. We also found that the 55K CDK9 protein, but not the 42K CDK9 protein, specifically associates with Ku70, a protein involved in DSB repair. Our findings suggest that the 55K CDK9 protein may function in repair of DNA through an association with Ku70.

  14. Criticality features in ultra-low frequency magnetic fields prior to the 2013 M6.3 Kobe earthquake

    Directory of Open Access Journals (Sweden)

    Stelios M. Potirakis

    2016-07-01

    Full Text Available The nonlinear criticality of ultra-low frequency (ULF magnetic variations is investigated before a particular earthquake (EQ occurred in Kobe on April 12, 2013, by applying the “natural time” analysis on a few ULF parameters: Fh, Fz and Dh. The first two refer to radiation from the lithosphere, and the last parameter corresponds to depression of horizontal component as a signature of ionospheric perturbation. A recent paper of our team has indicated, using the same data as in this paper but by means of conventional statistical analysis, a clear effect of depression in the horizontal component as an ionospheric signature. But there seems to be no convincing signature of lithospheric ULF radiation according to the specific analysis, so this paper aims at extending our study on the electromagnetic data recorded prior to the specific EQ by trying to find any significant phenomenon in ULF effects (both lithospheric radiation and the depression of horizontal component using the critical, natural time analysis. The natural time analysis has yielded that criticality at Shigaraki (SGA, as the station closest to the EQ epicenter, is reached on March 27-29 for Fh and March 27 to April 1 for Fz (about two weeks before the EQ. But, the criticality for Dh was not observed at SGA probably due to high noise, on the other hand such criticality was observed at Kanoya (KNY because of its known property of a wider range of detection of ULF depression.

  15. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Directory of Open Access Journals (Sweden)

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  16. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Science.gov (United States)

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  17. Türkiye’de Çalışan Y Kuşağında İş Tatmini-Motivasyon İlişkisi

    OpenAIRE

    Saracel, Nüket; Taşseven, Özlem; Kaynak, Ece

    2016-01-01

    Bilgi çağı olarak nitelenen yirmi birinci yüzyılda, bilgi ve insan organizasyonların en önemli sermayesihaline gelmiştir. Üretim kaynakları içerisinde insanın öneminin artması şirketlerin yönetiminde insangücünün motivasyonu ve iş tatminine ilişkin konuların özel önem taşıyan konular olmasını beraberindegetirmiştir. Birbirlerine yakın zamanlarda doğan insanların benzer özellikler taşıması kuşak kavramınıortaya çıkarmıştır. Her bir kuşağın farklı özelliklerinin olması, organizasyonel sistemler...

  18. Predictive images of postoperative levator resection outcome using image processing software

    Directory of Open Access Journals (Sweden)

    Mawatari Y

    2016-09-01

    Full Text Available Yuki Mawatari,1 Mikiko Fukushima2 1Igo Ophthalmic Clinic, Kagoshima, 2Department of Ophthalmology, Faculty of Life Science, Kumamoto University, Chuo-ku, Kumamoto, Japan Purpose: This study aims to evaluate the efficacy of processed images to predict postoperative appearance following levator resection.Methods: Analysis involved 109 eyes from 65 patients with blepharoptosis who underwent advancement of levator aponeurosis and Müller’s muscle complex (levator resection. Predictive images were prepared from preoperative photographs using the image processing software (Adobe Photoshop®. Images of selected eyes were digitally enlarged in an appropriate manner and shown to patients prior to surgery.Results: Approximately 1 month postoperatively, we surveyed our patients using questionnaires. Fifty-six patients (89.2% were satisfied with their postoperative appearances, and 55 patients (84.8% positively responded to the usefulness of processed images to predict postoperative appearance.Conclusion: Showing processed images that predict postoperative appearance to patients prior to blepharoptosis surgery can be useful for those patients concerned with their postoperative appearance. This approach may serve as a useful tool to simulate blepharoptosis surgery. Keywords: levator resection, blepharoptosis, image processing, Adobe Photoshop® 

  19. Impact of tropospheric scintillation in the Ku/K bands on the communications between two LEO satellites in a radio occultation geometry

    DEFF Research Database (Denmark)

    Martini, Enrica; Freni, A.; Facheris, L.

    2006-01-01

    A theoretical analysis of the impact of clear-air tropospheric scintillation on a radio occultation link between two low Earth orbit satellites in K- and Ku-bands is presented, with particular reference to differential approaches for the measure of the total content of water vapor. The troposphere...

  20. Prokaryotic Homologs of the Eukaryotic 3-Hydroxyanthranilate 3,4-Dioxygenase and 2-Amino-3-Carboxymuconate-6-Semialdehyde Decarboxylase in the 2-Nitrobenzoate Degradation Pathway of Pseudomonas fluorescens Strain KU-7†

    OpenAIRE

    Muraki, Takamichi; Taki, Masami; Hasegawa, Yoshie; Iwaki, Hiroaki; Lau, Peter C. K.

    2003-01-01

    The 2-nitrobenzoic acid degradation pathway of Pseudomonas fluorescens strain KU-7 proceeds via a novel 3-hydroxyanthranilate intermediate. In this study, we cloned and sequenced a 19-kb DNA locus of strain KU-7 that encompasses the 3-hydroxyanthranilate meta-cleavage pathway genes. The gene cluster, designated nbaEXHJIGFCDR, is organized tightly and in the same direction. The nbaC and nbaD gene products were found to be novel homologs of the eukaryotic 3-hydroxyanthranilate 3,4-dioxygenase a...

  1. Chemical compatibility study of Cooley L18KU, Herculite, and Elephant Mat with Hanford tank waste

    International Nuclear Information System (INIS)

    Mercado, J.E.

    1998-01-01

    An independent chemical compatibility review of various wrapping and absorbent/padding materials was conducted to evaluate resistance to chemicals and constituents present in liquid waste from the Hanford underground tanks. These materials will be used to wrap long-length contaminated equipment when such equipment is removed from the tanks and prepared for transportation and subsequent disposal or storage. The materials studied were Cooley L18KU, Herculite, and Elephant Mat. The study concludes that these materials are appropriate for use in this application

  2. Power load leveling and energy saving measures for office buildings. Power load leveling and energy saving technology for the new building of the Kobe branch of the Kansai Electric Power Co., and its effect; Office biru no denryoku fuka heijunka sho energy hosaku. Kobe shiten shinshaoku ni okeru denryoku fuka heijunka sho energy gijutsu to sono koka

    Energy Technology Data Exchange (ETDEWEB)

    Tsuchiyama, M. [Kansai Electric Power Co. Inc., Osaka (Japan)

    1999-06-10

    This paper presents power load leveling and energy saving measures for heat source, air conditioning and lighting of the new Kobe branch building. The low-temperature hot-air system adopts an ice storage system, and reduces blowing power by 12 degreesC blowing in place of normal 16 degreesC blowing, and an initial cost by duct size reduction. The continuous air conditioning system levels an initial peak load of air conditioning as compared with normal air conditioning only for working hours for buildings with large heat capacity. In addition, as power load leveling measures for the whole building, the complete heat storage system using an underground internal melting type ice storage tank is adopted. Energy saving for lighting is achieved with a dimming lighting controlling its lighting output by inverter. The following effects are expected by these new technologies: Load leveling effect of 30%, energy saving effect of 20.2% and CO{sub 2} reduction effect of 24.1%. (NEDO)

  3. Room Temperature Thin Film Ba(x)Sr(1-x)TiO3 Ku-Band Coupled MicrostripPhase Shifters: Effects of Film Thickness, Doping, Annealing and Substrate Choice

    Science.gov (United States)

    VanKeuls, F. W.; Mueller, C. H.; Miranda, F. A.; Romanofsky, R. R.; Canedy, C. L.; Aggarwal, S.; Venkatesan, T.; Ramesh, R.; Horwitz, S.; Chang, W.

    1999-01-01

    We report on measurements taken on over twenty Ku-band coupled microstrip phase shifters (CMPS) using thin ferroelectric films of Ba(x)Sr(1-x)TiO3. This CMPS design is a recent innovation designed to take advantage of the high tunability and tolerate the high dielectric constant of ferroelectric films at Ku- and K-band frequencies. These devices are envisioned as a component in low-cost steerable beam phased area antennas, Comparisons are made between devices with differing film thickness, annealed vs unannealed, Mn-doped vs. undoped, and also substrates of LaAlO3 and MgO. A comparison between the CMPS structure and a CPW phase shifter was also made oil the same ferroelectric film.

  4. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Science.gov (United States)

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  5. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Directory of Open Access Journals (Sweden)

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  6. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    International Nuclear Information System (INIS)

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  7. arXiv Search for new physics with the SHiP experiment at CERN

    CERN Document Server

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  8. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  9. Focusing electrode and coaxial reflector used for reducing the guiding magnetic field of the Ku-band foilless transit-time oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Junpu; Zhang, Jiande; He, Juntao, E-mail: hejuntao12@163.com; Wang, Lei; Deng, Bingfang [College of Optoelectronic Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

    2014-08-15

    Based on the theoretical analysis of the intense relativistic electron beam propagation in the coaxial drift-tube, a focusing electrode and a coaxial reflector is proposed to lessen the demand of the coaxial Ku-band foilless transit-time oscillator (TTO) for the guiding magnetic field. Moreover, a Ku-band TTO with the focusing electrode and the coaxial reflector is designed and studied by particle in cell simulation. When the diode voltage is 390 kV, the beam current 7.8 kA, and the guiding magnetic field is only 0.3 T, the device can output 820 MW microwave pulse at 14.25 GHz by means of the simulation. However, for the device without them, the output power is only 320 MW. The primary experiments are also carried out. When the guiding magnetic field is 0.3 T, the output power of the device with the focusing electrode and the coaxial reflector is double that of the one without them. The simulation and experimental results prove that the focusing electrode and the coaxial reflector are effective on reducing the guiding magnetic field of the device.

  10. Design studies of the Ku-band, wide-band Gyro-TWT amplifier

    Science.gov (United States)

    Jung, Sang Wook; Lee, Han Seul; Jang, Kwong Ho; Choi, Jin Joo; Hong, Yong Jun; Shin, Jin Woo; So, Jun Ho; Won, Jong Hyo

    2014-02-01

    This paper reports a Ku-band, wide band Gyrotron-Traveling-wave-tube(Gyro-TWT) that is currently being developed at Kwangwoon University. The Gyro-TWT has a two stage linear tapered interaction circuit to obtain a wide operating bandwidth. The linearly-tapered interaction circuit and nonlinearly-tapered magnetic field gives the Gyro-TWT a wide operating bandwidth. The Gyro-TWT bandwidth is 23%. The 2d-Particle-in-cell(PIC) and MAGIC2d code simulation results are 17.3 dB and 24.34 kW, respectively for the maximum saturated output power. A double anode MIG was simulated with E-Gun code. The results were 0.7 for the transvers to the axial beam velocity ratio (=alpha) and a 2.3% axial velocity spread at 50 kV and 4 A. A magnetic field profile simulation was performed by using the Poisson code to obtain the grazing magnetic field of the entire interaction circuit with Poisson code.

  11. Impact of Surface Soil Moisture Variations on Radar Altimetry Echoes at Ku and Ka Bands in Semi-Arid Areas

    Directory of Open Access Journals (Sweden)

    Christophe Fatras

    2018-04-01

    Full Text Available Radar altimetry provides information on the topography of the Earth surface. It is commonly used for the monitoring not only sea surface height but also ice sheets topography and inland water levels. The radar altimetry backscattering coefficient, which depends on surface roughness and water content, can be related to surface properties such as surface soil moisture content. In this study, the influence of surface soil moisture on the radar altimetry echo and backscattering coefficient is analyzed over semi-arid areas. A semi-empirical model of the soil’s complex dielectric permittivity that takes into account that small-scale roughness and large-scale topography was developed to simulate the radar echoes. It was validated using waveforms acquired at Ku and Ka-bands by ENVISAT RA-2 and SARAL AltiKa respectively over several sites in Mali. Correlation coefficients ranging from 0.66 to 0.94 at Ku-band and from 0.27 to 0.96 at Ka-band were found. The increase in surface soil moisture from 0.02 to 0.4 (i.e., the typical range of variations in semi-arid areas increase the backscattering from 10 to 15 dB between the core of the dry and the maximum of the rainy seasons.

  12. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  13. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    CERN Document Server

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  14. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Science.gov (United States)

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  15. Zamyšlení nad charakterem vůdčí vrstvy městského obyvatelstva na příkladu Brna v raném novověku. Diskusní příspěvek

    Czech Academy of Sciences Publication Activity Database

    Sulitková, Ludmila

    2004-01-01

    Roč. 22, - (2004), s. 243-260, 383-384 ISSN 0231-7443. [Pražské městské elity středověku a raného novověku - jejich proměny, zázemí a kulturní profil. Praha, 01.10.2002-02.10.2002] Institutional research plan: CEZ:AV0Z8077915 Keywords : municipal elites * Early Modern Ages * Brno Subject RIV: AB - History

  16. Low-loss negative index metamaterials for X, Ku, and K microwave bands

    Directory of Open Access Journals (Sweden)

    David A. Lee

    2015-04-01

    Full Text Available Low-loss, negative-index of refraction metamaterials were designed and tested for X, Ku, and K microwave frequency bands. An S-shaped, split-ring resonator was used as a unit cell to design homogeneous slabs of negative-index metamaterials. Then, the slabs of metamaterials were cut unto prisms to measure experimentally the negative index of refraction of a plane electromagnetic wave. Theoretical simulations using High-Frequency Structural Simulator, a finite element equation solver, were in good agreement with experimental measurements. The negative index of refraction was retrieved from the angle- and frequency-dependence of the transmitted intensity of the microwave beam through the metamaterial prism and compared well to simulations; in addition, near-field electromagnetic intensity mapping was conducted with an infrared camera, and there was also a good match with the simulations for expected frequency ranges for the negative index of refraction.

  17. Sutureless intrascleral intraocular lens fixation with lamellar dissection of scleral tunnel

    Directory of Open Access Journals (Sweden)

    Kawaji T

    2016-01-01

    Full Text Available Takahiro Kawaji,1,2 Tomoki Sato,2 Hidenobu Tanihara11Department of Ophthalmology, Faculty of Life Sciences, Kumamoto University, Chuo-ku, 2Sato Eye & Internal Medicine Clinic, Kumamoto, JapanPurpose: To report the results of sutureless scleral fixation of a posterior chamber intraocular lens (IOL by using our developed simple technique.Methods: We retrospectively reviewed the medical records of 48 eyes of 47 patients who underwent sutureless intrascleral IOL fixation by using our modified technique. A 25-gauge microvitreoretinal knife was used to perform sclerotomies and create limbus-parallel scleral tunnels with lamellar dissection in which the haptics were fixed.Results: The IOLs were fixed and centered well. The mean follow-up period was 26.7 months. Postoperative complications included smooth vitreous hemorrhage in four eyes (8.3%, cystoid macular edema in two eyes (4.2%, and iris capture of the IOL in two eyes (4.2%. No other complications, such as breakage of the IOL, spontaneous IOL dislocation, or retinal detachment, were detected during the follow-up period.Conclusion: The lamellar dissection of the limbus-parallel scleral tunnel can simplify the forceps-assisted introduction of the haptics into the scleral tunnel, and this technique seemed to be safe.Keywords: intraocular lenses, ophthalmologic surgical procedures, intrascleral fixation, sutureless fixation

  18. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Science.gov (United States)

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  19. Generation, Transformation and Place in Inga Iwasiów’s Novels Bambino (2008 and Ku słońcu (2010

    Directory of Open Access Journals (Sweden)

    Ursula PHILLIPS

    2012-06-01

    Full Text Available This chapter will discuss two novels by contemporary writer Inga Iwasiów (b. 1963, Bambino (2008 and Ku słońcu [Towards the Sun] (2010, in the context of geopolitical, ideological, social and psycho-cultural transformations as they specifically affect different generations of inhabitants of the Polish city of Szczecin (pre-1945 German Stettin from 1945 until the first decade of the 21st century. Bambino covers the years 1945–1981, but also contains flashbacksto pre-war memory of Stettin and to the suppressed experiences of the new post-war inhabitants, as well as ‘flash-forwards’ to post-1989, post-communist reality; Ku słońcu covers 1981 to the first decade of 2000s. It will show how the novels portray these transformations through the experience primarily of women (but not only — in Bambino, through the main protagonists: Ula (formerly Ulrike, Anna and Marysia, and through that of the hidden narrator Magda (Marysia’s daughter born in the same year as the author, Iwasiów, 1963; and in Ku słońcu, primarily through the experience of Magda herself, as well as through that of two generations of ‘feminist’ academics: Małgorzata and Sylwia (in which it is hard not to perceive the personal experience of the author, though she is at pains to emphasize elsewhere that her work is a collective biography of the city, not so much of herself. The analysis follows Katarzyna Chmielewska’s supposition that contemporary Polish fiction dealing with the past ‘constantly oscillates between memory and genealogy’, and that it raises raw issues not yet addressed by historians; it also derives inspiration from the new ‘postdependency’ studiesproposed by Hanna Gosk and Ryszard Nycz. It also attempts to capture the specific nature of Iwasiów’s use of language, her style of feminism, her method of portraying place, and the connections in her prose between place and memory.

  20. Akadēmiskās pašregulācijas saistība ar pusaudžu personības iezīmēm un vecāku audzināšanas stiliem

    OpenAIRE

    Iliško, Judīte

    2016-01-01

    Maģistra darba pētījuma mērķis bija noskaidrot, kāda saistība pastāv starp pusaudžu pašnovērtēto akadēmisko pašregulāciju, vecāku audzināšanas stiliem un pusaudžu personības iezīmēm, kā arī, vai pastāv dzimuma atšķirības starp pusaudžu pašnovērtēto akadēmisko pašregulāciju, vecāku audzināšanas stiliem un personības iezīmēm, un, cik lielā mērā pusaudžu personības iezīmes un vecāku audzināšanas stili prognozē pusaudžu akadēmisko pašregulāciju. Pētījumā piedalījās 225 7.-8.klašu skolēni no vien...

  1. Waldenström's macroglobulinemia harbors a unique proteome where Ku70 is severely underexpressed as compared with other B-lymphoproliferative disorders

    International Nuclear Information System (INIS)

    Perrot, A; Pionneau, C; Azar, N; Baillou, C; Lemoine, F M; Leblond, V; Merle-Béral, H; Béné, M-C; Herbrecht, R; Bahram, S; Vallat, L

    2012-01-01

    Waldenström's macroglobulinemia (WM) is a clonal B-cell lymphoproliferative disorder (LPD) of post-germinal center nature. Despite the fact that the precise molecular pathway(s) leading to WM remain(s) to be elucidated, a hallmark of the disease is the absence of the immunoglobulin heavy chain class switch recombination. Using two-dimensional gel electrophoresis, we compared proteomic profiles of WM cells with that of other LPDs. We were able to demonstrate that WM constitutes a unique proteomic entity as compared with chronic lymphocytic leukemia and marginal zone lymphoma. Statistical comparisons of protein expression levels revealed that a few proteins are distinctly expressed in WM in comparison with other LPDs. In particular we observed a major downregulation of the double strand repair protein Ku70 (XRCC6); confirmed at both the protein and RNA levels in an independent cohort of patients. Hence, we define a distinctive proteomic profile for WM where the downregulation of Ku70—a component of the non homologous end-joining pathway—might be relevant in disease pathophysiology

  2. Reduction of intergranular exchange coupling and grain size for high Ku CoPt-based granular media: Metal-oxide buffer layer and multiple oxide boundary materials

    Science.gov (United States)

    Tham, Kim Kong; Kushibiki, Ryosuke; Kamada, Tomonari; Hinata, Shintaro; Saito, Shin

    2018-05-01

    Investigation of magnetic properties and microstructure of granular media with various multiple oxides as the grain boundary material is reported. Saturation magnetization (Ms), uniaxial magnetocrystalline anisotropy (Ku), and magnetic grain diameter (GD) of the granular media show linear correlation with volume weighted average for melting point (Tm) of each oxides (Tmave). Ku of magnetic grains (Kugrain) shows a trade-off relation with GD that it is a big challenge to satisfy both high Kugrain and small GD by only controlling Tmave. To obtain a granular medium with appropriate Kugrain, GD, and low degree of intergranular exchange coupling, the combination of Tmave control of grain boundary material by mixing oxides and employment of a buffer layer are required. Here the degree of intergranular exchange coupling is estimated from the slope of M-H loop at around coercivity (α). By applying this technique, a typical granular medium with Kugrain of 1.0×107 erg/cm3, GD of 5.1 nm, and α of 1.2 is realized.

  3. A high efficiency Ku-band radial line relativistic klystron amplifier

    Energy Technology Data Exchange (ETDEWEB)

    Dang, Fangchao; Zhang, Xiaoping, E-mail: zhangxiaoping@nudt.edu.cn; Zhong, Huihuang; Zhang, Jun; Ju, Jinchuan [College of Optoelectronic Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

    2016-07-15

    To achieve the gigawatt-level microwave amplification output at Ku-band, a radial-line relativistic klystron amplifier is proposed and investigated in this paper. Different from the annular electron beam in conventional axial relativistic klystron amplifiers, a radial-radiated electron beam is employed in this proposed klystron. Owing to its radially spreading speciality, the electron density and space charge effect are markedly weakened during the propagation in the radial line drift tube. Additionally, the power capacity, especially in the output cavity, is enhanced significantly because of its large volume, which is profitable for the long pulse operation. Particle-in-cell simulation results demonstrate that a high power microwave with the power of 3 GW and the frequency of 14.25 GHz is generated with a 500 kV, 12 kA electron beam excitation and the 30 kW radio-frequency signal injection. The power conversion efficiency is 50%, and the gain is about 50 dB. Meanwhile, there is insignificant electron beam self-excitation in the proposed structure by the adoption of two transverse electromagnetic reflectors. The relative phase difference between the injected signals and output microwaves keeps stable after the amplifier saturates.

  4. Effects of surface roughness on sea ice freeboard retrieval with an Airborne Ku-Band SAR radar altimeter

    DEFF Research Database (Denmark)

    Hendricks, Stefan; Stenseng, Lars; Helm, Veit

    2010-01-01

    to investigate sea ice volume changes on an Arctic wide scale. Freeboard retrieval requires precise radar range measurements to the ice surface, therefore we investigate the penetration of the Ku-Band radar waves into the overlying snow cover as well as the effects of sub-footprint-scale surface roughness using...... airborne radar and laser altimeters. We find regional variable penetration of the radar signal at late spring conditions, where the difference of the radar and the reference laser range measurement never agrees with the expected snow thickness. In addition, a rough surface can lead to biases...

  5. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    CERN Document Server

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  6. Deficient Pms2, ERCC1, Ku86, CcOI in field defects during progression to colon cancer.

    Science.gov (United States)

    Nguyen, Huy; Loustaunau, Cristy; Facista, Alexander; Ramsey, Lois; Hassounah, Nadia; Taylor, Hilary; Krouse, Robert; Payne, Claire M; Tsikitis, V Liana; Goldschmid, Steve; Banerjee, Bhaskar; Perini, Rafael F; Bernstein, Carol

    2010-07-28

    In carcinogenesis, the "field defect" is recognized clinically because of the high propensity of survivors of certain cancers to develop other malignancies of the same tissue type, often in a nearby location. Such field defects have been indicated in colon cancer. The molecular abnormalities that are responsible for a field defect in the colon should be detectable at high frequency in the histologically normal tissue surrounding a colonic adenocarcinoma or surrounding an adenoma with advanced neoplasia (well on the way to a colon cancer), but at low frequency in the colonic mucosa from patients without colonic neoplasia. Using immunohistochemistry, entire crypts within 10 cm on each side of colonic adenocarcinomas or advanced colonic neoplasias were found to be frequently reduced or absent in expression for two DNA repair proteins, Pms2 and/or ERCC1. Pms2 is a dual role protein, active in DNA mismatch repair as well as needed in apoptosis of cells with excess DNA damage. ERCC1 is active in DNA nucleotide excision repair. The reduced or absent expression of both ERCC1 and Pms2 would create cells with both increased ability to survive (apoptosis resistance) and increased level of mutability. The reduced or absent expression of both ERCC1 and Pms2 is likely an early step in progression to colon cancer. DNA repair gene Ku86 (active in DNA non-homologous end joining) and Cytochrome c Oxidase Subunit I (involved in apoptosis) had each been reported to be decreased in expression in mucosal areas close to colon cancers. However, immunohistochemical evaluation of their levels of expression showed only low to modest frequencies of crypts to be deficient in their expression in a field defect surrounding colon cancer or surrounding advanced colonic neoplasia. We show, here, our method of evaluation of crypts for expression of ERCC1, Pms2, Ku86 and CcOI. We show that frequency of entire crypts deficient for Pms2 and ERCC1 is often as great as 70% to 95% in 20 cm long areas

  7. Development and simulation of the air-jack for emergency like a huge disaster; Kyujoyo eajakki no kaihatsu to sono simyureshon

    Energy Technology Data Exchange (ETDEWEB)

    Katsuyama, Kunihisa.; Ogata, Yuji.; Wada, Yuji. [National Institute for Resources and Environment, Tsukuba (Japan); Hashizume, Kiyoshi.; Nishida, Kenjiro. [Nippon Kayaku Corp., Tokyo (Japan)

    1999-02-28

    When a disaster is so huge like Kobe earthquake, every energy line is killed. Even if we want to help the sufferers, we have no energy to move machines to help them. As collapsed houses are very heavy, we need machines to remove collapsed stuff. Explosives include a lot of energy in themselves. So, an air-jack which has explosives inside was developed to remove collapsed stuff on suffered people. A simple air-jack was made and tested. One concrete block, 50cm x 50cm x 50cm, was lifted by the simple air-jack. A simulation of lifting the concrete block was carried out with a programme ANSYS on the super computer. (author)

  8. Modulation of splicing of the preceding intron by antisense oligonucleotide complementary to intra-exon sequence deleted in dystrophin Kobe

    Energy Technology Data Exchange (ETDEWEB)

    Takeshima, Y.; Matuso, M.; Sakamoto, H.; Nishio, H. [Kobe Univ. School of Medicine and Science (Japan)

    1994-09-01

    Molecular analysis of dystrophin Kobe showed that exon 19 of the dystrophin gene bearing a 52 bp deletion was skipped during splicing, although the known consensus sequences at the 5{prime} and 3{prime} splice site of exon 19 were maintained. These data suggest that the deleted sequence of exon 19 may function as a cis-acting factor for exact splicing for the upstream intron. To investigate this potential role, an in vitro splicing system using dystrophin precursors was established. A two-exon precursor containing exon 18, truncated intron 18, and exon 19 was accurately spliced. However, splicing of intron 18 was dramatically inhibited when wild exon 19 was replaced with mutated exon 19. Even though the length of exon 19 was restored to normal by replacing the deleted sequence with other sequence, splicing of intron 18 was not fully reactivated. Characteristically, splicing of intron 18 was inactivated more markedly when the replaced sequence contained less polypurine stretches. These data suggested that modification of the exon sequence would result in a splicing abnormality. Antisense 31 mer 2`-O-methyl ribonucleotide was targeted against 5{prime} end of deleted region of exon 19 to modulate splicing of the mRNA precursor. Splicing of intron 18 was inhibited in a dose- and time-dependent manner. This is the first in vitro evidence to show splicing of dystrophin pre-mRNA can be managed by antisense oligonucleotides. These experiments represent an approach in which antisense oligonucleotides are used to restore the function of a defective dystrophin gene in Duchenne muscular dystrophy by inducing skipping of certain exons during splicing.

  9. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Science.gov (United States)

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  10. NEDO Forum 2000. Solar technology development session (photovoltaic power generation system and our living); Taiyoko gijutsu kaihatsu session. Taiyoko hatsuden system to watashi tachi no kurashi

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-09-01

    The following themes were presented at the present session: (1) energy and environmental problems, and expectation to the photovoltaic power generation system, (2) our living and photovoltaic power generation, and (3) energy policies of Kobe Municipality based on lessons from the earthquake disaster. Item (1) describes: if the total electric power obtained in 20 years from the photovoltaic power generation system of 3 kW output for residential houses is converted into amount of petroleum consumed by thermal power plants, it corresponds to about 850 twenty-liter polyethylene tanks; to build a photovoltaic power generation system, energy corresponding to about 100 polyethylene tanks is used; therefore, subtraction results in saving of about 750 tanks; ordinary houses discharge about 3,500 kg of CO2 annually; and the photovoltaic power generation system serves to reduce about 1,000 kg of CO2 emission annually. Item (2) describes: in markets in 2010, more than 80% of the power generation system is served for housing; profitable price of power generation value is about 55/kW; more than 50% of the value is occupied by the value for other than power generation; and more than 80% of the system for housing will be of roof-material type in 2005. Item (3) introduces the energy diversification taken by Kobe Municipality after the earthquake disaster, and the energy policies, including the 'life spot' policy. (NEDO)

  11. Serial blood donations for intrauterine transfusions of severe hemolytic disease of the newborn with the use of recombinant erythropoietin in a pregnant woman alloimmunized with anti-Ku.

    Science.gov (United States)

    Lydaki, Evaggelia; Nikoloudi, Irene; Kaminopetros, Petros; Bolonaki, Irene; Sifakis, Stavros; Kikidi, Katerina; Koumantakis, Evgenios; Foundouli, Kaliopi

    2005-11-01

    The management of a pregnant woman with the rare Ko phenotype and anti-Ku is a special challenge, because matched blood is extremely rare and the possibility of severe hemolytic disease of the newborn is high. A 30-year-old woman with rare Ko (Knull) phenotype presented at 18 weeks of gestation with positive indirect agglutination test results. She had anti-Ku due to previous blood transfusion, one pregnancy, and two abortions. During this pregnancy, anti-Ku titers ranged from 1024 to 4096. At the 26th week of gestation ultrasound showed a hydropic fetus and urgent intrauterine exchange transfusion was performed with the maternal red blood cells (RBCs). Recombinant human erythropoietin (rHu-EPO) and intravenous (IV) iron were administered to the mother to ensure an adequate supply of matched RBCs for intrauterine transfusions and possible perinatal hemorrhage. Intrauterine transfusions were repeated every 1 to 3 weeks. By 35 weeks 2 days of gestation, the mother had donated 4 units of blood, and four intrauterine transfusions had been performed. Cesarean section was then decided and a healthy male newborn was born. He was treated with phototherapy but without exchange transfusions. By the 15th day of life rHu-EPO was administrated to the newborn because of anemia. The maternal RBCs completely disappeared from the child's blood by Day 100. As shown in this case, treatment with rHu-EPO and IV Fe has effectively increased the mother's capacity to donate RBCs for autologous use and intrauterine transfusions, with no adverse effects to the mother or the child.

  12. Exploration for petroleum and natural gas in Sonai Plain

    Energy Technology Data Exchange (ETDEWEB)

    Konishi, K

    1965-09-01

    Exploration in the Sonai Plain by Sekyu Shigen Kaihatsu Kabushiki Kaisha (Oil Resources Development Corporation) since 1955 is described. The development tasks are made difficult due to the presence of permeability traps. However, 41 out of 65 wells drilled up to late March of 1965 have been successful. Quantities of crude oil and natural gas produced in 1963 were, respectively, 5 and 6 times those of 1958. The Sonai Plain is a relatively new area, and there are still many unknown factors, yet the rate of development has increased greatly. More and deeper wells are expected to be drilled with even better results.

  13. Resistance to Sri Lankan Cassava Mosaic Virus (SLCMV) in Genetically Engineered Cassava cv. KU50 through RNA Silencing

    KAUST Repository

    Ntui, Valentine Otang

    2015-04-22

    Cassava ranks fifth among the starch producing crops of the world, its annual bioethanol yield is higher than for any other crop. Cassava cultivar KU50, the most widely grown cultivar for non-food purposes is susceptible to Sri Lankan cassava mosaic virus (SLCMV). The objective of this work was to engineer resistance to SLCMV by RNA interference (RNAi) in order to increase biomass yield, an important aspect for bioethanol production. Here, we produced transgenic KU50 lines expressing dsRNA homologous to the region between the AV2 and AV1 of DNA A of SLCMV. High level expression of dsRNA of SLCMV did not induce any growth abnormality in the transgenic plants. Transgenic lines displayed high levels of resistance to SLCMV compared to the wild-type plants and no virus load could be detected in uninoculated new leaves of the infected resistant lines after PCR amplification and RT-PCR analysis. The agronomic performance of the transgenic lines was unimpaired after inoculation with the virus as the plants presented similar growth when compared to the mock inoculated control plants and revealed no apparent reduction in the amount and weight of tubers produced. We show that the resistance is correlated with post-transcriptional gene silencing because of the production of transgene specific siRNA. The results demonstrate that transgenic lines exhibited high levels of resistance to SLCMV. This resistance coupled with the desirable yield components in the transgenic lines makes them better candidates for exploitation in the production of biomass as well as bioethanol.

  14. Resistance to Sri Lankan Cassava Mosaic Virus (SLCMV) in Genetically Engineered Cassava cv. KU50 through RNA Silencing

    KAUST Repository

    Ntui, Valentine Otang; Kong, Kynet; Khan, Raham Sher; Igawa, Tomoko; Janavi, Gnanaguru Janaky; Rabindran, Ramalingam; Nakamura, Ikuo; Mii, Masahiro

    2015-01-01

    Cassava ranks fifth among the starch producing crops of the world, its annual bioethanol yield is higher than for any other crop. Cassava cultivar KU50, the most widely grown cultivar for non-food purposes is susceptible to Sri Lankan cassava mosaic virus (SLCMV). The objective of this work was to engineer resistance to SLCMV by RNA interference (RNAi) in order to increase biomass yield, an important aspect for bioethanol production. Here, we produced transgenic KU50 lines expressing dsRNA homologous to the region between the AV2 and AV1 of DNA A of SLCMV. High level expression of dsRNA of SLCMV did not induce any growth abnormality in the transgenic plants. Transgenic lines displayed high levels of resistance to SLCMV compared to the wild-type plants and no virus load could be detected in uninoculated new leaves of the infected resistant lines after PCR amplification and RT-PCR analysis. The agronomic performance of the transgenic lines was unimpaired after inoculation with the virus as the plants presented similar growth when compared to the mock inoculated control plants and revealed no apparent reduction in the amount and weight of tubers produced. We show that the resistance is correlated with post-transcriptional gene silencing because of the production of transgene specific siRNA. The results demonstrate that transgenic lines exhibited high levels of resistance to SLCMV. This resistance coupled with the desirable yield components in the transgenic lines makes them better candidates for exploitation in the production of biomass as well as bioethanol.

  15. Destruction of gel sulfonated cation-exchangers of the KU-2 type under the influence of hydrogen peroxide

    Energy Technology Data Exchange (ETDEWEB)

    Roginskaya, B.S.; Zavadovskaya, A.S.; Znamenskii, Yu.P.; Paskhina, N.A.; Dobrova, E.I.

    1988-10-20

    The purpose of this work was to study the mechanism of interaction of Soviet sulfonated cation-exchangers of the KU-2 type with hydrogen peroxide. It is shown that under the influence of hydrogen peroxide sulfonated cation-exchangers begin, after a certain induction period, to lose capacity and to release destruction products into water; the length of the induction period increases with the degree of cross-linking. In a given time of contact between the resin and the solution the degree of destruction falls with increase of cross-linking. The principal product of destruction of sulfonated cation-exchangers is an aromatic sulfonic acid containing oxidized groups in the side chains.

  16. Reduction of intergranular exchange coupling and grain size for high Ku CoPt-based granular media: Metal-oxide buffer layer and multiple oxide boundary materials

    Directory of Open Access Journals (Sweden)

    Kim Kong Tham

    2018-05-01

    Full Text Available Investigation of magnetic properties and microstructure of granular media with various multiple oxides as the grain boundary material is reported. Saturation magnetization (Ms, uniaxial magnetocrystalline anisotropy (Ku, and magnetic grain diameter (GD of the granular media show linear correlation with volume weighted average for melting point (Tm of each oxides (Tmave. Ku of magnetic grains (Kugrain shows a trade-off relation with GD that it is a big challenge to satisfy both high Kugrain and small GD by only controlling Tmave. To obtain a granular medium with appropriate Kugrain, GD, and low degree of intergranular exchange coupling, the combination of Tmave control of grain boundary material by mixing oxides and employment of a buffer layer are required. Here the degree of intergranular exchange coupling is estimated from the slope of M-H loop at around coercivity (α. By applying this technique, a typical granular medium with Kugrain of 1.0×107 erg/cm3, GD of 5.1 nm, and α of 1.2 is realized.

  17. Teplovodní výměník pro krbovou vložku

    OpenAIRE

    Kněžínek, Petr

    2012-01-01

    Diplomová práce je zaměřena na problematiku zapojení krbových kamen a krbových vložek do teplovodních vytápěcích systémů. Práce obsahuje stručný popis krbů a otopných soustav. Konkrétně se zabývá návrhem teplovodního výměníku pro krbová kamna. Poslední část práce je věnována experimentálnímu ověření provozních parametrů a vyhodnocení získaných výsledků. The diploma thesis is focused on problems connecting of fireplace with water heating systems. The thesis comprises concise description of ...

  18. A technical writing programme implemented in a first-year engineering course at KU Leuven

    Science.gov (United States)

    Heylen, Christel; Vander Sloten, Jos

    2013-12-01

    Technical communication and technical writing are important skills for the daily work-life of every engineer. In the first-year engineering programme at KU Leuven, a technical writing programme is implemented within the project-based course 'Problem Solving and Engineering Design'. This paper describes a case study for implementing a writing programme based on active learning methods and situated learning in large classes. The programme consists of subsequent cycles of instructions, learning by doing and reflection on received feedback. In addition, a peer-review assignment, together with an interactive lecture using clicking devices, is incorporated within the assignments of the second semester. A checklist of desired writing abilities makes it easier to grade the large number of papers. Furthermore, this ensures that all staff involved in the evaluation process uses the same criteria to grade and for providing feedback.

  19. Hemşirelerin Bireysel ve Profesyonel Değerlerinde Kuşaklararası Farklılıklar / Personal and Professional Difference between the Generation of Nurses

    OpenAIRE

    IŞIK, Gülşen; EĞELİOĞLU CETİŞLİ, Nuray; TOKEM, Yasemin; YILMAZ, Dilan; İLHAN, Aylin

    2018-01-01

    Amaç: Buaraştırmanın amacı hemşirelerin bireysel ve profesyonel değerleri arasındakikuşaklararası farklılıkları belirlemektir. Gereçve Yöntem: Tanımlayıcı ve karşılaştırmalı tipteki bu çalışma, İzmir’dekibir üniversite hastanesinde çalışan, X kuşağındaki 85(doğum tarihi 1965-1979yılları arasında olanlar) ve Y kuşağındaki 79 (doğum tarihi 1980-1999 yıllarıarasında olanlar) olmak üzere toplam 164 hemşire ile yürütülmüştür. Veriler, araştırmacılar tarafından 30 dakikalık süreiçerisinde yüz yüze ...

  20. 8 – 11 gadus vecu bērnu pašcieņas saistība ar vecāku audzināšanas stilu un tehnoferenci

    OpenAIRE

    Ērmane, Linda

    2017-01-01

    Ir izvirzīts pētījuma mērķis teorētiski un praktiski izpētīt 8 – 11 gadus vecu bērnu pašcieņas saistību ar vecāku audzināšanas stilu un tehnoferenci. Pētījumā ir viena hipotēze par to, ka pastāv saistība starp vecāku audzināšanas stilu, bērnu pašcieņu un tehoferenci. Pētījuma izlasi veido 15 bērni (M = 9,6 gadi; SD = 1,12; 8 meitenes un 7 zēni) un 30 vecāki (M = 36,8 gadi; SD = 5,74; 15 vīrieši un 15 sievietes). Ir izmantoti 3 instrumenti: Audzināšanas pieeju aptauja, Tehnoloģijas ierīču ieja...

  1. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Directory of Open Access Journals (Sweden)

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  2. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Directory of Open Access Journals (Sweden)

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  3. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Science.gov (United States)

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  4. Wideband Array for C, X, and Ku-Band Applications with 5.3:1 Bandwidth

    Science.gov (United States)

    Novak, Markus H.; Volakis, John L.; Miranda, Felix A.

    2015-01-01

    Planar arrays that exploit strong intentional coupling between elements have allowed for very wide bandwidths in low-profile configurations. However, such designs also require complex impedance matching networks that must also be very compact. For many space applications, typically occurring at C-, X-, Ku-, and most recently at Ka-band, such designs require specialized and expensive fabrication techniques. To address this issue, a novel ultra-wideband array is presented, using a simplified feed network to reduce fabrication cost. The array operates from 3.5-18.5 GHz with VSWR less than 2.4 at broadside, and is of very low profile, having a total height of lambda/10 at the lowest frequency of operation. Validation is provided using a 64-element prototype array, fabricated using common Printed Circuit Board (PCB) technology. The low size, weight, and cost of this array make it attractive for space-borne applications.

  5. Emocionālā intelekta attīstība 16 -18 gadus veciem pusaudžiem un tā saistība ar vecāku audzināšanas stilu.

    OpenAIRE

    Poļakova, Anželika

    2011-01-01

    Šī pētījuma mērķis ir noskaidrot, vai vecāku izvēlētais audzināšanas stils ir saistīts ar emocionālā intelekta attīstību. Pētījumā piedalījās 64 respondenti: 32 sievietes no 16 līdz 18 gadiem un 32 vīrieši no 16 līdz 18 gadiem. Respondenti pārstāv dažādas sociāli ekonomiskas grupas. Tika izmantotas šādas metodes: Bar-Ona emocionālā intelekta aptauja (Bar-On Emotional Quotient Inventory (EQ-i), Bar-On, 1999) un Buri Vecāku audzināšanas stila aptauju (Buri Parental Authority Questionnaire- PAQ...

  6. Pusaudžu problemātiskas uzvedības saistības ar viņu piesaistes stilu un vecāku audzināšanas stilu ģimenē

    OpenAIRE

    Zamberga, Zane

    2006-01-01

    Maģistra darba pētījuma mērķis bija noskaidrot pusaudžu uzvedības traucējumu, piesaistes stilu un vecāku audzināšanas stilu savstarpējo saistību pusaudžu pašnovērtējumā, un, kāda ir savstarpējā ietekme (multiplās regresijas analīzes rezultātā) piesaistes stilam un vecāku audzināšanas stilam, iepretim uzvedības pašnovērtējumam. Pētījuma izlasi veido 60 pusaudži vcecumā no 14 – 16 gadiem. Tika aptaujāti Latvijas vispārizglītojošo skolu 7. un 8. klases skolēni: 30 meitenes un 30 zēni. Pētījumā...

  7. Modelling the morphology of migrating bacterial colonies

    Science.gov (United States)

    Nishiyama, A.; Tokihiro, T.; Badoual, M.; Grammaticos, B.

    2010-08-01

    We present a model which aims at describing the morphology of colonies of Proteus mirabilis and Bacillus subtilis. Our model is based on a cellular automaton which is obtained by the adequate discretisation of a diffusion-like equation, describing the migration of the bacteria, to which we have added rules simulating the consolidation process. Our basic assumption, following the findings of the group of Chuo University, is that the migration and consolidation processes are controlled by the local density of the bacteria. We show that it is possible within our model to reproduce the morphological diagrams of both bacteria species. Moreover, we model some detailed experiments done by the Chuo University group, obtaining a fine agreement.

  8. Wpływ wysiłku fizycznego na funkcję układu oddechowego w twardzinie układowej

    OpenAIRE

    Stanisław Sierakowski; Ewa Gińdzieńska-Sieśkiewicz; Maciej Kaczmarski; Zenon Siergiejko; Grzegorz Siergiejko; Piotr Siergiejko; Justyna Fryc

    2010-01-01

    Cel: Powikłania ze strony układu oddechowego stanowią główną przyczynę zgonów pacjentów z twardziną układową (TU). Tętniczenadciśnienie płucne i śródmiąższowa choroba płuc stanowią najistotniejszez nich. Pacjenci są jednak często zdiagnozowani dopierow późnym okresie choroby, dlatego też istotne jest opracowaniemetody diagnostycznej do wczesnego wykrywania tych powikłań.Celem pracy była ocena wpływu wysiłku fizycznego na zmiany parametrówoddechowych. Materiały i metody: Badania przeprowadzono...

  9. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    Institute of Scientific and Technical Information of China (English)

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  10. The impact of the snow cover on sea-ice thickness products retrieved by Ku-band radar altimeters

    Science.gov (United States)

    Ricker, R.; Hendricks, S.; Helm, V.; Perovich, D. K.

    2015-12-01

    Snow on sea ice is a relevant polar climate parameter related to ocean-atmospheric interactions and surface albedo. It also remains an important factor for sea-ice thickness products retrieved from Ku-band satellite radar altimeters like Envisat or CryoSat-2, which is currently on its mission and the subject of many recent studies. Such satellites sense the height of the sea-ice surface above the sea level, which is called sea-ice freeboard. By assuming hydrostatic equilibrium and that the main scattering horizon is given by the snow-ice interface, the freeboard can be transformed into sea-ice thickness. Therefore, information about the snow load on hemispherical scale is crucial. Due to the lack of sufficient satellite products, only climatological values are used in current studies. Since such values do not represent the high variability of snow distribution in the Arctic, they can be a substantial contributor to the total sea-ice thickness uncertainty budget. Secondly, recent studies suggest that the snow layer cannot be considered as homogenous, but possibly rather featuring a complex stratigraphy due to wind compaction and/or ice lenses. Therefore, the Ku-band radar signal can be scattered at internal layers, causing a shift of the main scattering horizon towards the snow surface. This alters the freeboard and thickness retrieval as the assumption that the main scattering horizon is given by the snow-ice interface is no longer valid and introduces a bias. Here, we present estimates for the impact of snow depth uncertainties and snow properties on CryoSat-2 sea-ice thickness retrievals. We therefore compare CryoSat-2 freeboard measurements with field data from ice mass-balance buoys and aircraft campaigns from the CryoSat Validation Experiment. This unique validation dataset includes airborne laser scanner and radar altimeter measurements in spring coincident to CryoSat-2 overflights, and allows us to evaluate how the main scattering horizon is altered by the

  11. Gözeli yöresindeki (Elazığ meşe (Quercus sp . ormanlarına asılan yapay yuvalardaki böcekçil kuşların kuluçka faaliyetleri

    Directory of Open Access Journals (Sweden)

    Özden YALÇIN

    2015-12-01

    Full Text Available Elazığ Orman Bölge Müdürlüğü sınırları içerisinde yer alan Elazığ ili Sivrice ilçesi Gözeli mevkiinde bulunan meşe ormanlarında, 2009-2013 yılları arasında gerçekleştirilen bu çalışma ile farklı bakılara asılan farklı renkteki küçük ve büyük yuva sandıklarında yuva yapan kuş türleri ve bu türlerin kuluçka faaliyetlerinin saptanması amaçlanmıştır. Kuluçkalarını başarı ile tamamlayan kuş türlerinin Otus scops haricindeki türlerin hepsi, hem küçük hem de büyük yuvaları kullanmıştır. Öncelikli yuva tercihleri şu şekilde olmuştur: Parus major küçük yuvaların %66,4’ünde, Cyanistes caeruleus büyük yuvaların %16,3’ünde, Sitta europaea büyük yuvaların %23,2’sinde, Petronia petronia küçük yuvaların %15,2’sinde, Passer domesticus büyük yuvaların %27,9’unda, Otus scops ise sadece büyük yuvaların %7’sinde yuvalanmıştır. Asılan yuvalarda başarılı kuluçka durumunun farklı kuş türlerine göre bakı tercihleri arasında farklılıklar bulunmaktadır. Büyük yuvalarda güney (%39,5, doğu (%34,9, kuzey (%16,3 ve batı (%9,3’dır. Küçük yuvalarda ise güney (%33,2, doğu (%27,2, batı (%20,8 ve kuzey (%18,8’dir.Farklı renklerde asılan kuş yuvalarında başarılı kuluçka yapan kuş türlerinin renk tercihleri değişmektedir. Büyük yuvalarda, Parus major yeşil yuvaları, Cyanistes caeruleus sarı yuvaları, Sitta europaea turuncu yuvaları, Petronia petronia sarı ve mavi yuvaları, Passer domesticus sarı, mavi ve boyanmamış yuvaları daha fazla tercih etmişlerdir. Kuşların yuva tercihinde yuva boyutu, renk ve bakının türler arası farklılık gösterdiği ortaya çıkmıştır. Bir türün daha yoğun bulunduğu alanda, o türe uygun yuva tercihinin gerçekleştirilerek asılması biyolojik mücadele kapsamında daha verimli sonuçlar elde edilmesini sağlayacaktır.

  12. Exposure to power frequency magnetic fields suppresses X-ray-induced apoptosis transiently in Ku80-deficient xrs5 cells

    International Nuclear Information System (INIS)

    Tian, Furong; Nakahara, Takehisa; Yoshida, Masami; Honda, Naoko; Hirose, Hideki; Miyakoshi, Junji

    2002-01-01

    In an attempt to determine whether exposure to extremely low frequency (ELF) electromagnetic fields can affect cells, Ku80-deficient cells (xrs5) and Ku80-proficient cells (CHO-K1) were exposed to ELF electromagnetic fields. Cell survival, and the levels of the apoptosis-related genes p21, p53, phospho-p53 (Ser 15 ), caspase-3 and the anti-apoptosis gene bcl-2 were determined in xrs5 and CHO-K1 cells following exposure to ELF electromagnetic fields and X-rays. It was found that exposure of xrs5 and CHO-K1 cells to 60 Hz ELF electromagnetic fields had no effect on cell survival, cell cycle distribution and protein expression. Exposure of xrs5 cells to 60 Hz ELF electromagnetic fields for 5 h after irradiation significantly inhibited G 1 cell cycle arrest induced by X-rays (1 Gy) and resulted in elevated bcl-2 expression. A significant decrease in the induction of p53, phospho-p53, caspase-3 and p21 proteins was observed in xrs5 cells when irradiation by X-rays (8 Gy) was followed by exposure to 5 mT ELF magnetic fields. Exposure of xrs5 cells to the ELF electromagnetic fields for 10 h following irradiation significantly decreased X-ray-induced apoptosis from about 1.7% to 0.7%. However, this effect was not found in CHO-K1 cells within 24 h of irradiation by X-rays alone and by X-rays combined with ELF electromagnetic fields. Exposure of xrs5 cells to 60 Hz ELF electromagnetic fields following irradiation can affect cell cycle distribution and transiently suppress apoptosis by decreasing the levels of caspase-3, p21, p53 and phospho-p53 and by increasing bcl-2 expression

  13. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    CERN Document Server

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  14. USP22 Induces Cisplatin Resistance in Lung Adenocarcinoma by Regulating γH2AX-Mediated DNA Damage Repair and Ku70/Bax-Mediated Apoptosis

    Directory of Open Access Journals (Sweden)

    Aman Wang

    2017-05-01

    Full Text Available Resistance to platinum-based chemotherapy is one of the most important reasons for treatment failure in advanced non-small cell lung cancer, but the underlying mechanism is extremely complex and unclear. The present study aimed to investigate the correlation of ubiquitin-specific peptidase 22 (USP22 with acquired resistance to cisplatin in lung adenocarcinoma. In this study, we found that overexpression of USP22 could lead to cisplatin resistance in A549 cells. USP22 and its downstream proteins γH2AX and Sirt1 levels are upregulated in the cisplatin- resistant A549/CDDP cell line. USP22 enhances DNA damage repair and induce cisplatin resistance by promoting the phosphorylation of histone H2AX via deubiquitinating histone H2A. In addition, USP22 decreases the acetylation of Ku70 by stabilizing Sirt1, thus inhibiting Bax-mediated apoptosis and inducing cisplatin resistance. The cisplatin sensitivity in cisplatin-resistant A549/CDDP cells was restored by USP22 inhibition in vivo and vitro. In summary, our findings reveal the dual mechanism of USP22 involvement in cisplatin resistance that USP22 can regulate γH2AX-mediated DNA damage repair and Ku70/Bax-mediated apoptosis. USP22 is a potential target in cisplatin-resistant lung adenocarcinoma and should be considered in future therapeutic practice.

  15. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Directory of Open Access Journals (Sweden)

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  16. Ocena poziomu lęku i depresji u rodziców dzieci z zespołem nerczycowym – sposoby radzenia sobie z nimi i metody wsparcia

    Directory of Open Access Journals (Sweden)

    Monika Pawlak-Bratkowska

    2013-06-01

    Full Text Available Wstęp i cele pracy: Idiopatyczny zespół nerczycowy w wieku rozwojowym przebiega nawrotowo i trwale zmie‑ nia życie dzieci oraz ich rodziców. Celem badania była ocena poziomu lęku i depresji u rodziców dzieci z zespo‑ łem nerczycowym. Materiał i metodyka: Badanie zaplanowano jako przekrojową próbę kliniczną wśród rodzi‑ ców dzieci chorujących na zespół nerczycowy w odniesieniu do rodziców dzieci zdrowych. Wszyscy badani (46 rodziców wypełniali: ankietę dotyczącą przebiegu choroby u dziecka, kwestionariusz STAI (Inwentarz stanu i cechy lęku, kwestionariusz Skali depresji Becka, kwestionariusz Skali kontroli emocji (CECS. Grupę kontrolną stanowiło 20 rodziców dzieci zdrowych. Wyniki: Rodzice dzieci z zespołem nerczycowym charakteryzowali się istotnie wyższym poziomem depresji (Skala depresji Becka 8,7 vs 4,9, t = 2,18, p < 0,05. U ojców zaobserwo‑ wano wyższe subiektywne uczucie kontrolowania własnych reakcji w porównaniu z matkami – wyższy wynik CECS, suma u ojców (55,1 vs 47,2, t = 2,53, p < 0,05. U matek odnotowano wyższe wskaźniki zarówno w ska‑ lach mierzących poziom lęku jako cechy (STAI – cecha 45,7 vs 36,1, t = 3,19, p < 0,05 i stanu (STAI – stan 42,8 vs 33,4, t = 2,8, p < 0,05, jak i w kwestionariuszu badającym poziom depresji (10,62 vs 4,86, t = 2,66, p < 0,05. Rodzice, którzy wykazywali tendencję do obwiniania się o chorobę dziecka, podczas jej pierwszego epizodu uzyskali statystycznie istotny wyższy wynik w testach badających poziom depresji. Wnioski: Rodzice dzieci cierpiących na zespół nerczycowy charakteryzowali się istotnie wyższym poziomem depresji niż rodzice dzieci zdrowych. Ważne wydaje się objęcie szczególną opieką matek, mającą na celu obniżenie poziomu lęku i objawów depresji, oraz ojców skłonnych do tłumienia przeżywanych emocji.

  17. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Keywords. Sensitivity analysis; dynamic improvement structural modoficaton; laser beam printer; motorbike; disc drive; mechatronics; automobile engine ... Author Affiliations. Nobuyuki Okubo1 Takeshi Toi1. Department of Precision Mechanics, Chuo University, Tokyo, Japan ...

  18. Some clastic rocks as parent rocks in beech forests of Brezovica - Južni Kučaj

    Directory of Open Access Journals (Sweden)

    Joksimović Vesna

    2003-01-01

    Full Text Available On the large forest areas, where the measures of soil quality improvement are absent or rarely undertaken, the rocks are the sources of a great number of elements in plant nutrition and one of the factors affecting the contents of some elements in plants. The aim of the study is to determine the differences in the contents of Cu, Zn, Mn, Ni, Fe, Cd, Co, Pb and Cr in the beech leaves developed in the same climate conditions, on morphologically similar terrains, composed of different types of sedimentary rocks. This paper presents the study results of the contents of the above elements in argillites, sandstones (grauwackes and microconglomerates occurring as the parent rocks in high beech forests in the region of GJ Bogovina (Brezovica Južni Kučaj and in the leaves of beech developed on these rocks.

  19. A 3D analysis of spatial relationship between geological structure and groundwater profile around Kobe City, Japan: based on ARCGIS 3D Analyst.

    Science.gov (United States)

    Shibahara, A.; Tsukamoto, H.; Kazahaya, K.; Morikawa, N.; Takahashi, M.; Takahashi, H.; Yasuhara, M.; Ohwada, M.; Oyama, Y.; Inamura, A.; Handa, H.; Nakama, J.

    2008-12-01

    Kobe city is located on the northern side of Osaka sedimentary basin, Japan, containing 1,000-2,000 m thick Quaternary sediments. After the Hanshin-Awaji Earthquake (January 17, 1995), a number of geological and geophysical surveys were conducted in this region. Then high-temperature anomaly of groundwater accompanied with high Cl concentration was detected along fault systems in this area. In addition, dissolved He in groundwater showed nearly upper mantle-like 3He/4He ratio, although there were no Quaternary volcanic activities in this region. Some recent studies have assumed that these groundwater profiles are related with geological structure because some faults and joints can function as pathways for groundwater flow, and mantle-derived water can upwell through the fault system to the ground surface. To verify these hypotheses, we established 3D geological and hydrological model around Osaka sedimentary basin. Our primary goal is to analyze spatial relationship between geological structure and groundwater profile. In the study region, a number of geological and hydrological datasets, such as boring log data, seismic profiling data, groundwater chemical profile, were reported. We converted these datasets to meshed data on the GIS, and plotted in the three dimensional space to visualize spatial distribution. Furthermore, we projected seismic profiling data into three dimensional space and calculated distance between faults and sampling points, using Visual Basic for Applications (VBA) scripts. All 3D models are converted into VRML format, and can be used as a versatile dataset on personal computer. This research project has been conducted under the research contract with the Japan Nuclear Energy Safety Organization (JNES).

  20. Estimation of underground structures in the Osaka-Kobe area by array-network observations of microtremors; Bido no array kansoku ni yoru Osaka-Hyogo chiiki no chika kozo no suitei

    Energy Technology Data Exchange (ETDEWEB)

    Okada, H; Ishikawa, K; Ling, S [Hokkaido University, Sapporo (Japan); Sasabe, K [Ministry of Construction, Tokyo (Japan)

    1997-05-27

    Microtremor observations have been carried out with an objective to estimate underground structures including the foundation depth in the Osaka-Kobe area which has been greatly damaged by the Hyogoken-nanbu earthquake in 1995. Different organizations have made seismic surveys and boring investigations in this area, by which elucidation has been made on the underground structures. The present observations are intended to identify S-wave velocity distribution in a wide area from the ground surface to the foundation, which is difficult to be verified by using conventional surveys and investigations. Methods to detect surface waves which are contained in microtremors include the frequency-wave number method (the F-K method) and the spatial autocorrelation method (the SPAC method). The SPAC method can estimate phase velocities of longer waves for the size of an array than with the F-K method, and is more advantageous in estimating ground structures at greater depths. S-wave velocity structure was estimated down to the foundation rocks existing in depths of about 0.5 to 2.0 km. For estimating the phase velocities in Raleigh waves, the SPAC method and the expanded spatial autocorrelation method were used. The underground structures thus derived showed a good agreement with the results of explorations using other methods. 8 figs., 1 tab.

  1. Motorické projevy laterality u osob středního věku a starších

    OpenAIRE

    Habartová, Lucie

    2008-01-01

    Název dielomové eráce: Motorické projevy laterality u osob středního věku a starších. Název v gnglickém jazyce: The Manifestations of Motoric Laterality of Middle-aged People and Elderly. Cíle eráce: Definovat, popsat lateralitu, zjistit stupeň laterality horní končetiny, dolní končetiny a oka. Zjistit vztah laterality horních končetin a očí, horních končetin a dolních končetin. Metoda: Lateralitu budeme zjišťovat na základě dotazníků a motorických testů. Testovaný soubor čítá 50 probandů ve ...

  2. Estimation of site effects in Higashinada Ward, Kobe City using aftershock records of the 1995 Hyogo-Ken Nanbu Earthquake; Hyogoken nanbu jishin no yoshin kiroku wo mochiita Kobeshihigashinadaku no jiban zofuku tokusei no hyoka

    Energy Technology Data Exchange (ETDEWEB)

    Kurita, K.; Yamanaka, H.; Seo, K. [Tokyo Inst. of Tech. (Japan)

    1998-07-30

    Source spectra and site effects are separated using the aftershock records, and the characteristics of short period earthquake motion in Higashinada Ward, Kobe City including the area to the south of seismic intensity 7 area are investigated placing emphasis on how far the site effects can be explained by 1-D ground structure. The shape and amplitude of the site effect of KNN and KYC located outside the seismic intensity 7 area can be explained fairly well by 1-D multiple reflection theory of S wave. However, peaks near 3 to 4Hz of KNN and UOZ in seismic intensity 7 area can not be explained. This suggests that the site effects of seismic intensity 7 area obtained by the aftershock records might include 2-D effects of underground structure. Inversion is performed using site effects as the objective functions to determine S wave velocity structure and Qs in the sedimentary layer. S wave velocity structure shows no systematical difference from those of the past models. 22 refs., 13 figs., 2 tabs.

  3. Y Kuşağı Turistlerin Destinasyon İmaj Algıları Üzerine Bir Araştırma A Research On Generation Y Tourists Perceptions Of Destination Image

    Directory of Open Access Journals (Sweden)

    Aslı ALBAYRAK

    2013-07-01

    Full Text Available This study has been performed on the purposed of determiningeffects of the destination image composing factors on deciding tovacation resort of Y Generation tourists who show differentcharacterists in comparison to the previous and the next generation,and making recommendations related to destination marketing for thegeneration by examining the relationship between destinationperception and structural features of Y Generation tourist.In this study, questionnaire technique which is one thequantitative research method, were used and questionnaire study weremade face to face with 384 people who were determined by quotasampling method and represent the generation in Istanbul. On analysisobtained from data were used descriptive statistics, t-test, and Anovaanalysis.According to results of research, destination image differs fromdepending on gender, level of educaiton, also income levels ofparticipants. On the other other hand, it can be said that Y Generationtourists act at the request of seeing new places, leisure, andentertainment and are the individuals who look for quality and luxuryholiday with affordable price.Touristic purchase process is shaped by many factors. One of thefactors affecting this process is image of destination. The mostgenerational definition about destination image is as an individual’soverall perception and these perceptions ınfluenced by many factorssuch as age, education, income and culture. There are several studieshave been conducted about tourists’ perceptions of destination image inpast and generally these studies about effects of tourists’ characteristicssuch as age, education, culture income to perception of destinationimage but there are no studies about different generations’ destinationimage perceptions. Therefore ıt’s thought that the results obtained fromthis study could contribute to the tourism marketers. Bu çalışma, kendinden önceki ve sonraki kuşaklardan farklı özellikler gösteren Y ku

  4. Effect of deep structure and surface layer (a) simulation study on the heavy damage belt of the 1995 Hyogoken Nanbu earthquake; Hado simulation wo mochiita `shinsai no obi` ni tsuite no kento

    Energy Technology Data Exchange (ETDEWEB)

    Feng, S; Ishikawa, K; Kaji, Y [Chuokaihatsu Corp., Tokyo (Japan)

    1996-05-01

    A simulation study was done to identify the causes for the so-called heavy damage belt observed as a result of the Hyogoken Nanbu Earthquake. This study determines distributions of the maximum amplitudes on the ground surfaces, and discusses the effects of deep structures and low-velocity surface layers, based on the simulation by the wave equation with the underground model of Higashinada-ku and its vicinity in the north-south direction, observed seismic records and artificial waves. The two-dimensional scalar wave equation is used for the analysis. The velocity structure model used for the simulation is established, based on the elastic wave seismic survey results. The focus function is drawn by expanding or contracting the time scale, using the seismic records at Kobe Port Island and artificial waves. The analysis results show that the damage belt coincides with the areas at which the focusing zone of the deep structure overlap the amplification zone in the low-velocity ground surfaces, where relative density is amplified 1.5 to 2 times. It is also observed that large peaks repeat 2 to 3 times on the time scale. 5 refs., 8 figs., 1 tab.

  5. A Small Ku-Band Polarization Tracking Active Phased Array for Mobile Satellite Communications

    Directory of Open Access Journals (Sweden)

    Wei Shi

    2013-01-01

    Full Text Available A compact polarization tracking active phased array for Ku-band mobile satellite signal reception is presented. In contrast with conventional mechanically tracking antennas, the approach presented here meets the requirements of beam tracking and polarization tracking simultaneously without any servo components. The two-layer stacked square patch fed by two probes is used as antenna element. The impedance bandwidth of 16% for the element covers the operating frequency range from 12.25 GHz to 12.75 GHz. In the presence of mutual coupling, the dimensional parameters for each element of the small 7 × 7 array are optimized during beam scanning and polarization tracking. The compact polarization tracking modules based on the low-temperature cofired ceramic (LTCC system-in-package (SiP technology are proposed. A small active phased array prototype with the size of 120 mm (length × 120 mm (width × 55 mm (height is developed. The measured polarization tracking patterns of the prototype are given. The polarization tracking beam can be steered in the elevation up to 50°. The gain of no less than 16.0 dBi and the aperture efficiency of more than 50% are obtained. The measured and simulated polarization tracking patterns agreed well.

  6. Efficient gene replacements in ku70 disruption strain of Aspergillus chevalieri var. intermedius

    Directory of Open Access Journals (Sweden)

    Qingqing Huang

    2017-01-01

    Full Text Available Aspergillus chevalieri var. intermedius is a dominant filamentous fungal species in Fuzhuan tea and is associated with the quality and health benefits of this tea. The sexual or asexual reproduction of this fungus depends on the osmotic pressure of the tea. Efforts to enhance the beneficial effects of A. chevalieri var. intermedius are hampered by difficulties in disrupting its genes. To address this issue, we identified the A. chevalieri var. intermedius homolog (Acku70 of human Ku70 and generated an Acku70 disruption strain (ΔAcku70, aiming to improve the gene replacement efficiency. ΔAcku70 grew at a slightly lower rate in vitro than the wild-type strain; however, the two strains exhibited similar sensitivity to temperature, osmotic pressure and the effects of ethyl methane sulphonate and H2O2. The replacement efficiency of veA and flbA dramatically increased in ΔAcku70 compared to that in the wild type. The efficiency of flbA replacement increased from 2.6% to 80%, whereas the frequency of veA disruption increased from 15.2% to 83.9% and from 30.8% to 86.8%. Thus, ΔAcku70 is suitable for use as a type strain for large-scale functional genomic analysis of A. chevalieri var. intermedius.

  7. Pusaudžu agresivitātes saistība ar vecāku audzināšanas stilu.

    OpenAIRE

    Dambe, Agnese

    2007-01-01

    Šajā darbā tiek apskatīta viena no mūsdienu būtiskākajām problēmām- pusaudžu agresivitāte. Pētījuma mērķis bija noskaidrot, vai pastāv statistiski nozīmīgas saistības starp vecāku audzināšanas stilu un pusaudžu agresivitāti. Pētījuma izlasi veido 60 pusaudži (30 jaunietes un 30 jaunieši) no pilnām ģimenēm, vecumposmā no 15-17 gadiem. Pētījumā tika izmantotas divas pētījuma metodes- A.H. Bassa (A.H. Buss)- A. Darki (A. Durkee) aptaujas anketa agresīvu reakciju noteikšanai un ...

  8. Oxygen Isotope Records in Modern Oyster Shells from Chi Ku, Tainan and Their Implication of Seasonality

    Science.gov (United States)

    Chen, Y. C.; Mii, H. S.; Li, K. T.

    2015-12-01

    To exam whether oxygen isotope records of Crassostrea gigasoysters can be used as proxies of environment, 133 cultivated oysters and 21 water samples were collected from Chi Ku area, Tainan City, southern Taiwan in December of 2012, and from March, 2013 to July, 2014. Instrumental air and water temperatures and precipitation records were obtained from a nearest Central Weather Bureau (CWB) station roughly 16 km north of Chi Ku. The oxygen and carbon isotope values of the ligamental area of the modern oyster shells are from -6.92‰ to -0.08‰ (-3.05 ± 1.17‰, N = 2280; 1σ; VPDB) and from -5.57‰ to 0.63‰ (-1.88 ± 0.81‰), respectively. Oxygen isotope values of the water samples are mainly between -0.28‰ and 0.74‰ (0.18 ± 0.29‰, N = 20; 1σ; VSMOW). However, water oxygen isotope value of -2.75‰ was observed for the water sample collected immediately after a typhoon heavy rainfall. Seasonal temperature fluctuation pattern of estimated oxygen isotope temperatures from modern shells is similar to that of CWB instrumental records. However, the oxygen isotope temperatures are respectively about 3 °C and 10°C higher than those of instrumental records for winter and summer. Higher estimated oxygen isotope temperatures are most likely caused by underestimated fraction of freshwater. We analyzed 5 archaeological oyster shells of Siraya culture (500~250B.P.) collected from Wu Chien Tuso North (WCTN) archaeological site of Tainan branch of Southern Taiwan Science Park to infer the harvest season of mollusks. Oxygen isotope values of the ligamental area of the archaeological oyster shells are between -5.98‰ and -1.26‰ (-3.34 ± 1.37‰, N = 60; 1σ), and carbon isotope values are between -3.21‰ and 0.60‰ (-2.04‰ ± 0.55‰). The oxygen isotope records of archaeological oyster shells also showed clear seasonality. Most of the oysters were collected in autumn and winter. Oxygen isotope values of archaeological oyster shells was 1‰ greater than that

  9. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    Institute of Scientific and Technical Information of China (English)

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  10. Tracking- and Scintillation-Aware Channel Model for GEO Satellite to Land Mobile Terminals at Ku-Band

    Directory of Open Access Journals (Sweden)

    Ali M. Al-Saegh

    2015-01-01

    Full Text Available Recent advances in satellite to land mobile terminal services and technologies, which utilize high frequencies with directional antennas, have made the design of an appropriate model for land mobile satellite (LMS channels a necessity. This paper presents LMS channel model at Ku-band with features that enhance accuracy, comprehensiveness, and reliability. The effect of satellite tracking loss at different mobile terminal speeds is considered for directional mobile antenna systems, a reliable tropospheric scintillation model for an LMS scenario at tropical and temperate regions is presented, and finally a new quality indicator module for different modulation and coding schemes is included. The proposed extended LMS channel (ELMSC model is designed based on actual experimental measurements and can be applied to narrow- and wide-band signals at different regions and at different speeds and multichannel states. The proposed model exhibits lower root mean square error (RMSE and significant performance observation compared with the conventional model in terms of the signal fluctuations, fade depth, signal-to-noise ratio (SNR, and quality indicators accompanied for several transmission schemes.

  11. Cave bear (Ursus spelaeus Rosenmüller & Heinroth males' den from Velika Pećina in Duboka Near Kučevo, Eastern Serbia

    Directory of Open Access Journals (Sweden)

    Dimitrijević Vesna M.

    2002-01-01

    Full Text Available More a 100 years after the first research in the cave Velika pećina in Duboka near Kučevo cave bear remains were discovered in a small chamber cut off from the passable channels by a 7 m high slope. A whole skull, bones of a forearm in articulation, and other skeleton parts were laying on the cave floor encrusted in travertine cover and in some places overgrown by stalagmites. Bones belonged to adult males, which found there the shelter to hibernate, in a short epizode that ended by closing the channels that once linked this part of the cave to a surface.

  12. Analysis and comparison model for measuring tropospheric scintillation intensity for Ku-band frequency in Malaysia

    Directory of Open Access Journals (Sweden)

    Mandeep JS

    2011-06-01

    Full Text Available This study has been based on understanding local propagation signal data distribution characteristics and identifying and predicting the overall impact of significant attenuating factors regarding the propagation path such as impaired propagation for a signal being transmitted. Predicting propagation impairment is important for accurate link budgeting, thereby leading to better communication network system designation. This study has thus used sample data for one year concerning beacon satellite operation in Malaysia from April 2008 to April 2009. Data concerning 12GHz frequency (Ku-band and 40° elevation angle was collected and analysed, obtaining average signal amplitude value, ÷ and also standard deviation ó which is normally measured in dB to obtain long-term scintillation intensity distribution. This analysis showed that scintillation intensity distribution followed Gaussian distribution for long-term data distribution. A prediction model was then selected based on the above; Karasawa,
    ITU-R, Van de Kamp and Otung models were compared to obtain the best prediction model performance for selected data regarding specific meteorological conditions. This study showed that the Karasawa model had the best performance for predicting scintillation intensity for the selected da ta.

  13. Y Kuşağının Mobil Öğrenme Uygulama Tercihini Etkileyen Faktörlerin İncelenmesi

    OpenAIRE

    ALTUNTAŞ, Başar

    2017-01-01

    Mobilteknolojilerin öğrenme ortamlarına dâhil edilmesiyle birlikte öğrenme faaliyetifiziksel sınırların dışına çıkmış ve farklı bir boyuta evrilmiştir. Tasarlanan öğrenmeuygulamaları kullanıcılarına zamandan ve mekândan bağımsız öğrenme fırsatısunarken, yeni ve farklı deneyimleri de beraberinde getirmiştir. Bu çalışmada,Y kuşağının mobil öğrenme uygulamalarını tercih etmesini ve kullanmasınıetkileyen faktörler incelenmiştir. Teknoloji kabul modeli ile beklenti-kabul modelitemelinde tasarlanan...

  14. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Directory of Open Access Journals (Sweden)

    Mobo Gao

    2007-01-01

    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  15. Kuş Gölü (Bandırma Makrobentik Omurgasız Faunası Hakkında Bir Ön Araştırma.

    Directory of Open Access Journals (Sweden)

    Süleyman Balık

    2015-12-01

    Full Text Available Kuş Gölü’nün makrobentik omurgasız faunasını belirlemek amacıyla 1987 ve 1988 yılları arasında aylık periyotlar halinde, bir yıl süre ile 5 istasyonda arazi çalışması yapılmıştır. Ekman grab ile alınan çamur örnekleri 500 μm göz açıklığındaki elekten geçirilmiş ve örnekler %4’lük formaldehit solüsyonunda tespit edilmiştir. Araştırma sonucunda, Oligochaeta sınıfından 10, Chironomidae familyasından 5 ve Ceratopogonidae familyasından 1 olmak üzere toplam 16 takson tespit edilmiştir. Kuş gölü’nde metrekarede ortalama 6759 birey tespit edilmiş, grupların oransal dağılımında %81,94 ile Oligochaeta bireylerinin en baskın grubu oluşturduğu, bu grubu Chironomidae (%17,90 ve Ceratopogonidae (%0,16 larvalarının takip ettiği saptanmıştır. Tespit edilen grupların istasyonlara göre oransal dağılımlarında ise, 1. istasyonun en zengin (%28,71, 4. istasyonun en fakir (%12,77 istasyon olduğu gözlenmiştir

  16. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Science.gov (United States)

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  17. Pusaudžu - hokeja spēlētāju sasniegumu stratēģijas un apmierinātības izjūta, spēlējot hokeju, saistībā ar vecāku audzināšanas stiliem.

    OpenAIRE

    Stālmane, Liene

    2014-01-01

    Maģistra darba mērķis bija izpētīt saistības starp pusaudžu, kuri trenējas hokejā jau no agrīna vecuma, sasniegumu stratēģijām, apmierinātības izjūtu, spēlējot hokeju, un viņu vecāku audzināšanas stilus. Pētījumā tika iekļauti 53 respondenti latviešu tautības zēni, vecumā no 9 – 14 gadiem, kuri trenējas hokejā. Par pētījuma instrumentāriju izmantotas: 1)Vecāku audzināšanas stila aptauja. (Parental Authority Questionnaire (PAQ), Buri, 1991); 2) Sasniegumu stratēģiju aptauja....

  18. Vecāku audzināšanas stilu saistība ar pašcieņu pusaudžu vecumā

    OpenAIRE

    Miķelsone-Ježaka, Dace

    2008-01-01

    Darba mērķis ir izpētīt pašcieņas saistību ar mātes un tēvu audzināšanas stilu bērnībā. Pētījumā piedalījās 105 pusaudži no dažādām skolām vecumā no 16 līdz 18 gadiem, kas dzīvo pilnās ģimenēs. Tika izmantotas 2 aptaujas: 1. Vecāku autoritātes novērtējuma aptauja (The Parental Authority Questionnaire, Buri, 1991; Griškina, 2002). 2. Rozenberga pašcieņas aptauja (The Rosenberg Self – esteem Scale, Rosenberg, 1965).

  19. Vecāku audzināšanas stila saistība ar pusaudžu vientulības izjūtu

    OpenAIRE

    Vlasova, Iveta

    2013-01-01

    Pētījuma jautājums: Vai starp mātes audzināšanas stilu un vientulības līmeni pusaudžiem pastāv saistība? Pētījuma dalībnieki. Viena izlase, pēc pieejamības principa. Dalībnieku vecums: 12-16 gadi, 31 meitene, 23 zēni. Dzīvojoši pilnās ģimenēs. Pētījuma metode. 1.Lieto, lai noteiktu kopējo vientulības izjūtas līmeni, tika izmantota Vientulības skala (UCLA Loneliness Scale/UCLA LS/, VERSION 3; Russel, D.W. 1996).– visu jautājumu summa. 2.Vecāku audzināšanas stila aptauja (Parental...

  20. Comparison of neutron and gamma irradiation effects on KU1 fused silica monitored by electron paramagnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Bravo, D. [Department Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain)], E-mail: david.bravo@uam.es; Lagomacini, J.C. [Department Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Leon, M.; Martin, P. [Materiales para Fusion, CIEMAT, Avda. Complutense 22, E-28040 Madrid (Spain); Martin, A. [Department Fisica e Instalaciones, ETS Arquitectura UPM, E-28040 Madrid (Spain); Lopez, F.J. [Department Fisica de Materiales, Universidad Autonoma de Madrid, E-28049 Madrid (Spain); Ibarra, A. [Materiales para Fusion, CIEMAT, Avda. Complutense 22, E-28040 Madrid (Spain)

    2009-06-15

    Electron paramagnetic resonance (EPR) studies have been carried out on KU1 fused silica irradiated with neutrons at fluences 10{sup 21} and 10{sup 22} n/m{sup 2}, and gamma-ray doses up to 12 MGy. The effects of post-irradiation thermal annealing treatments, up to 850 deg. C, have also been investigated. Paramagnetic oxygen-related defects (POR and NBOHC) and E'-type defects have been identified and their concentration has been measured as a function of neutron fluence, gamma dose and post-irradiation annealing temperature. It is found that neutrons at the highest fluence generate a much higher concentration of defects (mainly E' and POR, both at concentrations about 5 x 10{sup 18} spins/cm{sup 3}) than gamma irradiations at the highest dose (mainly E' at a concentration about 4 x 10{sup 17} spins/cm{sup 3}). Moreover, for gamma-irradiated samples a lower treatment temperature (about 400 deg. C) is required to annihilate most of the observed defects than for neutron-irradiated ones (about 600 deg. C)

  1. Ufundishaji wa Kusoma na Kuandika Kiswahili: Uzoefu wa Idara ya ...

    African Journals Online (AJOL)

    Makala haya yanahusu shughuli za kufundisha Kiswahili kama lugha ya kigeni katika Chuo Kikuu cha Sebha nchini Libya. Kwanza inaeleza historia ya Kiswahili – yaani kilianza lini kufundishwa kwa madhumuni gani na nani walikuwa wanzilishi. Halikadhalika makala ya naeleza utaratibu uliowekwa na idara ili kuweza ...

  2. Faktorová analýza antropometrických charakteristik u mladých plavců ve věku 11 a 12 let Factor analysis of anthropometric characteristics in young swimmers aged 11 and 12

    Directory of Open Access Journals (Sweden)

    Zofia Ignasiak

    2006-02-01

    Full Text Available Cílem této práce bylo popsat vybrané somatické charakteristiky typické pro mladé plavce. Faktorová analýza umožnila úměrné snížení somatických ukazatelů a umožnila vypočítat hlavní strukturální faktory typické pro mladé plavce. Do výzkumného souboru bylo zařazeno 80 žáků (11 a 12letých přijatých ke studiu na základní sportovní škole ve Wroclawi. Sledovaní probandi trénovali po dobu 2–3 let a jejich průměrný tréninkový čas byl 12 až 18 hodin týdně. Byly měřeny následující parametry: tělesná výška a hmotnost, délka horních a dolních končetin, obvod stehen, lýtka, paží, předloktí, hrudníku v klidu, hrudníku po nádechu a po výdechu, obvod pasu a boků, šířka ramen, šířka boků, šířka hrudníku, hloubka hrudníku a Rohrerův index. K dosažení cíle této studie byla použita metoda faktorové analýzy. Analýza výsledků ukázala, že pouze některé zvláštnosti mezi sledovanými parametry jsou pro mladé plavce charakteristické. Jsou spojeny do 2 trsů somatických charakteristik: kubický obsah (zahrnuje tělesnou hmotnost, svalstvo, trup a obvod horních a dolních končetin a vertikální rozměr (zahrnuje tělesnou výšku a délku horních a dolních končetin. Tyto parametry signalizují formování postavy typické pro plavce, charakteristické specifickými proporcemi tělesné hmotnosti a výšky, hrudníku a boků a obvykle delšími končetinami. Výsledky naznačují, že antropometrické charakteristiky lze použít pro optimalizaci tréninkového procesu mladých plavců. The aim of this study was to describe the set of somatic characteristics, which significantly discriminate young swimmers. The factor analysis let us reduce the number of somatic traits mostly correlated and to calculate the main structural factors typical for young swimmers. There were 80 pupils (11 and 12 years old from the primary sport school in Wroclaw recruited for the study

  3. A Novel Ku-Band/Ka-Band and Ka-Band/E-Band Multimode Waveguide Couplers for Power Measurement of Traveling-Wave Tube Amplifier Harmonic Frequencies

    Science.gov (United States)

    Wintucky, Edwin G.; Simons, Rainee N.

    2015-01-01

    This paper presents the design, fabrication and test results for a novel waveguide multimode directional coupler (MDC). The coupler, fabricated from two dissimilar frequency band waveguides, is capable of isolating power at the second harmonic frequency from the fundamental power at the output port of a traveling-wave tube (TWT) amplifier. Test results from proof-of-concept demonstrations are presented for a Ku-band/Ka-band MDC and a Ka-band/E-band MDC. In addition to power measurements at harmonic frequencies, a potential application of the MDC is in the design of a satellite borne beacon source for atmospheric propagation studies at millimeter-wave (mm-wave) frequencies (Ka-band and E-band).

  4. Fiscal 1993 achievement report. International Clean Energy Network Using Hydrogen Conversion (WE-NET) technology (Subtask 8 - Development of hydrogen combustion turbine - Development of main accessories); 1993 nendo seika hokokusho. Suiso riyo kokusai clean energy system gijutsu (WE-NET) (Subtask 8. Suiso nensho tabin no kaihatsu - Shuyo hokirui no kaihatsu)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-03-01

    In the first fiscal year 1993 of the project, surveys were conducted about current technologies relative to cold energy-utilizing oxygen production equipment and high-temperature heat exchangers for the development of main accessories for a hydrogen combustion turbine plant. Kobe Steel, Ltd., conducted surveys about very low temperature heat exchangers and cold energy utilization technology used in facilities for gasifying liquid hydrogen or liquefied gas. Daido Hoxan, Inc., in its research on the possibility of air separator performance enhancement through liquid hydrogen cold energy application, studied reduction in power unit requirement, stable power supply responding to changes in load, safety measures, and so forth. Toshiba Corporation conducted surveys and studies about heat conduction improvement techniques and about the type, structure, and materials for heat exchangers for the embodiment of a high-temperature heat exchanger excellent in performance and high in structural soundness. Mitsubishi Heavy Industries, Ltd., aiming to establish basic technologies for heat exchangers, studied efficiency enhancement with low pressure loss, improved hygroscopic moisture removing function, and new materials utilization for achieving high-temperature capability. (NEDO)

  5. Beretning for undersøgelse af bopladsområde med værkstedsaktivitet fra yngre jernalder/vikingetid, neolitiske anlæg fortrinsvis fra MN A III og en grav fra MN B II. Kalmergården (KU) 2000

    DEFF Research Database (Denmark)

    Bican, Josefine Franck

    2001-01-01

    anlæggelse er omtalt nedenfor i en separat beretning ved Lone Gebauer Thomsen (se bilag 2). Yngre jernalder/vikingetid er den periode, der var bedst repræsenteret på pladsen. Her var spor efter en markeds-/produktionsplads, der er registreret vha. 3735 detektorfund, hvor især sølvskatten (KU 2337) skal...

  6. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Science.gov (United States)

    Yan, Xuemei; Zhang, Qianying; Feng, Fang

    2016-04-01

    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Styl radzenia sobie ze stresem jako moderator związku lęku z neurotyzmem u osób z reumatoidalnym zapaleniem stawów

    Directory of Open Access Journals (Sweden)

    Michał Ziarko

    2011-06-01

    Full Text Available Lęk stanowi jedną z konsekwencji chorób przewlekłych, w tymreumatoidalnego zapalenia stawów (RZS. Wysoki poziom lękuobniża jakość życia pacjentów, prowadzi do zachowań antyzdrowotnychoraz może wpływać na gorszy przebieg choroby. Związekneurotyzmu z lękiem został dotąd dobrze udokumentowany. Neurotyzmstanowi cechę temperamentu, a więc w niewielkim stopniumożna ją modyfikować. Redukcja kosztów psychicznych ponoszonychprzez osoby o wysokim poziomie neurotyzmu wymagapoznania czynników, które mogłyby ograniczać wpływ neurotyzmuna poziom lęku (czynniki moderujące relację neurotyzm–lęk.Celem badania było określenie zmiennych moderujących relacjępomiędzy neurotyzmem a lękiem.W badaniach wzięło udział 100 osób chorujących na RZS (78 ko -biet i 22 mężczyzn. Zostali oni przebadani za pomocą kwestionariuszymierzących: poziom lęku, style radzenia sobie ze stresemoraz wymiary osobowości. Obliczono współczynniki korelacjir Pearsona pomiędzy mierzonymi zmiennymi oraz wykonano analizęmoderacji związku pomiędzy neurotyzmem a lękiem jakostanem za pośrednictwem stylów radzenia sobie ze stresem.Testowanie interakcji przeprowadzono metodą najmniejszych kwadratówi regresji logistycznej.Ustalono, że istnieje wprost proporcjonalny związek pomiędzyneurotyzmem a lękiem rozumianym jako stan (r = 0,63; p < 0,01(tab. I. Zaobserwowano, że związek ten nie zachodzi w przypadkuosób o wysokim neurotyzmie posługujących się unikowym stylem radzenia sobie ze stresem (R2 = 0,19; F = 7,00; p < 0,001 (ryc. 1oraz u osób poszukujących kontaktów towarzyskich (R2 = 0,22;F = 8,70; p < 0,001 (ryc. 2, tab. II.Wyniki wskazują, że silny neurotyzm zwiększa prawdopodobieństworeagowania podwyższonym poziomem lęku w obliczu pojawiającychsię objawów oraz zagrożeń będących konsekwencjąchoroby. Zaobserwowane zależności potwierdzają hipotezę, żetemperament jest czynnikiem ryzyka w rozwoju zaburze

  8. The miracle of a mountain moving out to the sea: the creation of new human space.

    Science.gov (United States)

    Kuroda, T

    1985-10-01

    Port Island is an artificial island made up of sand and soil from Mount Takakura in the Rokko mountain range of Japan. The materials were carried to the coast of Suma a distance of 7.1 kilometers by a specially devised overhead conveyor belt from Kobe City. Work on the island still continues today. On the average, 7000 dump trucks a day have been mobilized at the conveyor belt facilities. The materials are transported from the coast by pusher-barges that have specially designed bottoms that open and dump the building materials on the sea bed. The island is linked to Kobe City by a huge bridge. It is serviced by a fully automatic monorail. A new city was also created at the site where the sand and soil were removed. A joint study with the Kobe City authority and local experts under the support and cooperation of the United Nations Fund for Population Activities (UNFPA) was initiated. The administrative structure and financing required of a project of this magnitude need to be examined. The organizational structure and management style of local governments undertaking the project were non-bureaucratic, efficient and flexible. Kobe City authorities secured the necessary funds by issuing the German mark bond. A research on Kobe City and the redistribution of population is planned. More living space and better living conditions resulted from the project.

  9. Drinking Parties and Learning: A Tale from Japan

    Science.gov (United States)

    Suchan, Jim

    2007-01-01

    In spring of 2006, the author spent a semester teaching undergraduate and graduate business and managerial communication courses at Chuo University, with intent to challenge his US-centric habits of mind about interaction and communication by immersing himself in a cultural and work environment fundamentally different from his own. Although…

  10. Use of combined ion exchangers on the basis of KU-23 and KM-2p cation exchangers for purification of ammonium molybdate and tungstate solutions from phosphate, arsenate, and silicate impurities

    International Nuclear Information System (INIS)

    Blokhin, A.A.; Majorov, D.Yu.; Kopyrin, A.A.; Taushkanov, V.P.

    2002-01-01

    Using the Tracer technique ( 32 P) and elementary analysis, potentiality of using combined ionites on the basis of macroporous cation-exchange resins KU-23 or KM-2p and hydrated zirconium oxide for purification of concentrated solutions of ammonium molybdate and tungstate from phosphate-, arsenate-, and silicate-ions impurities was studied. High selectivity of the combined ionites towards impurity ions was ascertained, which permits reducing the content of impurities by a factor of 50-100 compared with the initial one [ru

  11. Extracted atmospheric impairments on earth-sky signal quality in tropical regions at Ku-band

    Science.gov (United States)

    Al-Saegh, Ali Mohammed; Sali, Aduwati; Mandeep, J. S.; Ismail, Alyani

    2013-11-01

    Atmospheric condition variations were shown to have a major effect on the earth sky signal quality at Ku band. Moreover, such variations increased in the tropical regions as compared to temperate areas due to their different weather parameters. With the increase of recent satellite communication technology applications throughout the tropical countries and lack of information regarding the atmospheric impairments analysis, simulation and mitigation techniques, there is an ever increasing need for extracting a unique and accurate performance of the signal quality effects during highly natural tropical weather impairments. This paper presents a new method developed for proper analysis with distinctive and highly realistic performance evaluation for signal quality during the atmospheric conditions variations in 14 tropical areas from the four continents analyzed based on actual measured parameters. The method implementation includes signal attenuation, carrier to noise ratio, symbol energy to noise ratio, and symbol error rate at different areas and different modulation schemes. Furthermore, for improvement in analysis in terms of covering more remarkable regions in tropics, the paper provides new measurements data with analysis for certain region in tropics used as a test bed and to add measurement data of such area to the world's data base for future researchers. The results show a significant investigation and performance observation in terms of weather impairments in tropical regions in general and each region in that area in particular regarding the signal attenuation and error rates accompanied for several transmission schemes.

  12. Download this PDF file

    African Journals Online (AJOL)

    J. S. Nyombo Luboya

    P.O. Box 3006, Chuo Kikuu, Morogoro, TANZANIA. 2. Applied Human ... INTRODUCTION. Sweet potato (Ipomoea batatas L) is grown as a food crop in most parts of the world, ... diet and health status. .... Effect of drying on ascorbic acid, carotenoids, iron, calcium, oxalates and polyphenols ..... 1983; 10: 205-210. 28. Garman ...

  13. Kinetics of destruction of KU-2 x 8 and AV-17 x 8 ion-exchange resins by the joint action of heating and irradiation

    International Nuclear Information System (INIS)

    Tulupov, P.E.; Butenko, T.Yu.

    1982-01-01

    Experimental data indicates a decrease of the exchange capacity of AV-17 x 8 (OH) resin in ion-exchange beds at various temperatures. Losses of exchange of the resin in hydroxyl form after 10,000h of continuous heating at 60, 70, and 80 0 C are 24, 44, and 78% respectively. Partial replacement of the hydroxyl by the salt form is accomplished by appreciable lowering of capacity losses. The trimethlyamine evolved during deamination of AV-17 x 8 anion exchange resin, and only methanol, enters the coolant. Under the influence of ionizing radiation in the active zone the methanol will be converted successively into formaldehyde, formic acid and CO 2 . Thus the maximum temperature of use of the hydroxyl form of te anion-exchange resin AV-17 x 8 (OH) in nuclear power plants can be raised to 70-75 0 C. Brief changes of temperature at 100 0 C do not cause any appreciable losses of exchange capacity either. Physicochemical properties of ion-exchange resins after use in nuclear power plants leads to excessive and unjustified restriction of their service life in the course of a single cycle. Joint action of heating and irradiation on AV-17 anion-exchange resin was studied. It was found that rate constants of the processes of thermal radiation decreases the exchange capacities of the resins in the temperature ranges of interest with relation to nuclear power plants. Calculation of the stability of KU-2 x 8 cation-exchange resin shows that even after a year of use at 100 0 C the loss of its exchange capacity is less than 0.1%. Therefore, under the conditions of use in a nuclear power plant KU-2 x 8 resin can be regarded as absolutely stable. The loss of exchange capacity of AV-17 x 8 resin in C1 form at 100 0 C is of similar magnitude

  14. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Directory of Open Access Journals (Sweden)

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  15. Pašvērtējuma, apmierinātības ar dzīvi un agresijas atšķirības pieaugušajiem ar un bez bērnībā pieredzētas vecāku šķiršanās

    OpenAIRE

    Ekarte, Marika

    2013-01-01

    Pētījuma mērķis ir noskaidrot vai pastāv atšķirības starp uzrādītajiem pašvērtējuma, apmierinātības ar dzīvi un agresijas rādītājiem respondentiem ar bērnībā pieredzētu vecāku šķiršanos un respondentiem bez vecāku šķiršanās pieredzes, kontrolējot dzimumu. Pētījuma mērķa noskaidrošanā pielietota pašvērtējuma aptauja (Rosenberg Self-Esteem Scale, RSE, Rosenberg, 1965), apmierinātības ar dzīvi aptauja (Satisfaction with life scales. Diener, 1985), agresijas līmeņa noteikšanai - agre...

  16. Utilization of steel bellows expansion joints to improve the earthquake resistance of pipelines and piping-systems; Einsatz von Stahlkompensatoren zur Erhoehung der Erdbebensicherheit von Rohrleitungen und Rohrsystemen

    Energy Technology Data Exchange (ETDEWEB)

    Silbe, H. [IWK Regler und Kompensatoren GmbH, Berlin (Germany). Ingenieurbuero

    2001-07-01

    Seismic damages of lifelines could cause catastrophic consequences for life and environment. Defects in the gas system could be the reason for fires, the lack of water because of broken water pipes leads to problems in fire-fighting. The loss of potable water service could cause epidemics, further a preventing energy transmission and media service in hospitals could lead to difficulties in the medical treatment of victims. For instants during the Kobe 1995 earthquake, Kobe's water system sustained approximately 2000 breaks. The resulting lack of water contributed significantly to the fire problem due to the damages of Kobe's gas system. (orig.) [German] Erdbebenbedingte Schaeden an Versorgungsleitungen koennen katastrophale Folgen fuer Menschen und Umwelt hervorrufen. Defekte Gasleitungen koennen Ursache fuer Grossbraende sein, deren Bekaempfung durch zerstoerte Wasserversorgungsleitungen erschwert oder unmoeglich ist, eine unterbrochene Trinkwasserversorgung kann zu Epidemien fuehren, nicht zuletzt kann eine unterbrochene Energie- bzw. Medienversorgung in Krankenhaeusern zu Problemen bei der Versorgung von Verletzten fuehren. Das Wassernetz Kobes erfuhr beispielsweise infolge des Erdbebens 1995 mehr als 2000 Brueche. Wegen des zerstoerten Wasserversorgungsnetzes war eine Bekaempfung des Grossfeuers, hervorgerufen durch Brueche im Gasnetz, nicht moeglich. (orig.)

  17. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Science.gov (United States)

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  18. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Directory of Open Access Journals (Sweden)

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  19. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    International Nuclear Information System (INIS)

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  20. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  1. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Energy Technology Data Exchange (ETDEWEB)

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  2. Differentiating Social Phobia from Shyness

    OpenAIRE

    Heiser, Nancy A.; Turner, Samuel M.; Beidel, Deborah C.; Roberson-Nay, Roxann

    2008-01-01

    To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group...

  3. 10- 12 gadus vecu bērnu ar atkārtotu nesekmību iemācītās bezpalīdzības saistība ar vecāku iemācīto bezpalīdzību

    OpenAIRE

    Lamstere, Jolanta

    2006-01-01

    Darbā tika pētīta iemācītās bezpalīdzības saistība bērniem ar vecāku iemācīto bezpalīdzību. Pētījuma gaitā tika izvirzīti pētījuma jautājumi: vai pastāv statistiski nozīmīgas sakarības starp iemācītās bezpalīdzības rādītājiem 10- 12 gadus veciem bērniem ar atkārtotu nesekmību un viņu vecāku iemācītās bezpalīdzības rādītājiem; vai pastāv statistiski nozīmīgas atšķirības starp iemācītās bezpalīdzības rādītājiem bērniem ar atkārtotu nesekmību un sekmīgiem bērniem; vai pastāv statistiski nozīmīga...

  4. Microwave absorption in X and Ku band frequency of cotton fabric coated with Ni–Zn ferrite and carbon formulation in polyurethane matrix

    International Nuclear Information System (INIS)

    Gupta, K.K.; Abbas, S.M.; Goswami, T.H.; Abhyankar, A.C.

    2014-01-01

    The present study highlights various microwave properties, i.e. reflection, transmission, absorption and reflection loss, of the coated cotton fabric [formulation: Ni–Zn ferrite (Ni 0.5 Zn 0.5 Fe 2 O 4 ) and carbon black (acetylene black) at concentrations of 30, 40, 50, 60 and70 g of ferrite and 5 g carbon in each 100 ml polyurethane] evaluated at 8–18 GHz frequency. The uniform density of filling materials in coated fabrics (dotted marks in SEM micrograph) indicates homogeneous dispersion of conducting fillers in polyurethane and the density of filling material cluster increases with increase in ferrite concentration. SEM images also show uniform coating of conducting fillers/resin system over individual fibers and interweave spaces. The important parameters governing the microwave properties of coated fabrics i.e. permittivity and permeability, S-parameters, reflection loss, etc. were studied in a HVS free space microwave measurement system. The lossy character of coated fabric is found to increase with increase of ferrite content; the ferrite content decreases the impedance and increases the permittivity and permeability values. The 1.6–1.8 mm thick coated fabric sample (40 wt% ferrite, 3 wt% carbon and 57 wt% PU) has shown about 40% absorption, 20% transmission and 40% reflectance in X (8.2–12.4 GHz) and Ku (12–18 GHz) frequency bands. The reflection loss at 13.5 GHz has shown the highest peak value (22.5 dB) due to coated sample optical thickness equal to λ/4 and more than 7.5 dB in entire Ku band. Owing to its thin and flexible nature, the coated fabric can be used as apparel in protecting human being from hazardous microwaves and also as radar camouflage covering screen in defense. - Highlights: • Ni–Zn ferrite (Ni 0.5 Zn 0.5 Fe 2 O 4 ) with acetylene black found effective coating for microwave absorption. • Coating formulation containing 40 wt% ferrite, 3 wt% carbon and 57 wt% PU offered 40% absorption, 20% transmission and 40% reflection

  5. Microwave absorption in X and Ku band frequency of cotton fabric coated with Ni–Zn ferrite and carbon formulation in polyurethane matrix

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, K.K., E-mail: krishna62@rediffmail.com [Defence Materials and Stores Research and Development Establishment, Kanpur PO, GT Road, Kanpur 208013 (India); Abbas, S.M.; Goswami, T.H. [Defence Materials and Stores Research and Development Establishment, Kanpur PO, GT Road, Kanpur 208013 (India); Abhyankar, A.C. [Defence Institute of Advanced Technology( DIAT), Giri Nagar, Pune 411025 (India)

    2014-08-01

    The present study highlights various microwave properties, i.e. reflection, transmission, absorption and reflection loss, of the coated cotton fabric [formulation: Ni–Zn ferrite (Ni {sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4}) and carbon black (acetylene black) at concentrations of 30, 40, 50, 60 and70 g of ferrite and 5 g carbon in each 100 ml polyurethane] evaluated at 8–18 GHz frequency. The uniform density of filling materials in coated fabrics (dotted marks in SEM micrograph) indicates homogeneous dispersion of conducting fillers in polyurethane and the density of filling material cluster increases with increase in ferrite concentration. SEM images also show uniform coating of conducting fillers/resin system over individual fibers and interweave spaces. The important parameters governing the microwave properties of coated fabrics i.e. permittivity and permeability, S-parameters, reflection loss, etc. were studied in a HVS free space microwave measurement system. The lossy character of coated fabric is found to increase with increase of ferrite content; the ferrite content decreases the impedance and increases the permittivity and permeability values. The 1.6–1.8 mm thick coated fabric sample (40 wt% ferrite, 3 wt% carbon and 57 wt% PU) has shown about 40% absorption, 20% transmission and 40% reflectance in X (8.2–12.4 GHz) and Ku (12–18 GHz) frequency bands. The reflection loss at 13.5 GHz has shown the highest peak value (22.5 dB) due to coated sample optical thickness equal to λ/4 and more than 7.5 dB in entire Ku band. Owing to its thin and flexible nature, the coated fabric can be used as apparel in protecting human being from hazardous microwaves and also as radar camouflage covering screen in defense. - Highlights: • Ni–Zn ferrite (Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4}) with acetylene black found effective coating for microwave absorption. • Coating formulation containing 40 wt% ferrite, 3 wt% carbon and 57 wt% PU offered 40% absorption, 20

  6. Pusaudžu tipiskās reakcijas pēc vecāku laulības šķiršanas.

    OpenAIRE

    Steļmaha, Elza

    2011-01-01

    Rezumējums Pētījuma „Pusaudžu depresija un uzvedības problēmas pēc vecāku laulības šķiršanas” mērķis bija noskaidrot kādas ir pusaudžu uzvedības un depresijas atšķirības starp šķirtajām un pilnajām ģimenēm.. Pētījuma papildus daļas mērķis bija noskaidrot kādas ir atšķirības depresijas izpausmēm un uzvedības problēmām, meitenēm un zēniem gan šķirto, gan pilno ģimeņu izlasē. Pētījumā piedalījās 60 respondenti vecuma grupā no 13-16 gadiem, 30 pusaudžiem vecāki ir šķiršanās procesā vai šķīr...

  7. From Resident to President: The Sinuous Participation of Paraguayan Women in Politics and the Emergence of the Feminist Political Movement Kuña Pyrenda

    Directory of Open Access Journals (Sweden)

    Sarah Cerna Villarga

    2015-07-01

    Full Text Available Paraguayan women have transcended history as the mothers of the “Guarani breed”, as The Resident Woman Residentas, the social role of these has been undeniable, but in other scopes, such as the political area, its social and historical role is still invisible, because the policy has historically been considered a male activity. However, many women have contributed to the construction of the history of this nation, and although the asymmetries in the real access to power between men and women are notorious today, Paraguayan want power and will seek, as it was found in the last two presidential elections of 2008 and 2013. On this basis, this paper aims to describe what has been the impact of feminism in Paraguayan politics and, in turn, explain the factors that have influenced raid Kuña Pyrenda feminist movement in the elections of 2013.

  8. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Science.gov (United States)

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang

    2018-05-30

    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  9. Review of the genus Pentacentrus Saussure (Orthoptera: Gryllidae: Pentacentrinae) from China .

    Science.gov (United States)

    Liu, Hao-Yu; Mao, Shao-Li; Shi, Fu-Ming

    2014-07-22

    Four new species of Pentacentrus Gorochov from China are described and illustrated, P. acutiparamerus Liu & Shi sp. nov., P. biflexuous Liu & Shi sp. nov., P. emarginatus Liu & Shi sp. nov. and P. parvulus Liu & Shi sp. nov. A key and a distribution map of the Chinese species of this genus are provided.

  10. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Science.gov (United States)

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  11. Statistical analysis on dominating factor of pH in rain and snow sample. Investigation on water analysis from January, 1984 through December, 1986 sampled at Chuo-ku, Sapporo city

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Norimoto; Kishi, Masami; Hayakawa, Osamu

    1988-03-31

    On the each samples of rain and snow collected in the City of Sapporo from January 1984 through December 1986, analyses were made in eleven ionic species, amount of rainfall, conductivity, ninhydrin-N, pH buffer, chemical oxygen demand (COD), and ultra violet absorbance. The pH of samples correlated to the logarithm of the concentration on each analysis except Na, NH/sub 4/, ninhydrin-N, and PO. Rainfall samples were divided into five respective pH range as follows: 5.0 or less, 5.0 to 5.5, 5.5 to 6.0, 6.0 to 6.5, and 6.5 or more. Equivalent amount of cation and anion, and cation/anion ratio increased in higher pH range. No significant correlation was found between the pH of the samples and the concentration of N and S oxides, nor between the hydrogen ion concentration precipitated amounts and the NO/sub 2/ and SO/sub 4/ precipitated amounts in pH range of 5.5 or less. The study yeilded the result that the increase of N and S oxides has little effect on the increase of H/sup +/. (8 figs, 6 tabs, 1 ref)

  12. 38-year-old woman with recurrent abdominal pain, but no fever

    OpenAIRE

    Iwata, Kentaro; Toma, Tomoko; Yachie, Akihiro

    2012-01-01

    Kentaro Iwata1, Tomoko Toma2, Akihiro Yachie21Department of Infectious Diseases, Kobe University Hospital, Kobe, Japan; 2Department of Pediatrics, Graduate School of Medical Science and School of Medicine, Kanazawa University, Kanazawa, JapanAbstract: A 38-year-old woman presented with 2 days history of left-flank pain. She had similar episodes of abdominal pain as well as chest pain several times, but symptoms disappeared spontaneously. Each time she developed pain, there was no fever. After...

  13. Echo intensity obtained from ultrasonography images reflecting muscle strength in elderly men

    OpenAIRE

    Watanabe, Yuya; Yamada,Yosuke; Fukumoto,; Yokoyama,Keiichi; Yoshida,Tsukasa; Miyake,; Yamagata,Emi; Kimura,; Ishihara,

    2013-01-01

    Yuya Watanabe,1 Yosuke Yamada,1,2 Yoshihiro Fukumoto,3 Tatsuro Ishihara,4 Keiichi Yokoyama,1 Tsukasa Yoshida,1 Motoko Miyake,1 Emi Yamagata,5 Misaka Kimura1 1Laboratory of Sports and Health Science, Kyoto Prefectural University of Medicine, Kyoto, Japan; 2Research Fellow, Japan Society for the Promotion of Science, Tokyo, Japan; 3Faculty of Rehabilitation, Kobe Gakuin University, Kobe, Japan; 4Faculty of Health and Sports Science, Doshisha University, Kyoto, Japan; 5Laboratory of Gerontologic...

  14. Kinetic modelling and optimisation of antimicrobial compound production by Candida pyralidae KU736785 for control of Candida guilliermondii.

    Science.gov (United States)

    Mewa-Ngongang, Maxwell; du Plessis, Heinrich W; Hutchinson, Ucrecia F; Mekuto, Lukhanyo; Ntwampe, Seteno Ko

    2017-06-01

    Biological antimicrobial compounds from yeast can be used to address the critical need for safer preservatives in food, fruit and beverages. The inhibition of Candida guilliermondii, a common fermented beverage spoilage organism, was achieved using antimicrobial compounds produced by Candida pyralidae KU736785. The antimicrobial production system was modelled and optimised using response surface methodology, with 22.5 ℃ and pH of 5.0 being the optimum conditions. A new concept for quantifying spoilage organism inhibition was developed. The inhibition activity of the antimicrobial compounds was observed to be at a maximum after 17-23 h of fermentation, with C. pyralidae concentration being between 0.40 and 1.25 × 10 9 CFU ml -1 , while its maximum specific growth rate was 0.31-0.54 h -1 . The maximum inhibitory activity was between 0.19 and 1.08 l contaminated solidified media per millilitre of antimicrobial compound used. Furthermore, the antimicrobial compound formation rate was 0.037-0.086 l VZI ml -1 ACU h -1 , respectively. The response surface methodology analysis showed that the model developed sufficiently described the antimicrobial compound formation rate 1.08 l VZI ml -1 ACU, as 1.17 l VZI ml -1 ACU, predicted under the optimum production conditions.

  15. Uticaj povećanja dometa na dinamičku stabilnost artiljerijskih raketa sa olučastim krilima / Influence of range extension on dynamic stability for artillery rockets with wrap around fins

    Directory of Open Access Journals (Sweden)

    Danilo Ćuk

    2007-07-01

    Full Text Available U radu su prikazani efekti povećanja dometa artiljerijske rakete sa olučastim krilima na njenu dinamičku stabilnost. Totalni impuls raketnog motora, uvećan za 50% i let rakete kroz slojeve atmosfere sa malom gustinom vazduha povećavaju domet rakete za više od 75% od nominalnog dometa. Međutim, let rakete kroz razređeni vazduh proizvodi teškoće koje se odnose na dinamičku stabilnost. Male promene bočnog momenta indukovanog napadnim uglom i Magnusovog momenta mogu proizvesti nestabilnost kretanja i nedozvoljeni rast napadnog ugla. Određene su tolerancije bočnog momenta za osnovnu i poboljšanu varijantu rakete radi sprečavanja nestabilnog leta. Analiziran je, takođe uticaj povećanja dometa na verovatna odstupanja rakete po dometu i pravcu. / This paper presents the effects of the range extension of an artillery rocket with wrap around fins on its dynamic stability. The increased total impulse of the rocket engine for 50% and flight through the atmosphere layers with low air density extend the range for more than 75% of the nominal range. However, the flight of the unguided rocket through the rarefied air produces difficulties related to the dynamic stability. The small changes in the side moment which is induced by the angle of attack and Magnus moment of the improved rocket can produce instabilities in flight and increasement the angle of attack. The tolerances of the side moment were determined for both basic and improved type of the rocket in order to prevent instable flight. The influence of the range extension on the probable errors in range and cross-range was analyzed as well.

  16. A family of diverse Kunitz inhibitors from Echinococcus granulosus potentially involved in host-parasite cross-talk.

    Science.gov (United States)

    González, Silvia; Fló, Martín; Margenat, Mariana; Durán, Rosario; González-Sapienza, Gualberto; Graña, Martín; Parkinson, John; Maizels, Rick M; Salinas, Gustavo; Alvarez, Beatriz; Fernández, Cecilia

    2009-09-17

    The cestode Echinococcus granulosus, the agent of hydatidosis/echinococcosis, is remarkably well adapted to its definitive host. However, the molecular mechanisms underlying the successful establishment of larval worms (protoscoleces) in the dog duodenum are unknown. With the aim of identifying molecules participating in the E. granulosus-dog cross-talk, we surveyed the transcriptomes of protoscoleces and protoscoleces treated with pepsin at pH 2. This analysis identified a multigene family of secreted monodomain Kunitz proteins associated mostly with pepsin/H(+)-treated worms, suggesting that they play a role at the onset of infection. We present the relevant molecular features of eight members of the E. granulosus Kunitz family (EgKU-1 - EgKU-8). Although diverse, the family includes three pairs of close paralogs (EgKU-1/EgKU-4; EgKU-3/EgKU-8; EgKU-6/EgKU-7), which would be the products of recent gene duplications. In addition, we describe the purification of EgKU-1 and EgKU-8 from larval worms, and provide data indicating that some members of the family (notably, EgKU-3 and EgKU-8) are secreted by protoscoleces. Detailed kinetic studies with native EgKU-1 and EgKU-8 highlighted their functional diversity. Like most monodomain Kunitz proteins, EgKU-8 behaved as a slow, tight-binding inhibitor of serine proteases, with global inhibition constants (K(I) (*)) versus trypsins in the picomolar range. In sharp contrast, EgKU-1 did not inhibit any of the assayed peptidases. Interestingly, molecular modeling revealed structural elements associated with activity in Kunitz cation-channel blockers. We propose that this family of inhibitors has the potential to act at the E. granulosus-dog interface and interfere with host physiological processes at the initial stages of infection.

  17. Research report on promotion of geothermal energy exploitation for fiscal 1997. Fluid geochemical research (No.B-6 Tsujinodake district); 1997 nendo chinetsu kaihatsu sokushin chosa. Ryutai chikagaku chosa hokokusho (No.B-6 Tsujinodake chiiki)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-07-01

    The research covers the Tsujinodake district spreading over Yamakawa-cho and Ibusuki-shi, Kagoshima Prefecture. Hot spring water in the district is of the neutral Cl type, heated mainly by conduction and containing seawater. The thermal water layer of the highest geothermal potential exists in the vicinity of the Nishi district of Ibusuki-shi. It spreads widely in the westward part and may be linked with the Unagiike district. The temperature of the deep-seated thermal water layer is estimated at 220-230 degrees C, yet it may be higher. In addition to the layer in the vicinity of the Nishi and Unagiike districts, there is a shallow-seated hot spring aquifer in the Nagasakibana district, where the deep-seated thermal water is probably prevented from lifting in the presence of an aquiclude. In the Narikawa district, possibilities are low that the thermal water just beneath will come up. As for hot spring water in the Oyama and Okachogamizu districts, there are no signs of high-temperature thermal water infiltration. In these two districts, it appears that hot spring water is heated by conduction over a large area. For the disclosure of linkage of hot water systems and deep-seated geothermal structures which cannot be detected by geochemical investigations conducted into hot spring water, etc., it is necessary to resort to geological and geophysical researches, and to carry out test drilling. (NEDO)

  18. General practitioners’ attitudes towards and experiences with referrals due to supplemental health insurance

    DEFF Research Database (Denmark)

    Andersen, Merethe K; Pedersen, Line B; Dupont, Michael

    2017-01-01

    Background.: Supplemental health insurances (SHI) cover 38% of the Danish population. SHI can give faster access to, and additional treatment from, private health providers. However, this is contingent on a referral from the general practitioner (GP), further complicating clinical decision...... to 3321 GPs focusing on three issues: (i) Attitudes towards the public health care system. (ii) Perceptions of the impact of SHI. (iii) Experiences with patients holding SHIs. Results.: The response rate was 64%. Overall, GPs found that SHIs contribute to inequality (83%) and overtreatment (90%). However...... a majority of GPs associate SHI with overtreatment and inequality in health, many GPs feel under pressure to refer patients holding SHI for treatments or examinations that are not medically warranted. Some GPs even refer these patients without further examination or questioning. Insistent SHI patients may...

  19. Rainfall measurement from the opportunistic use of an Earth–space link in the Ku band

    Directory of Open Access Journals (Sweden)

    L. Barthès

    2013-08-01

    Full Text Available The present study deals with the development of a low-cost microwave device devoted to the measurement of average rain rates observed along Earth–satellite links, the latter being characterized by a tropospheric path length of a few kilometres. The ground-based power measurements, which are made using the Ku-band television transmissions from several different geostationary satellites, are based on the principle that the atmospheric attenuation produced by rain encountered along each transmission path can be used to determine the path-averaged rain rate. This kind of device could be very useful in hilly areas where radar data are not available or in urban areas where such devices could be directly placed in homes by using residential TV antenna. The major difficulty encountered with this technique is that of retrieving rainfall characteristics in the presence of many other causes of received signal fluctuation, produced by atmospheric scintillation, variations in atmospheric composition (water vapour concentration, cloud water content or satellite transmission parameters (variations in emitted power, satellite pointing. In order to conduct a feasibility study with such a device, a measurement campaign was carried out over a period of five months close to Paris. The present paper proposes an algorithm based on an artificial neural network, used to identify dry and rainy periods and to model received signal variability resulting from effects not related to rain. When the altitude of the rain layer is taken into account, the rain attenuation can be inverted to obtain the path-averaged rain rate. The rainfall rates obtained from this process are compared with co-located rain gauges and radar measurements taken throughout the full duration of the campaign, and the most significant rainfall events are analysed.

  20. Rainfall measurement from the opportunistic use of an Earth-space link in the Ku band

    Science.gov (United States)

    Barthès, L.; Mallet, C.

    2013-08-01

    The present study deals with the development of a low-cost microwave device devoted to the measurement of average rain rates observed along Earth-satellite links, the latter being characterized by a tropospheric path length of a few kilometres. The ground-based power measurements, which are made using the Ku-band television transmissions from several different geostationary satellites, are based on the principle that the atmospheric attenuation produced by rain encountered along each transmission path can be used to determine the path-averaged rain rate. This kind of device could be very useful in hilly areas where radar data are not available or in urban areas where such devices could be directly placed in homes by using residential TV antenna. The major difficulty encountered with this technique is that of retrieving rainfall characteristics in the presence of many other causes of received signal fluctuation, produced by atmospheric scintillation, variations in atmospheric composition (water vapour concentration, cloud water content) or satellite transmission parameters (variations in emitted power, satellite pointing). In order to conduct a feasibility study with such a device, a measurement campaign was carried out over a period of five months close to Paris. The present paper proposes an algorithm based on an artificial neural network, used to identify dry and rainy periods and to model received signal variability resulting from effects not related to rain. When the altitude of the rain layer is taken into account, the rain attenuation can be inverted to obtain the path-averaged rain rate. The rainfall rates obtained from this process are compared with co-located rain gauges and radar measurements taken throughout the full duration of the campaign, and the most significant rainfall events are analysed.

  1. Estimating Snow Water Equivalent with Backscattering at X and Ku Band Based on Absorption Loss

    Directory of Open Access Journals (Sweden)

    Yurong Cui

    2016-06-01

    Full Text Available Snow water equivalent (SWE is a key parameter in the Earth’s energy budget and water cycle. It has been demonstrated that SWE can be retrieved using active microwave remote sensing from space. This necessitates the development of forward models that are capable of simulating the interactions of microwaves and the snow medium. Several proposed models have described snow as a collection of sphere- or ellipsoid-shaped ice particles embedded in air, while the microstructure of snow is, in reality, more complex. Natural snow usually forms a sintered structure following mechanical and thermal metamorphism processes. In this research, the bi-continuous vector radiative transfer (bi-continuous-VRT model, which firstly constructs snow microstructure more similar to real snow and then simulates the snow backscattering signal, is used as the forward model for SWE estimation. Based on this forward model, a parameterization scheme of snow volume backscattering is proposed. A relationship between snow optical thickness and single scattering albedo at X and Ku bands is established by analyzing the database generated from the bi-continuous-VRT model. A cost function with constraints is used to solve effective albedo and optical thickness, while the absorption part of optical thickness is obtained from these two parameters. SWE is estimated after a correction for physical temperature. The estimated SWE is correlated with the measured SWE with an acceptable accuracy. Validation against two-year measurements, using the SnowScat instrument from the Nordic Snow Radar Experiment (NoSREx, shows that the estimated SWE using the presented algorithm has a root mean square error (RMSE of 16.59 mm for the winter of 2009–2010 and 19.70 mm for the winter of 2010–2011.

  2. 'Modernization property' of our country is visualized / TAISEI; Wagakuni no 'kindaika isan' wo eizoka / taiseisensetsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-10

    TAISEI was about rapidly promoted from Days of the Tokugawa shogunate over Meiji and Taisho this, and the documentary film which focused on building and 'the modernization property' which are related to industry and traffic and civil engineering which made the base of the our country development was planned and was produced. The title of the movie is 'travel to the Japan modernization property'. The movie which really introduced such modern age property is rare, and it s as an image material precious. It tries to pick up main thing, The oldest lighthouse 'Mikomotojima Island lighthouse (Shizuoka Prefect.1870)' and covers Shiga Prefecture and Kyoto prefecture,'The Lake Biwa hydrophobic', in our country, the first gravitational concrete dam 'Nunobiki Gohnmatsu dam, Kobe City, 1900'Length furnace for the cement baking which remains in Yamaguchi Prefect. 'The ONODA CEMENT (Pacific Ocean cement) sake bottle furnace'. In becoming modernization property which widely remains in our country and so on the guide person, Mr. Shinbo Minami of the illustrator has introduced it. The narration is the Mr. platform step of the actress. Still, screening party of this movie is done in the following schedule (admission free). The detailed query is Japanese movie new Co. (141-0021 2-10-17 Kami-Osaki, Shinagawa ku, Tokyo), TEL 03-3442-7251 FAX 03-3442-7360. (translated by NEDO)

  3. The determinants of long-term care utilization and equity of access to care among older adults in Dong-Ku of Incheon Metropolitan city, South Korea.

    Science.gov (United States)

    Park, J M

    2005-01-01

    Under the current health care system, around three percent of the elderly remain uninsured. Based on the 2003 Dong-Ku Health Status Survey and the Aday and Andersen Access Framework, the present study examined the social and behavioral determinants of long-term care utilization and the extent to which equity in the use of long-term care services for the elderly has been achieved. The results indicate that universal health insurance system has not yielded a fully equitable distribution of services. Type of coverage and resource availability do not remain predictors of long-term care utilization. The data suggest that a universal health insurance system exists in South Korea with significant access problems for the population without insurance. Access differences also arise from obstacles in expanding the scope and level of plan benefits due to financial disparity among insurers. Health policy reforms must continue to concentrate on extending insurance coverage to the uninsured and establishing long-term insurance system for the elderly.

  4. Effects of Snow/ Soil Interface on Microwave Backscatter of Terrestrial Snowpack at X- and Ku- Band

    Science.gov (United States)

    Kang, D. H.; Tan, S.; Zhu, J.; Gu, W.; Tsang, L.; Kim, E. J.

    2017-12-01

    Recent advances in monitoring and modeling capabilities to support remote sensing of terrestrial snow is encouraging to develop satellite mission concept in monitoring cold-region hydrological processes on global scales. However, it is still challenging to link back the active microwave backscattering signals to physical snowpack parameters. One of the limitations resides in the ignorance of the vegetation and soil conditions beneath the snowpack in the microwave scattering/ emission modeling and the snow water equivalent (SWE) retrieval algorithm. During the SnowEx 2017 winter campaign in Grand Mesa, CO, a particular effort has been made on comprehensive measurements of the underlying vegetation and soil characteristics from the snowpit measurements. Besides conducting standard snow core sampling, we have made additional protocols to record the background information beneath the snowpack. Recent works on active SWE retrieval algorithm using backscatters at X- (9.6 GHz) and Ku- (17.2 GHz) band suggest the significant signals from the background scattering characterization. The background scattering arising from the rough snow/ soil interface and the buried vegetation inside and beneath the snowpack modifies the sensitivity of the total backscatter to SWE. In this paper, we summarize the snow/ soil interface conditions as observed in the SnowEx campaign. We also develop standards for future in-situ snowpit measurements to include regular snow/ soil interface observations to accommodate the interpretation of microwave backscatter both for modeling and observation of microwave signatures. These observations first provide inputs to the microwave scattering models to predict the backscattering contribution from background, which is one of the key factors to be included to improve the SWE retrieval performance.

  5. X ve Y Kuşağı: Hemşirelerin Meslek Dayanışması İle İş Doyumu Arasındaki İlişki

    OpenAIRE

    KARASU, Fatma; AYLAZ, Rukuye

    2017-01-01

    Amaç:Bu araştırma, X ve Y kuşağındaki hemşirelerin meslek dayanışması ile iş doyumuarasındaki ilişkisini belirlemek amacıyla yapılmıştır. Gereç ve Yöntem: Kesitsel nitelikteki araştırmanın evrenini devlethastanesinde çalışan hemşireler oluşturmuş, örneklem seçimine gidilmeyerekevrenin tamamı örnekleme dahil edilmiş ve 01.02.2017-01.03.2017 tarihleriarasında çalışmayı kabul eden toplamda 145 hemşireye ulaşılmıştır. Veri toplamaformunda, hemşirelerin sosyo-demografik özellikleri, Hemşirelerde M...

  6. High-performance 16-way Ku-band radial power combiner based on the TE01-circular waveguide mode

    Science.gov (United States)

    Montejo-Garai, José R.; Saracho-Pantoja, Irene O.; Ruiz-Cruz, Jorge A.; Rebollar, Jesús M.

    2018-03-01

    This work presents a 16-way Ku-band radial power combiner for high power and high frequency applications, using the very low loss TE01 circular waveguide mode. The accomplished design shows an excellent performance: the experimental prototype has a return loss better than 30 dB, with a balance for the amplitudes of (±0.15 dB) and (±2.5°) for the phases, in a 16.7% fractional bandwidth (2 GHz centered at 12 GHz). For obtaining these outstanding specifications, required, for instance, in high-frequency amplification or on plasma systems, a rigorous step-by-step procedure is presented. First, a high-purity mode transducer has been designed, from the TE10 mode in the rectangular waveguide to the TE01 mode in the circular waveguide, with very high attenuation (>50 dB) for the other propagating and evanescent modes in the circular waveguide. This transducer has been manufactured and measured in a back-to-back configuration, validating the design process. Second, an E-plane 16-way radial power divider has been designed, where the power is coupled from the 16 non-reduced-height radial standard waveguides into the TE01 circular waveguide mode, improving the insertion loss response and removing the usual tapered transformers of previous designs limiting the power handling. Finally, both the transducer and the divider have been assembled to make the final radial combiner. The prototype has been carefully manufactured, showing very good agreement between the measurements and the full-wave simulations.

  7. Differentiating social phobia from shyness.

    Science.gov (United States)

    Heiser, Nancy A; Turner, Samuel M; Beidel, Deborah C; Roberson-Nay, Roxann

    2009-05-01

    To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group reported similar levels of anxiety as the shy without social phobia during analogue conversation tasks, but they reported more anxiety during a speech task. The social phobia group performed less effectively across tasks than those without social phobia. All groups' perceptions of anxiety and effectiveness during behavioral tasks were consistent with ratings of independent observers. None of the groups differed on psychophysiological measures. Results are discussed in the context of theoretical models of social phobia.

  8. [The significance of a large number of health insurance funds and fusions for health services research with statutory health insurance data in Germany - experiences of the lidA study].

    Science.gov (United States)

    March, S; Powietzka, J; Stallmann, C; Swart, E

    2015-02-01

    Since 1970 the health insurance system in Germany has shrunk by more than 90% to 132 statutory health insurance funds (SHI) at present. For studies using data from different SHI, this development means a reduction of contacts and a higher workload when requesting data. The latter is due to the fact that fusions bind resources in the health insurance funds. In order to avoid selection in studies among the insured, all SHI must be contacted. Additionally, 15 controlling institutions on the state and national level have to agree as determined in § 75 of the German Social Code number 10. The lidA study - a German cohort study on work, age and health intends to link primary and secondary data from all SHI of those insured who have given their agreement for participation. Since the beginning of the study in 2009 the number of SHI has been reduced by 70. Of the 6 585 interviews in 2011 approximately half of the interviewees agreed in written form that their individual health insurance data can be linked. This portion of the insured is dispersed among 95 SHI. At this point, 11 contracts with SHI are realised (approximately 50% of the insured) and 8 data controlling authorities have been contacted. The problems involved in the fusion of SHI and its meaning for research are explained in this article. The fusion of SHI makes sense for the long term. It will lead to a reduction of contacts and contracts that researchers have to establish in order to analyse the data. Therefore, this article also discusses the alternative of creating a meta-data set of all the data from the different SHI combined. © Georg Thieme Verlag KG Stuttgart · New York.

  9. Seismic response time history analyses for KALIMER building with a horizontal and vertical seismic isolation

    International Nuclear Information System (INIS)

    Lee, J. H.; Yoo, B.; Koo, K. H.

    2001-01-01

    The seismic response time history analyses for the lumped mass models of KALIMER reactor building with a horizontal and vertical seismic isolation are performed for Artificial Time History and Kobe earthquake. The vertical amplification by the horizontal isolation is reduced by a vertical isolation for both earthquakes. The 3% viscous damping and the vertical isolation frequency of 1.5Hz gives a reduced vertical response compared to the fixed base condition at reactor support, and the 9% viscous damping to Kobe earthquake is required to get an equivalent vertical response with a fixed base condition

  10. 神戸女学院音楽部レッスン帳(1907-1923)の資料的価値とその内実

    OpenAIRE

    津上, 智実

    2010-01-01

    This paper reports on a document newly found in the Music Library of Kobe College. It is the 'Music Lesson Record of the Music School, Kobe College for 1907 to 1923', which contains precise records of the music lessons in each school term, given to eighty-eight students in total, from shortly after the establishment of the Music School in 1906. Each page of this book is divided into five columns: 1) the instrument or the subject in which the lesson was given: organ, piano,singing, theory and...

  11. Seismic response time history analyses for KALIMER building with a horizontal and vertical seismic isolation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, J. H.; Yoo, B.; Koo, K. H. [KAERI, Taejon (Korea, Republic of)

    2001-05-01

    The seismic response time history analyses for the lumped mass models of KALIMER reactor building with a horizontal and vertical seismic isolation are performed for Artificial Time History and Kobe earthquake. The vertical amplification by the horizontal isolation is reduced by a vertical isolation for both earthquakes. The 3% viscous damping and the vertical isolation frequency of 1.5Hz gives a reduced vertical response compared to the fixed base condition at reactor support, and the 9% viscous damping to Kobe earthquake is required to get an equivalent vertical response with a fixed base condition.

  12. Nuclear energy: what to do with it

    International Nuclear Information System (INIS)

    Laramee, V.

    1996-01-01

    In this article are detailed all the uses of radioactivity in human activities: nuclear medicine with diagnostic uses and therapeutic uses, irradiation of foods to preserve or sterilize them, determination of soldering quality, preservation of cultural objects by sterilization and age determination by carbon 14 use, the last possibility is actually the prevention of earthquakes since the japanese have discovered that before the Kobe earthquake, the radon rate had increased in water of Kobe, a survey of this radioactive gas should contribute to anticipate earth tremors. (N.C.)

  13. Stone heterogeneity index as the standard deviation of Hounsfield units: A novel predictor for shock-wave lithotripsy outcomes in ureter calculi.

    Science.gov (United States)

    Lee, Joo Yong; Kim, Jae Heon; Kang, Dong Hyuk; Chung, Doo Yong; Lee, Dae Hun; Do Jung, Hae; Kwon, Jong Kyou; Cho, Kang Su

    2016-04-01

    We investigated whether stone heterogeneity index (SHI), which a proxy of such variations, was defined as the standard deviation of a Hounsfield unit (HU) on non-contrast computed tomography (NCCT), can be a novel predictor for shock-wave lithotripsy (SWL) outcomes in patients with ureteral stones. Medical records were obtained from the consecutive database of 1,519 patients who underwent the first session of SWL for urinary stones between 2005 and 2013. Ultimately, 604 patients with radiopaque ureteral stones were eligible for this study. Stone related variables including stone size, mean stone density (MSD), skin-to-stone distance, and SHI were obtained on NCCT. Patients were classified into the low and high SHI groups using mean SHI and compared. One-session success rate in the high SHI group was better than in the low SHI group (74.3% vs. 63.9%, P = 0.008). Multivariate logistic regression analyses revealed that smaller stone size (OR 0.889, 95% CI: 0.841-0.937, P < 0.001), lower MSD (OR 0.995, 95% CI: 0.994-0.996, P < 0.001), and higher SHI (OR 1.011, 95% CI: 1.008-1.014, P < 0.001) were independent predictors of one-session success. The radiologic heterogeneity of urinary stones or SHI was an independent predictor for SWL success in patients with ureteral calculi and a useful clinical parameter for stone fragility.

  14. Topical steroid addiction in atopic dermatitis

    OpenAIRE

    Fukaya, Mototsugu; Sato, Kenji; Sato, Mitsuko; Kimata, Hajime; Fujisawa, Shigeki; Dozono, Haruhiko; Yoshizawa, Jun; Minaguchi, Satoko

    2014-01-01

    Mototsugu Fukaya,1 Kenji Sato,2 Mitsuko Sato,3 Hajime Kimata,4 Shigeki Fujisawa,5 Haruhiko Dozono,6 Jun Yoshizawa,7 Satoko Minaguchi8 1Tsurumai Kouen Clinic, Nagoya, 2Department of Dermatology, Hannan Chuo Hospital, Osaka, 3Sato Pediatric Clinic, Osaka, 4Kimata Hajime Clinic, Osaka, 5Fujisawa Dermatology Clinic, Tokyo, 6Dozono Medical House, Kagoshima, 7Yoshizawa Dermatology Clinic, Yokohama, 8Department of Dermatology, Kounosu Kyousei Hospital, Saitama, Japan Abstract: The American Academy ...

  15. Gaistošo organisko savienojumu emisijas no kuņģa vēža audiem un to potenciālā bioloģiskā saistība

    OpenAIRE

    Aronsson, Dan Erik

    2018-01-01

    Gaistošā organiskā savienojuma (VOC) emisija, ko var novērot izelpā, ir strauji augoša diagnostikas metode audzēju izmeklēšanā. VOC ir savienojums, kam istabas temperatūrā ir augsts tvaika spiediens, kas veicina tā iztvaikošanu gāzes formā. Šo gāzi var noteikt cilvēka audos un šķidrumos.( Haick et al 2014) Galvenokārt ir pētīta VOC saistība ar plaušu vēzi. Taču aizvien vairāk tiek veikti pētījumi, lai noteiktu, kādas ir iespējas VOC pielietot arī kuņģa audzēja gadījumā. Tā kā VOC molekula sp...

  16. A Ku band pulsed electron paramagnetic resonance spectrometer using an arbitrary waveform generator for quantum control experiments at millikelvin temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Yap, Yung Szen, E-mail: yungszen@utm.my [Graduate School of Engineering Science, Osaka University, 1-3 Machikaneyama-cho, Toyonaka-shi, Osaka 560-8531 (Japan); Faculty of Science, Universiti Teknologi Malaysia, 81310 UTM Johor Bahru, Johor (Malaysia); Tabuchi, Yutaka [Research Center for Advanced Science and Technology (RCAST), The University of Tokyo, Meguro-ku, Tokyo 153-8904 (Japan); Negoro, Makoto; Kagawa, Akinori; Kitagawa, Masahiro, E-mail: kitagawa@ee.es.osaka-u.ac.jp [Graduate School of Engineering Science, Osaka University, 1-3 Machikaneyama-cho, Toyonaka-shi, Osaka 560-8531 (Japan)

    2015-06-15

    We present a 17 GHz (Ku band) arbitrary waveform pulsed electron paramagnetic resonance spectrometer for experiments down to millikelvin temperatures. The spectrometer is located at room temperature, while the resonator is placed either in a room temperature magnet or inside a cryogen-free dilution refrigerator; the operating temperature range of the dilution unit is from ca. 10 mK to 8 K. This combination provides the opportunity to perform quantum control experiments on electron spins in the pure-state regime. At 0.6 T, spin echo experiments were carried out using γ-irradiated quartz glass from 1 K to 12.3 mK. With decreasing temperatures, we observed an increase in spin echo signal intensities due to increasing spin polarizations, in accordance with theoretical predictions. Through experimental data fitting, thermal spin polarization at 100 mK was estimated to be at least 99%, which was almost pure state. Next, to demonstrate the ability to create arbitrary waveform pulses, we generate a shaped pulse by superposing three Gaussian pulses of different frequencies. The resulting pulse was able to selectively and coherently excite three different spin packets simultaneously—a useful ability for analyzing multi-spin system and for controlling a multi-qubit quantum computer. By applying this pulse to the inhomogeneously broadened sample, we obtain three well-resolved excitations at 8 K, 1 K, and 14 mK.

  17. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    OpenAIRE

    Ascaribay Andrade, Saúl Geovani

    2013-01-01

    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  18. Problemas de los grupos *k(hi̭, *kṷ(hi̭, *t(hi̭ y *tṷ en griego

    Directory of Open Access Journals (Sweden)

    M.ª Luisa del Barrio Vega

    1990-12-01

    Full Text Available In this research the author studies a series of problems related to the evolution of the groups *k(hi̭, *kṷ(hi̭, *t(hi̭ and *tṷ in Greek. After a brief description of the palatalization process undergone by these groups and considering the different results from *t(hi̭ in the Ionic-Attic and Arcadian-Cypriot dialects which were swept twice by a wave of palatalization as well as the possible influence by analogy of the development undergone by *k(hi̭, the author examines in great depth the state of these groups at the time of the Mycenaean tablets analyzing the different values proposed for the series z- and s-. For z- an occlusive palatal and for s- an affricate articulation are considered the most likely ones. The author further suggests that the s- series followed an evolution parallel to that of the complex syllabograms of the type raz, roz, etc. Subsequently the author analyzes the graphic issues related to the evolution of the phonemic groups under study: The use of a special graphical notation in some Ionic and Pamphylian σσ/ττ in the dialects during the first millennium are due to the influence derived from the graphic representation of the state *ts. Finally the author suggests the Boeotian dialect as a starting point for the change *ts > tt, as in this dialect tt has a corresponding voiced series dd.

  19. Functional simian immunodeficiency virus Gag-specific CD8+ intraepithelial lymphocytes in the mucosae of SIVmac251- or simian-human immunodeficiency virus KU2-infected macaques

    International Nuclear Information System (INIS)

    Stevceva, Liljana; Moniuszko, Marcin; Alvarez, Xavier; Lackner, Andrew A.; Franchini, Genoveffa

    2004-01-01

    The vaginal and rectal mucosae are the first line of cellular immune defense to sexually transmitted human immunodeficiency virus type 1 (HIV-1) entry. Thus, intraepithelial lymphocytes (IELs) may be important in the immune response to HIV infection. Here we investigated whether functional IELs in mucosal compartments could be visualized by direct staining with a tetrameric complex specific for the simian immunodeficiency virus (SIV) immunodominant Gag epitope in either separated IEL cells or tissues of macaques infected with SIVmac251. Of the 15 Mamu-A*01-positive macaques studied here, eight were chronically infected with either SIVmac251 or simian-human immunodeficiency virus (SHIV) KU2 and the remaining seven were exposed mucosally to SIVmac251 and sacrificed within 48 h to assess the local immune response. Gag-specific CD8+ T-cells were found in separated IELs from the rectum, colon, jejunum, and vagina of most infected animals. Direct staining of tetramers also revealed their presence in intact tissue. These Gag-specific IELs expressed the activation marker CD69 and produced IFN-γ, suggesting an active immune response in this locale

  20. 75 FR 60761 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-10-01

    ... related to drug resistance. Inventors: Genbin Shi, Gary Shaw, Xinhua Ji (NCI). Patent Status: U.S... Publications: 1. Blaszczyk J, Shi G, Li Y, Yan H, Ji X. Reaction trajectory of pyrophosphoryl transfer...: 15016362]. 2. Blaszczyk J, Shi G, Yan H, Ji X. Catalytic center assembly of HPPK as revealed by the crystal...

  1. The Effect of the Unique Features of Y Generation on Organizational Commitment / Y Kuşağının Belirleyici Özelliklerinin Örgütsel Bağlılık Üzerindeki Etkisi

    Directory of Open Access Journals (Sweden)

    Mustafa Emre Civelek

    2017-12-01

    Full Text Available ABSTRACT In this research, the determinants of the generations and unique characteristics of Generation Y are examined and the effect of this unique characteristics on organizational commitment is investigated. In the introduction part of the research, different features separating the generations from each other were mentioned and the studies done in this subject were examined and the studies and findings of different researchers were evaluated. In the final part of the survey, there is the analysis result of the survey collected from overall Turkey from 8 corporations. Sample size of this research is 267.  In order to measure organizational commitment, the scale developed by Allen and Meyer was used (Allen & Meyer, 1993. In order to measure team working, the scale developed by Levi and Slem was used (Levi & Slem, 1995. In order to measure playful spirit at work, the scale developed by Berg was used (Berg, 2011. According to the test results, there is a positive and significant relationship between Workplace fun and Team Working and between Team Working and Organizational Commitment. Contrary to expectation, there is not directly relation between organizational commitment and workplace fun. But work place fun positively effects organizational commitment through team working indirectly. The results of this research are to confirm that employees will be more likely to work in teams if organization environments are established to make them happy and entertained, thereby increasing their organizational commitment. ÖZ Bu araştırmada Kuşakların belirleyici özellikleri incelenerek Y kuşağını diğer kuşaklardan ayıran özelliklerin neler olduğu ve bu özelliklerin örgütsel bağlılık üzerinde ne gibi bir etkisi olduğu araştırılmaktadır. Araştırmanın giriş kısmında kuşakları birbirinden ayrıştıran farklı özelliklere değinilmiş ve bu konuda yapılan çalışmalar incelenerek farklı araştırmacıların

  2. Trends spanning 36 years of nursing research

    OpenAIRE

    LEE Hyeyong; SHIMOTAKAHARA Rie; FUKADA Akimi; SHINBASHI Sumiko

    2018-01-01

    PURPOSE: The aim of demonstrating priorities for future research, this study draws on the strengths of text-mining analysis to analyze trends in nursing research in Japan over a 36-year period. METHODS: Documents published in the online version of the Igaku Chuo Zasshi (ICHUSHI) between 1980 and December 2015 were targeted for analysis. Tendencies and trends over time characterizing words used in the titles of all target research papers were analyzed, along with characteristic words. RESULTS:...

  3. Smart home in a box: usability study for a large scale self-installation of smart home technologies.

    Science.gov (United States)

    Hu, Yang; Tilke, Dominique; Adams, Taylor; Crandall, Aaron S; Cook, Diane J; Schmitter-Edgecombe, Maureen

    2016-07-01

    This study evaluates the ability of users to self-install a smart home in a box (SHiB) intended for use by a senior population. SHiB is a ubiquitous system, developed by the Washington State University Center for Advanced Studies in Adaptive Systems (CASAS). Participants involved in this study are from the greater Palouse region of Washington State, and there are 13 participants in the study with an average age of 69.23. The SHiB package, which included several different types of components to collect and transmit sensor data, was given to participants to self-install. After installation of the SHiB, the participants were visited by researchers for a check of the installation. The researchers evaluated how well the sensors were installed and asked the resident questions about the installation process to help improve the SHiB design. The results indicate strengths and weaknesses of the SHiB design. Indoor motion tracking sensors are installed with high success rate, low installation success rate was found for door sensors and setting up the Internet server.

  4. The maximum allowable temperature of zircaloy-2 fuel cladding under dry storage conditions

    International Nuclear Information System (INIS)

    Mayuzumi, M.; Yoshiki, S.; Yasuda, T.; Nakatsuka, M.

    1990-09-01

    Japan plans to reprocess and reutilise the spent nuclear fuel from nuclear power generation. However, the temporary storage of spent fuel is assuming increasing importance as a means of ensuring flexibility in the nuclear fuel cycle. Our investigations of various methods of storage have shown that casks are the most suitable means of storing small quantities of spent fuel of around 500 t, and research and development are in progress to establish dry storage technology for such casks. The soundness of fuel cladding is being investigated. The most important factor in evaluating soundness in storage under inert gas as currently envisaged is creep deformation and rupture, and a number of investigations have been made of the creep behaviour of cladding. The present study was conducted on the basis of existing in-house results in collaboration with Nippon Kakunenryo Kaihatsu KK (Nippon Nuclear Fuel Department Co.), which has hot lab facilities. Tests were run on the creep deformation behaviour of irradiated cladding, and the maximum allowable temperature during dry storage was investigated. (author)

  5. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Science.gov (United States)

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun

    2005-10-01

    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  6. SERANGAN BENALU PADA BEBERAPA KELAS UMUR TANAMAN JATI DI WILAYAH HUTAN BKPH BEGAL, KPH NGAWI, JAWA TIMUR (An Attact of Parasitic Plant on Several Ages of Teak Plantation In Begal Forest Sub-District, Ngawi Forest District, East Java

    Directory of Open Access Journals (Sweden)

    Soewarno Hasanbahri

    2014-10-01

    The objectives of the study were to determine the relationship of teak plantation age class with the frequency and severity of teak trees due to an attack of parasitic plant (mistletoe, and parasitic plant distribution patterns horizontally. The sampling method in this study was the Multistage Sampling, i.e. at each age group classe (KU represented one compartment and each compartment made an individual sampling tree as much as 10 % for KU V and up (old age classes, 5 % for KU III – IV (middle age classes and 1 % for KU I - II (young age classes to the total trees populations. Age class relationship with the frequency and degree of tree damage due to an attack of parasitic plant were analyzed by correlation test formula and for the parasitic plant distribution were analysed by the Poisson distribution formula and the Binomial Test Statistically Reversed. The conclusions of this study that were found two species of parasitic plants of Dendrophthoe pentandra and Scurula parasitiaca of the Loranthaceae family members, sub-family Viscoidae. The frequency of teak trees that were attacted by parasitic plants ranged from 12.88 % for KU II and  followed by 15.55 % for KU I, 15.72 % for KU V, 18.06 % for KU IV and VI, up  to 19.73 % for KU III. The correlation between an attack of parasitic plants and the teak forest age classes have proven that significant relationship to the level of the proximal health. In another part, proved that age class does not have a significant relationship to the distal extent of damage. Nevertheless , the teak tree damage suffered an attack of parasitic plants were more prevalent on trees in the younger age classes. It was shown by a comparison of proximal and distal branches in each age class, namely: -23.81 cm for KU I, -1.56 cm for KU II, 14.66 cm for KU III, 24.13 cm for KU IV, 22.40 cm for KU V and 54.94 cm for KU VI. With the loss of future growth faced by teak trees in the young age classes become very vulnerable in the presence of

  7. Simulation study for ground-based Ku-band microwave observations of ozone and hydroxyl in the polar middle atmosphere

    Science.gov (United States)

    Newnham, David; Clilverd, Mark; Kosch, Michael; Verronen, Pekka

    2017-04-01

    Commercial satellite TV broadcasting is possible due to remarkable advances in microwave electronics, enabling weak signals transmitted over 36,000 km from geostationary orbit to be received by inexpensive rooftop dishes. The Ku band satellite frequencies (10.70-14.25 GHz) overlap microwave emissions from ozone (O3) at 11.072 GHz and hydroxyl radical (OH) at 13.44 GHz. These important chemical species in the polar middle atmosphere respond strongly to solar variability and, at high latitudes, geomagnetic activity associated with space weather. Atmospheric model calculations predict that energetic electron precipitation (EEP) driven by magnetospheric substorms produces large changes in polar mesospheric O3 and OH. The EEP typically peaks at geomagnetic latitudes ˜65˚ (e.g. Kilpisjärvi, Finland and Syowa station, Antarctica) and evolves rapidly with time eastwards and over the geomagnetic latitude range 60˚ -80˚ (e.g. reaching Halley, Antarctica). During the substorms OH can increase by more than 1000% at 64-84 km. The substorms leave footprints of 5-55% O3 loss lasting many hours of local time, with strong altitude and seasonal dependences. An atmospheric simulation and retrieval study is performed to determine the specification and design requirements for microwave radiometers capable of measuring O3 and OH profiles from Arctic and Antarctic locations using accessible satellite TV receiver technology. The proposed observations are highly applicable to studies of EEP, atmospheric dynamics, planetaryscale circulation, chemical transport, and the representation of these processes in polar and global climate models. They would provide a lowcost, reliable alternative to increasingly sparse satellite measurements, extending long-term data records and also providing "ground truth" calibration data.

  8. Agrobacterium tumefaciens T-DNA Integration and Gene Targeting in Arabidopsis thaliana Non-Homologous End-Joining Mutants

    Directory of Open Access Journals (Sweden)

    Qi Jia

    2012-01-01

    Full Text Available In order to study the role of AtKu70 and AtKu80 in Agrobacterium-mediated transformation and gene targeting, plant lines with a T-DNA insertion in AtKu80 or AtKu70 genes were functionally characterized. Such plant lines lacked both subunits, indicating that heterodimer formation between AtKu70 and AtKu80 is needed for the stability of the proteins. Homozygous mutants were phenotypically indistinguishable from wild-type plants and were fertile. However, they were hypersensitive to the genotoxic agent bleomycin, resulting in more DSBs as quantified in comet assays. They had lower end-joining efficiency, suggesting that NHEJ is a critical pathway for DSB repair in plants. Both Atku mutants and a previously isolated Atmre11 mutant were impaired in Agrobacterium T-DNA integration via floral dip transformation, indicating that AtKu70, AtKu80, and AtMre11 play an important role in T-DNA integration in Arabidopsis. The frequency of gene targeting was not significantly increased in the Atku80 and Atku70 mutants, but it was increased at least 10-fold in the Atmre11 mutant compared with the wild type.

  9. Comparison of the effect between pegaptanib and ranibizumab on exudative age-related macular degeneration with small lesion size

    Directory of Open Access Journals (Sweden)

    Fujihara M

    2012-03-01

    Full Text Available Yoshihiro Nishimura1,2, Maiko Taguchi1, Takafumi Nagai1, Masashi Fujihara1,2, Shigeru Honda2, Mamoru Uenishi11Department of Ophthalmology, Mitsubishi Kobe Hospital, Kobe, Japan; 2Department of Surgery, Division of Ophthalmology, Kobe University Graduate School of Medicine, Kobe, JapanPurpose: To compare the effect of pegaptanib versus ranibizumab on exudative age-related macular degeneration (AMD with small lesion size.Methods: This is a retrospective study of 81 eyes from 78 patients with exudative AMD treated and followed up over 12 months. Patients with baseline best corrected visual acuity (BCVA under 20/400 and with a greatest linear dimension of lesion over 4500 µm were excluded from the study. Twenty-six eyes from 25 patients were treated with three consecutive intravitreal injections of pegaptanib (IVP group and 55 eyes from 54 patients were treated with three consecutive ranibizumab injections (IVR group. Each therapy was repeated as needed. The alteration in BCVA was evaluated in the IVP and IVR groups.Results: No differences were detected in baseline parameters between the IVP and IVR groups. The mean BCVA (logMAR at month 1, 3, 6 and 12 after the initial treatment was improved from baseline in the IVP group (-0.095, -0.17, -0.18 and -0.18, respectively and in the IVR group (-0.077, -0.15, -0.17 and -0.11, respectively, which was statistically significant. There was no difference in the change in mean BCVA between IVP and IVR groups at the same time periods.Conclusions: The visual outcome of IVP was equivalent with IVR in exudative AMD with small lesion size.Keywords: pegaptanib, ranibizumab, age-related macular degeneration, small lesion size

  10. [Use of routine data from statutory health insurances for federal health monitoring purposes].

    Science.gov (United States)

    Ohlmeier, C; Frick, J; Prütz, F; Lampert, T; Ziese, T; Mikolajczyk, R; Garbe, E

    2014-04-01

    Federal health monitoring deals with the state of health and the health-related behavior of populations and is used to inform politics. To date, the routine data from statutory health insurances (SHI) have rarely been used for federal health monitoring purposes. SHI routine data enable analyses of disease frequency, risk factors, the course of the disease, the utilization of medical services, and mortality rates. The advantages offered by SHI routine data regarding federal health monitoring are the intersectoral perspective and the nearly complete absence of recall and selection bias in the respective population. Further, the large sample sizes and the continuous collection of the data allow reliable descriptions of the state of health of the insurants, even in cases of multiple stratification. These advantages have to be weighed against disadvantages linked to the claims nature of the data and the high administrative hurdles when requesting the use of SHI routine data. Particularly in view of the improved availability of data from all SHI insurants for research institutions in the context of the "health-care structure law", SHI routine data are an interesting data source for federal health monitoring purposes.

  11. Multi-Satellite MIMO Communications at Ku-Band and Above: Investigations on Spatial Multiplexing for Capacity Improvement and Selection Diversity for Interference Mitigation

    Directory of Open Access Journals (Sweden)

    Liolis Konstantinos P

    2007-01-01

    Full Text Available This paper investigates the applicability of multiple-input multiple-output (MIMO technology to satellite communications at the Ku-band and above. After introducing the possible diversity sources to form a MIMO matrix channel in a satellite environment, particular emphasis is put on satellite diversity. Two specific different topics from the field of MIMO technology applications to satellite communications at these frequencies are further analyzed: (i capacity improvement achieved by MIMO spatial multiplexing systems and (ii interference mitigation achieved by MIMO diversity systems employing receive antenna selection. In the first case, a single-user capacity analysis of a satellite MIMO spatial multiplexing system is presented and a useful analytical closed form expression is derived for the outage capacity achieved. In the second case, a satellite MIMO diversity system with receive antenna selection is considered, adjacent satellite cochannel interference on its forward link is studied and an analytical model predicting the interference mitigation achieved is presented. In both cases, an appropriate physical MIMO channel model is assumed which takes into account the propagation phenomena related to the frequencies of interest, such as clear line-of-sight operation, high antenna directivity, the effect of rain fading, and the slant path lengths difference. Useful numerical results obtained through the analytical expressions derived are presented to compare the performance of multi-satellite MIMO systems to relevant single-input single-output (SISO ones.

  12. The University of Kansas High-Throughput Screening laboratory. Part I: meeting drug-discovery needs in the heartland of America with entrepreneurial flair.

    Science.gov (United States)

    McDonald, Peter R; Roy, Anuradha; Chaguturu, Rathnam

    2011-05-01

    The University of Kansas High-Throughput Screening (KU HTS) core is a state-of-the-art drug-discovery facility with an entrepreneurial open-service policy, which provides centralized resources supporting public- and private-sector research initiatives. The KU HTS core applies pharmaceutical industry project-management principles in an academic setting by bringing together multidisciplinary teams to fill critical scientific and technology gaps, using an experienced team of industry-trained researchers and project managers. The KU HTS proactively engages in supporting grant applications for extramural funding, intellectual-property management and technology transfer. The KU HTS staff further provides educational opportunities for the KU faculty and students to learn cutting-edge technologies in drug-discovery platforms through seminars, workshops, internships and course teaching. This is the first instalment of a two-part contribution from the KU HTS laboratory.

  13. Hizbollah–Syrian Intelligence Affairs: A Marriage of Convenience

    Directory of Open Access Journals (Sweden)

    Carl Anthony Wege

    2011-01-01

    Full Text Available Since the 1980s, Hizbollah has emerged as the guardian of Lebanon's Shi'a and a stalking horse for Iran. Syria, though allied with Tehran, seeks to manage Hizbollah's freedom of action in Lebanon and is eyed cautiously in Damascus. Hizbollah has managed to maintain independence from these Syrian efforts because of both Lebanese Shi'a religious élan and the protection given Hizbollah by its Shi'a allies in Iran.

  14. Discrimination in waiting times by insurance type and financial soundness of German acute care hospitals.

    Science.gov (United States)

    Schwierz, Christoph; Wübker, Achim; Wübker, Ansgar; Kuchinke, Björn A

    2011-10-01

    This paper shows that patients with private health insurance (PHI) are being offered significantly shorter waiting times than patients with statutory health insurance (SHI) in German acute hospital care. This behavior may be driven by the higher expected profitability of PHI relative to SHI holders. Further, we find that hospitals offering private insurees shorter waiting times when compared with SHI holders have a significantly better financial performance than those abstaining from or with less discrimination.

  15. KUŞAKLARIN SİYASAL İLETİŞİM KÜLTÜR VE LİDERLİK AÇISINDAN DEĞERLENDİRİLMESİ

    OpenAIRE

    GÖKTAŞ, Pınar; ÇARIKÇI, İlker Hüseyin

    2018-01-01

    Kuşaklararası farklılıklar; bireylerin iletişim tarzını vearzu edilen liderlik tarzını etkilemektedir. Tipik kuşak çatışmalarının çoğuiletişimsizlikten kaynaklanmaktadır. Bu sorunu çözmek için hedef kitleye yönelikiletişim tarzı seçilmelidir. Liderlik tarzı açısından ise kuşaklar inandırıcı vegüvenilir bir lider arzusu içindedir. Araştırma kapsamında aynı zamandaaralarındaki farka da değinebilmek adına sessiz kuşak, patlama kuşağı, X, Y ve Zkuşaklarına yer verilmiştir. Bu bağlamda kuşaklar il...

  16. Sequential and joint hydrogeophysical inversion using a field-scale groundwater model with ERT and TDEM data

    Directory of Open Access Journals (Sweden)

    D. Herckenrath

    2013-10-01

    Full Text Available Increasingly, ground-based and airborne geophysical data sets are used to inform groundwater models. Recent research focuses on establishing coupling relationships between geophysical and groundwater parameters. To fully exploit such information, this paper presents and compares different hydrogeophysical inversion approaches to inform a field-scale groundwater model with time domain electromagnetic (TDEM and electrical resistivity tomography (ERT data. In a sequential hydrogeophysical inversion (SHI a groundwater model is calibrated with geophysical data by coupling groundwater model parameters with the inverted geophysical models. We subsequently compare the SHI with a joint hydrogeophysical inversion (JHI. In the JHI, a geophysical model is simultaneously inverted with a groundwater model by coupling the groundwater and geophysical parameters to explicitly account for an established petrophysical relationship and its accuracy. Simulations for a synthetic groundwater model and TDEM data showed improved estimates for groundwater model parameters that were coupled to relatively well-resolved geophysical parameters when employing a high-quality petrophysical relationship. Compared to a SHI these improvements were insignificant and geophysical parameter estimates became slightly worse. When employing a low-quality petrophysical relationship, groundwater model parameters improved less for both the SHI and JHI, where the SHI performed relatively better. When comparing a SHI and JHI for a real-world groundwater model and ERT data, differences in parameter estimates were small. For both cases investigated in this paper, the SHI seems favorable, taking into account parameter error, data fit and the complexity of implementing a JHI in combination with its larger computational burden.

  17. Nuclear survivin and its relationship to DNA damage repair genes in non-small cell lung cancer investigated using tissue array.

    Directory of Open Access Journals (Sweden)

    Songliu Hu

    Full Text Available To investigate the predictive role and association of nuclear survivin and the DNA double-strand breaks repair genes in non-small cell lung cancer (NSCLC: DNA-dependent protein kinase catalytic subunit (DNA-PKcs, Ku heterodimeric regulatory complex 70-KD subunit (Ku70 and ataxia-telangiectasia mutated (ATM.The protein expression of nuclear survivin, DNA-PKcs, Ku70 and ATM were investigated using immunohistochemistry in tumors from 256 patients with surgically resected NSCLC. Furthermore, we analyzed the correlation between the expression of nuclear survivin, DNA-PKcs, Ku70 and ATM. Univariate and multivariate analyses were performed to determine the prognostic factors that inuenced the overall survival and disease-free survival of NSCLC.The expression of nuclear survivin, DNA-PKcs, Ku70 and ATM was significantly higher in tumor tissues than in normal tissues. By dichotomizing the specimens as expressing low or high levels of nuclear survivin, nuclear survivin correlated significantly with the pathologic stage (P = 0.009 and lymph node status (P = 0.004. The nuclear survivin levels were an independent prognostic factor for both the overall survival and the disease-free survival in univariate and multivariate analyses. Patients with low Ku70 and DNA-PKcs expression had a greater benefit from radiotherapy than patients with high expression of Ku70 (P = 0.012 and DNA-PKcs (P = 0.02. Nuclear survivin expression positively correlated with DNA-PKcs (P<0.001 and Ku70 expression (P<0.001.Nuclear survivin may be a prognostic factor for overall survival in patients with resected stage I-IIIA NSCLC. DNA-PKcs and Ku70 could predict the effect of radiotherapy in patients with NSCLC. Nuclear survivin may also stimulates DNA double-strand breaks repair by its interaction with DNA-PKcs and Ku70.

  18. Primary hyperparathyroidism at nishi kobe medical center

    International Nuclear Information System (INIS)

    Omori, Koichi; Yamashita, Masaru; Kishimoto, Masanao; Tsuji, Tomoko

    2002-01-01

    Since 1994, there have been 10 cases (1 male, 9 females, 37-72 years old) of primary hyperparathyroidism at our hospital. CT, ultrasonography (US), and MIBI scintigraphy (MIBI) were undertaken for preoperative imaging of the parathyroid tumor. In 9 adenoma cases, accurate localization was obtained in 6 of 9 cases for US, in 8 of 8 cases for CT, and in 9 of 9 cases for MIBI. After the surgery, laboratory data of Ca and i-PTH were in the normal range. Histopathological diagnosis showed 9 adenoma cases and 1 hyperplasia case. Three cases were associated with thyroid diseases. This paper presents two cases with rare clinical symptoms. The chief complaint of the first case was hoarseness. Transient recurrent nerve palsy was observed two times in 2 years. During the surgery, the tumor existed just behind the right recurrent nerve. By histological examination, the tumor was diagnosed as parathyroid adenoma. There has been no recurrent nerve palsy since the surgery. The second case had been treated after diagnosis of deglusion for 3 years in a psychiatry clinic. CT and MIBI showed parathyroid tumor just below the right lobe of the thyroid. After surgery, psychological symptoms were dramatically improved. (author)

  19. Extension of NHWAVE to Couple LAMMPS for Modeling Wave Interactions with Arctic Ice Floes

    Science.gov (United States)

    2015-09-30

    Modelling, in press. Orzech, M., Shi, F., Veeramony, J., Bateman , S., Calantoni, J., and Kirby, J. T., 2015, “Incorporating floating surface...objects into a fully dispersive surface wave model”, Ocean Modelling, submitted. Bateman , S. Shi, F., Orzech, M., Veeramony, J., and Calantoni, J., 2014...Orzech, M., Shi, F., Calantoni, J., Bateman , S., and Veeramony, J., “Small-scale modeling of waves and floes in the Marginal Ice Zone”, 2014 Fall Meeting of the American Geophysical Union.

  20. High-resolution aeromagnetic survey in the area of Arima-Takatsuki-Rokko active fault system; Arima Takatsuki Rokko katsudanso chiiki ni okeru komitsudo kuchu jiki tansa

    Energy Technology Data Exchange (ETDEWEB)

    Nakatsuka, T; Okuma, S; Morijiri, R; Makino, M [Geological Survey of Japan, Tsukuba (Japan)

    1996-10-01

    High-resolution aeromagnetic survey was conducted in December, 1995, over the area of Arima-Takatsuki-Rokko active fault system, where the 1995 Hyogo-South (Kobe) earthquake took place. Based on the surveyed data, the magnetic anomaly distribution in the Kei-Hanshin district was illustrated. Features of magnetic anomaly observed in it were discussed. Influence of artificial structures in the coastal zone of Kobe City was tried to be removed. Distinct magnetic anomaly observed in the center of Kyoto City was located at the southern part near Shijo-Karasuma. This was mainly affected by the artificial structure. A high magnetic anomaly with a long wave length was observed in the southern part of Kyoto. There was a high magnetic anomaly in an area surrounded by central cities of Nishinomiya-Toyonaka district. At the location where positive and negative magnetic anomalies were illustrated in NEDO`s map in the coastal zone of Kobe City, the anomaly pattern was clarified. The influence of artificial structure was approximated using a point dipole. The dipole was placed in each block having a magnetic anomaly. The parameter was determined by the inverse analysis, to remove the influence. Consequently, most of magnetic anomalies due to artificial structures could be removed. 6 figs.

  1. The Comparison of Canopy Height Profiles Extracted from Ku-band Profile Radar Waveforms and LiDAR Data

    Directory of Open Access Journals (Sweden)

    Hui Zhou

    2018-05-01

    Full Text Available An airborne Ku-band frequency-modulated continuous waveform (FM-CW profiling radar, Tomoradar, records the backscatter signal from the canopy surface and the underlying ground in the southern boreal forest zone of Finland. The recorded waveforms are transformed into canopy height profiles (CHP with a similar methodology utilized in large-footprint light detection and ranging (LiDAR. The point cloud data simultaneously collected by a Velodyne® VLP-16 LiDAR on-board the same platform represent the frequency of discrete returns, which are also applied to the extraction of the CHP by calculating the gap probability and incremental distribution. To thoroughly explore the relationships of the CHP derived from Tomoradar waveforms and LiDAR data we utilized the effective waveforms of one-stripe field measurements and comparison them with four indicators, including the correlation coefficient, the root-mean-square error (RMSE of the difference, and the coefficient of determination and the RMSE of residuals of linear regression. By setting the Tomoradar footprint as 20 degrees to contain over 95% of the transmitting energy of the main lobe, the results show that 88.17% of the CHPs derived from Tomoradar waveforms correlated well with those from the LiDAR data; 98% of the RMSEs of the difference ranged between 0.002 and 0.01; 79.89% of the coefficients of determination were larger than 0.5; and 98.89% of the RMSEs of the residuals ranged from 0.001 to 0.01. Based on the investigations, we discovered that the locations of the greatest CHP derived from the Tomoradar were obviously deeper than those from the LiDAR, which indicated that the Tomoradar microwave signal had a stronger penetration capability than the LiDAR signal. Meanwhile, there are smaller differences (the average RMSEs of differences is only 0.0042 when the total canopy closure is less than 0.5 and better linear regression results in an area with a relatively open canopy than with a denser

  2. Pilot testing of the Czech versions of the Coaching Behavior Assessment Questionnaire structure [Pilotní testování struktury české verze dotazníku Coaching Behavior Assessment Questionnaire

    Directory of Open Access Journals (Sweden)

    Martin Musálek

    2012-03-01

    Martin a Kelly Barnes vytvořili v roce 1999 dotazník Coaching Behavior Assessment Questionnaire, který vychází z CBAS (Smith a kol., 1977 a LSS (Chelladurai & Saleh, 1978, 1980. V současné době není v České republice podobný diagnostický nástroj pro hodnocení chování trenéra. CÍLE: Cílem této pilotní studie bylo přeložit a ohodnotit strukturu dotazníku CBAQ metodou strukturálního modelování pro populaci dětí ve věku 10 – 16 let. METODIKA: Pro účel překladu dotazníku byla použita modifikovaná metoda přímého překladu (Behling & Law, 2000. Dotazník vyplnilo 100 účastníků ve věku 10 – 16 let, 63 děvčat (průměrný věk 13,02; SD = 2,10, 37 chlapců (průměrný věk 13,27; SD = 1,37. Pro analýzu dat byla použita exploratorní a konfirmační faktorová analýza. VÝSLEDKY: Původní model byl testován za účelem ověření struktury a diagnostické kvality tohoto nástroje. Výsledky původního 12-faktorového modelu CBAQ ukázaly slabý fit modelu s podprůměrnými hodnotami indexů fitu RMSEA = 0,082, CFI = 0,600 a také nízké koeficienty generické reliability. Z tohoto důvodu jsme se rozhodli pro re-analýzu dat, ze které byla vytvořena modifikovaná 5-faktorová struktura CBAQ. Tento 5-faktorový model s omezeným počtem položek ukázal nejlepší hodnoty indexů fitu RMSEA = 0,056; CFI = 0.964 a také akceptovatelné hodnoty generické reliability. ZÁVĚRY: Tato studie měla pilotní charakter, uvědomujeme si proto, že snížení velkého počtu položek u této modifikované verze vedlo ke ztrátě informace. Přesto se domníváme, že by tato finální 5-faktorová verze s 15 položkami mohla tvořit základ pro budoucí připravovanou plně standardizovanou českou verzi CBAQ.

  3. Mechanický návrh průběžného zásobníku příze a jeho realizace

    OpenAIRE

    Klusoň, Vladimír

    2014-01-01

    Práce se zabývá vývojem zařízení Průběžného zásobníku příze pro textilní stroj. Průběžný zásobník přízeobsahuje poháněný navíjecí válec s rotačním kompenzátorem napětí příze, flyerem. Poháněný otočný zásobník je spřažen s prvním pohonem tvořeným elektrickým motorem a rotační kompenzátor je spřažen s druhým pohonem tvořeným elektrickým motorem, přičemž oba motory jsou napojeny na řídicí systém. Zařízení Průběžný zásobník příze efektivně zvyšuje stupeň automatizace textilního stroje. This th...

  4. Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a

    Directory of Open Access Journals (Sweden)

    Xue Ying

    2006-07-01

    Full Text Available Abstract Background Shigella bacteria cause dysentery, which remains a significant threat to public health. Shigella flexneri is the most common species in both developing and developed countries. Five Shigella genomes have been sequenced, revealing dynamic and diverse features. To investigate the intra-species diversity of S. flexneri genomes further, we have sequenced the complete genome of S. flexneri 5b strain 8401 (abbreviated Sf8401 and compared it with S. flexneri 2a (Sf301. Results The Sf8401 chromosome is 4.5-Mb in size, a little smaller than that of Sf301, mainly because the former lacks the SHI-1 pathogenicity island (PAI. Compared with Sf301, there are 6 inversions and one translocation in Sf8401, which are probably mediated by insertion sequences (IS. There are clear differences in the known PAIs between these two genomes. The bacteriophage SfV segment remaining in SHI-O of Sf8401 is clearly larger than the remnants of bacteriophage SfII in Sf301. SHI-1 is absent from Sf8401 but a specific related protein is found next to the pheV locus. SHI-2 is involved in one intra-replichore inversion near the origin of replication, which may change the expression of iut/iuc genes. Moreover, genes related to the glycine-betaine biosynthesis pathway are present only in Sf8401 among the known Shigella genomes. Conclusion Our data show that the two S. flexneri genomes are very similar, which suggests a high level of structural and functional conservation between the two serotypes. The differences reflect different selection pressures during evolution. The ancestor of S. flexneri probably acquired SHI-1 and SHI-2 before SHI-O was integrated and the serotypes diverged. SHI-1 was subsequently deleted from the S. flexneri 5b genome by recombination, but stabilized in the S. flexneri 2a genome. These events may have contributed to the differences in pathogenicity and epidemicity between the two serotypes of S. flexneri.

  5. Leveraging multi-layer imager detector design to improve low-dose performance for megavoltage cone-beam computed tomography

    Science.gov (United States)

    Hu, Yue-Houng; Rottmann, Joerg; Fueglistaller, Rony; Myronakis, Marios; Wang, Adam; Huber, Pascal; Shedlock, Daniel; Morf, Daniel; Baturin, Paul; Star-Lack, Josh; Berbeco, Ross

    2018-02-01

    While megavoltage cone-beam computed tomography (CBCT) using an electronic portal imaging device (EPID) provides many advantages over kilovoltage (kV) CBCT, clinical adoption is limited by its high doses. Multi-layer imager (MLI) EPIDs increase DQE(0) while maintaining high resolution. However, even well-designed, high-performance MLIs suffer from increased electronic noise from each readout, degrading low-dose image quality. To improve low-dose performance, shift-and-bin addition (ShiBA) imaging is proposed, leveraging the unique architecture of the MLI. ShiBA combines hardware readout-binning and super-resolution concepts, reducing electronic noise while maintaining native image sampling. The imaging performance of full-resolution (FR); standard, aligned binned (BIN); and ShiBA images in terms of noise power spectrum (NPS), electronic NPS, modulation transfer function (MTF), and the ideal observer signal-to-noise ratio (SNR)—the detectability index (d‧)—are compared. The FR 4-layer readout of the prototype MLI exhibits an electronic NPS magnitude 6-times higher than a state-of-the-art single layer (SLI) EPID. Although the MLI is built on the same readout platform as the SLI, with each layer exhibiting equivalent electronic noise, the multi-stage readout of the MLI results in electronic noise 50% higher than simple summation. Electronic noise is mitigated in both BIN and ShiBA imaging, reducing its total by ~12 times. ShiBA further reduces the NPS, effectively upsampling the image, resulting in a multiplication by a sinc2 function. Normalized NPS show that neither ShiBA nor BIN otherwise affects image noise. The LSF shows that ShiBA removes the pixilation artifact of BIN images and mitigates the effect of detector shift, but does not quantifiably improve the MTF. ShiBA provides a pre-sampled representation of the images, mitigating phase dependence. Hardware binning strategies lower the quantum noise floor, with 2  ×  2 implementation reducing the

  6. Vecāku prombūtnes un klātesošā vecāka audzināšanas pieejas saistība ar pusaudžu depresijas pazīmēm

    OpenAIRE

    Ločmele, Renāte

    2014-01-01

    Pētījuma mērķis bija noskaidrot, kādas ir saistības starp vecāku prombūtni, klātesošā vecāka audzināšanas pieeju un pusaudžu depresijas pazīmēm. Pētījumā piedalījās 62 respondenti – 37 meitenes un 25 zēni vecumā no 11 līdz 16 gadiem. Respondentu vidējais vecums bija 14 gadi. Tie tika sadalīti divās grupās: vienā grupā bija pusaudži, kuriem viens no vecākiem atrodas prombūtnē (n=31), otrā grupā bija pusaudži, kas dzīvo kopā ar abiem vecākiem ( n=31). Datu ievākšanai tika izmantotas sekojoš...

  7. Ku to V-band 4-bit MEMS phase shifter bank using high isolation SP4T switches and DMTL structures

    Science.gov (United States)

    Dey, Sukomal; Koul, Shiban K.; Poddar, Ajay K.; Rohde, Ulrich L.

    2017-10-01

    This work presents a micro-electro-mechanical system (MEMS) based on a wide-band 4-bit phase shifter using two back-to-back single-pole-four-throw (SP4T) switches and four different distributed MEMS transmission line (DMTL) structures that are implemented on 635 µm alumina substrate using surface micromachining process. An SP4T switch is designed with a series-shunt configuration and it demonstrates an average return loss of  >17 dB, an insertion loss of  28 dB up to 60 GHz. A maximum area of the SP4T switch is ~0.76 mm2. Single-pole-single-throw and SP4T switches are capable of handling 1 W of radio frequency (RF) power up to  >100 million cycles at 25° C; they can even sustained up to  >70 million cycles with 1 W at 85 °C. The proposed wide-band phase shifter works at 17 GHz (Ku-band), 25 GHz (K-band), 35 GHz (Ka-band) and 60 GHz (V-band) frequencies. Finally,a 4-bit phase shifter demonstrates an average insertion loss of  10 dB and maximum phase error of ~3.8° at 60 GHz frequency over 500 MHz bandwidth. Total area of the fabricated device is ~11 mm2. In addition, the proposed device works well up to  >107 cycles with 1 W of RF power. To the best of the author’s knowledge, this is the best reported wide-band MEMS 4-bit phase shifter in the literature that works with a constant resolution.

  8. Elucidating the association between the self-harm inventory and several borderline personality measures in an inpatient psychiatric sample.

    Science.gov (United States)

    Sellbom, Martin; Sansone, Randy A; Songer, Douglas A

    2017-09-01

    The current study evaluated the utility of the self-harm inventory (SHI) as a proxy for and screening measure of borderline personality disorder (BPD) using several diagnostic and statistical manual of mental disorders (DSM)-based BPD measures as criteria. We used a sample of 145 psychiatric inpatients, who completed the SHI and a series of well-validated, DSM-based self-report measures of BPD. Using a series of latent trait and latent class analyses, we found that the SHI was substantially associated with a latent construct representing BPD, as well as differentiated latent classes of 'high' vs. 'low' BPD, with good accuracy. The SHI can serve as proxy for and a good screening measure for BPD, but future research needs to replicate these findings using structured interview-based measurement of BPD.

  9. Hard X-Ray Properties of the Merging Cluster Abell 3667 as Observed with Suzaku

    Science.gov (United States)

    2008-08-01

    3667 as Observed with Suzaku Kazuhiro NAKAZAWA Department of Physics, The University of Tokyo, 7-3-1 Hongo , Bunkyo-ku, Tokyo 113-0033 nakazawa...of Tokyo, 7-3-1 Hongo , Bunkyo-ku, Tokyo 113-0033 Kazuo MAKISHIMA Department of Physics, The University of Tokyo, 7-3-1 Hongo , Bunkyo-ku, Tokyo 113

  10. The Shi’a Crescent: A Misconception of Shi’a Alliance

    Science.gov (United States)

    2014-12-01

    Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni

  11. Synthesis, Transfer, and Characterization of Nanoscale 2-Dimensional Materials

    Science.gov (United States)

    2015-09-01

    Shi Y, Hamsen C, Jia X, Kim KK, Reina A, Hofmann M, Kong J. Synthesis of few-layer hexagonal boron nitride thin film by chemical vapor deposition...hexagonal boron nitride layers. Nano Letters. 2010;10(8):3209–3215. 12. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of...microscopy. Physical Review B. 2009;80(15):155425. 33. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of monolayer hexagonal boron

  12. The effect of MRN complex and ATM kinase inhibitors on Zebrafish embryonic development

    Science.gov (United States)

    Kumaran, Malina; Fazry, Shazrul

    2018-04-01

    Zebrafish is an ideal animal model to study developmental biology due to its transparent embryos and rapid development stages of embryogenesis. Here we investigate the role of DNA damage proteins, specifically Mre11/Rad50/NBN (MRN) complex and ataxia-telangiectasia mutated (ATM) kinase during embryogenesis by inhibiting its function using specific MRN complex (Mirin) and ATM Kinase inhibitors (Ku60019 and Ku55933). Zebrafish embryos at midblastula transition (MBT) stage are treated with Mirin, Ku60019 and Ku55933. The embryonic development of the embryos was monitored at 24 hours-post fertilisation (hpf), 48 hpf and 72 hpf. We observed that at the lowest concentrations (3 µM of Mirin, 1.5 nM of Ku60019 and 3 nM of Ku55933), the inhibitors treated embryos have 100% survivability. However, with increasing inhibitor concentration, the survivability drops. Control or mock treatment of all embryos shows 100 % survivability rate. This study suggests that DNA damage repair proteins may be crucial for normal zebrafish embryo development and survival.

  13. Semiconductor laser with fresh aloe shi fu and nursing therapy curative effect observation of indwelling needle phlebitis in patients with cerebral apoplexy%半导体激光联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效观察

    Institute of Scientific and Technical Information of China (English)

    王爱丽; 卢琦; 梅现红; 官莉

    2015-01-01

    Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。

  14. Elasticity of superhydrous phase B at the mantle temperature and pressure: Implications for 800-km discontinuity and water flow into lower mantle

    Science.gov (United States)

    Yang, D.; Wang, W.; Wu, Z.

    2017-12-01

    Plate subduction can transport the water to the Earth's interior by forming hydrous phases and water can exert important effects on global dynamics and many processes within the deep Earth. Superhydrous phase B (ShyB), as an important candidate for transporting water into the mantle transition zone and lower mantle, is stable up to 31 GPa and will decompose into bridgmanite, periclase and water at a depth of 800 km [Komabayashi and Omori, 2006]. The decomposition of ShyB may be related to the seismic discontinuity at the depth of 800 km in Western-Pacific Subduction Zones [Liu et al., 2016; Porritt and Yoshioka, 2016]. The detail discussions on this topic require the elasticity of ShyB at the P-T conditions of the transition zone and lower mantle. In this contribution, we obtained the thermal elasticity of ShyB using first-principles calculations. ShyB shows a very low velocity and density compared to the bridgmanite and periclase, the major minerals in the lower mantle. The accumulation of ShyB will generate the low-velocity anomaly in the uppermost lower mantle. The dehydration of ShyB will cause the Vp, Vs, and density increase by 7.5%, 15.0% and 12%, respectively. It means that a slab with 10% ShyB could cause an impedance contrast of 2.7% at a depth of 800 km for shear wave. Furthermore, the released waters by the dehydration of ShyB probably migrate upward and promote the partial melt to reduce the sound velocity at shallower depth, which can further explain the low-velocity zones just above 800-km discontinuity in Western-Pacific Subduction Zones [Liu et al., 2016]. Komabayashi, T., and S. Omori (2006), Internally consistent thermodynamic data set for dense hydrous magnesium silicates up to 35GPa, 1600°C: Implications for water circulation in the Earth's deep mantle, Physics of the Earth and Planetary Interiors, 156(1-2), 89-107. Liu, Z., J. Park, and S. I. Karato (2016), Seismological detection of low-velocity anomalies surrounding the mantle transition

  15. Is universal coverage via social health insurance financially feasible in Swaziland?

    Science.gov (United States)

    Mathauer, Inke; Musango, Laurent; Sibandze, Sibusiso; Mthethwa, Khosi; Carrin, Guy

    2011-03-01

    The Government of Swaziland decided to explore the feasibility of social health insurance (SHI) in order to enhance universal access to health services. We assess the financial feasibility of a possible SHI scheme in Swaziland. The SHI scenario presented is one that mobilises resources additional to the maintained Ministry of Health and Social Welfare (MOHSW) budget. It is designed to increase prepayment, enhance overall health financing equity, finance quality improvements in health care, and eventually cover the entire population. The financial feasibility assessment consists of calculating and projecting revenues and expenditures of the SHI scheme from 2008 to 2018. SimIns, a health insurance simulation software, was used. Quantitative data from government and other sources and qualitative data from discussions with health financing stakeholders were gathered. Policy assumptions were jointly developed with and agreed upon by a MOHSW team. SHI would take up an increasing proportion of total health expenditure over the simulation period and become the dominant health financing mechanism. In principle, and on the basis of the assumed policy variables, universal coverage could be reached within 6 years through the implementation of an SHI scheme based on a mix of contributory and tax financing. Contribution rates for formal sector employees would amount to 7% of salaries and the Ministry of Health and Social Welfare budget would need to be maintained. Government health expenditure including social health insurance would increase from 6% in 2008 to 11% in 2018.

  16. Lastedisain ehk kodumaine disainerlooming lastele / Dagmar Reinolt

    Index Scriptorium Estoniae

    Reinolt, Dagmar

    2015-01-01

    Eesti disainerite poolt toodetud lastepärased esemed - võileivaalus (VarmCountry), tapeet "Värvi ise" (Anni Varm), söögitool "Mari" (Julia Maria Künnap), nööpsadul (Liisa Elken), öökullipadi (Ann Lutter), kiikhobu "Fox" (Maile Grünberg), KuKuJuKu helkurid (Okeiko) ja Dadamora lasteriided (Mariliis Oksaar,Tõnis Kenkmaa)

  17. Structural Modification of Egyptian Kaolinite for Paper Coating

    International Nuclear Information System (INIS)

    Mohamed, H.F.; Hassan, M.S.; Morsy, F.A.; El-Sherbiny, S.

    2013-01-01

    The aim of this work is surface modification of Egyptian kaolinite for paper coating. Kaolinite < 2 fraction (KF) obtained using sedimentation and centrifuging techniques. Organo-kaolinite was prepared via inserting Urea (NH 2 CO NH 2 ) within the gallery of kaolinite using grinding technique for different times. Nano kaolinite was prepared from dispersion of organo-kaolinite in paper coating. The kaolinite (K), kaolinite /urea (KU) and kaolinite urea with binder (KU/Binder) were characterized using X-ray diffractometry (XRD), Infrared spectroscopy (IR) and Scanning Electron Microscopy (SEM). XRD studies revealed shifting of basal space of kaolinite from 0.714 to 1.11 nm upon grinding of kaolinite with urea for 5 h. On the other hand, the characteristic peak of kaolinite completely disappeared during dispersion of KU in paper coating suspension, which revealed the exfoliation of organo-kaolinite layers through the binder. Meanwhile, IR spectra show that NH-CO molecule exists in the intercalated kaolinite. The SEM images of KU revealed that kaolinite is intercalated U and fully exfoliation of KU achieved in KU/Binder and revealed by thin flakes with particle size ranged from 500 nm and 300 nm respectively. The modified kaolinite for paper coating increased the optical properties in terms of ISO brightness, opacity and gloss of the coated paper. There was a significant decrease in coated paper roughness compared to untreated kaolinite. Air permeance of the KF decreased in comparison with K sample, but increased sharply by intercalation of kaolinite (KU). Burst strength also started to increase with untreated kaolinite but decreased sharply with urea KU.

  18. Micro-Raman studies of swift heavy ion irradiation induced structural and conformational changes in polyaniline nanofibers

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Somik [Materials Research Laboratory, Department of Physics, Tezpur University, Tezpur 784028, Assam (India); Kumar, A., E-mail: ask@tezu.ernet.i [Materials Research Laboratory, Department of Physics, Tezpur University, Tezpur 784028, Assam (India)

    2010-09-15

    Polyaniline (PAni) nanofibers doped with camphor sulfonic acid have been irradiated with 90 MeV O{sup 7+} ions at different fluences (3 x 10{sup 10}-1 x 10{sup 12} ions/cm{sup 2}) using a 15UD Pelletron accelerator under ultra-high vacuum. XRD studies reveal a decrease in the domain length and an increase in the strain upon SHI irradiation. The increase in d-spacing corresponding to the (1 0 0) reflection of PAni nanofibers with increasing irradiation fluence has been attributed to the increase in the tilt angle of the chains with respect to the (a, b) basal plane of PAni. Decrease in the integral intensity upon SHI irradiation indicates amorphization of the material. Micro-Raman ({mu}R) studies confirm amorphization of the PAni nanofibers and also show that the PAni nanofibers get de-doped upon SHI irradiation. {mu}R spectroscopy also reveals a benzenoid to quinoid transition in the PAni chain upon SHI irradiation. TEM results show that the size of PAni nanofibers decreases with the increase in irradiation fluence, which has been attributed to the fragmentation of PAni nanofibers in the core of amorphized tracks caused by SHI irradiation.

  19. Safety Evaluation Report related to the renewal of the operating license for the research reactor at the University of Kansas (Docket No. 50-148)

    International Nuclear Information System (INIS)

    1984-05-01

    This Safety Evaluation Report for the application filed by the University of Kansas (KU) for a renewal of Operating License R-78 to continue to operate the KU 250-kW open-pool training reactor has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is owned and operated by the University of Kansas and is located on the KU campus in Lawrence, Douglas County, Kansas. The staff concludes that the reactor facility can continue to be operated by KU without endangering the health and safety of the public. 17 references, 11 figures, 4 tables

  20. Lie. kū́nas

    Directory of Open Access Journals (Sweden)

    Simas Karaliūnas

    2011-12-01

    Full Text Available LIТН. kū́nas “BODY”SummaryThe cognates of Lith. kū́nas “body” and Latv. kûnis (kи̃пе, kũņа “body; chrysalis; caterpil­lar of a butterfly; bee pupae” are supposed to be Lith. kūпа “carrion”, pa-kū́nė “sore, furuncle; upper lamella, a layer under the roots”, Latv. kипа “wart, excrescence”, kunis “bottom of a sheaf” and others. Lith. kū́nas, kūпа may represent substantivized forms of the adjective Latv. kûns“round, obese, stout”, while Latv. kûnis, kũņа, kūne seem to be derivatives of the suffixes *-o-*-ā-, *-ē-.

  1. Spontaneous haemoperitoneum in pregnancy and endometriosis: a case series

    NARCIS (Netherlands)

    Lier, M. van; Malik, R.F.; Waesberghe, J. van; Maas, J.W.; Rumpt-van de Geest, D.A. van; Coppus, S.F.P.J.; Berger, J.P.; Rijn, B.B. van; Janssen, P.F.; Boer, M.A. de; Vries, J.I.P. de; Jansen, F.W.; Brosens, I.A.; Lambalk, C.B.; Mijatovic, V.

    2017-01-01

    OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In

  2. Spontaneous haemoperitoneum in pregnancy and endometriosis : a case series

    NARCIS (Netherlands)

    Lier, McI; Malik, R F; van Waesberghe, Jhtm; Maas, J W; van Rumpt-van de Geest, D A; Coppus, S F; Berger, J P; van Rijn, B B; Janssen, P F; de Boer, M. A; de Vries, Jip; Jansen, F. W.; Brosens, I A; Lambalk, C B; Mijatovic, V

    OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In

  3. Dual-pulse frequency compounded superharmonic imaging

    NARCIS (Netherlands)

    Neer, P.L.M.J. van; Danilouchkine, M.G.; Matte, G.M.; Steen, A.F.W. van der; Jong, N. de

    2011-01-01

    Tissue second-harmonic imaging is currently the default mode in commercial diagnostic ultrasound systems. A new modality, superharmonic imaging (SHI), combines the third through fifth harmonics originating from nonlinear wave propagation through tissue. SHI could further improve the resolution and

  4. Purtscher's retinopathy followed by neovascular glaucoma

    Directory of Open Access Journals (Sweden)

    Kuroda M

    2013-11-01

    Full Text Available Masasko Kuroda,1 Akihiro Nishida,1 Masashi Kikuchi,2 Yasuo Kurimoto11Department of Ophthalmology, Kobe City Medical Center General Hospital, Kobe, Hyogo, Japan; 2Kikuchi Eye Clinic, Kobe, Hyogo, JapanAbstract: We report the case of a 66-year-old Japanese man who developed neovascular glaucoma secondary to Purtscher's retinopathy following a head injury. The patient presented at our hospital with blurred vision and a visual field abnormality in his left eye 1 month after suffering from a head injury. Upon initial presentation, his best-corrected visual acuity on a decimal chart was 1.5 oculus dexter and 0.6 oculus sinister. The intraocular pressure (IOP was 12 mmHg in both eyes. Fundus examination of the left eye revealed multiple white lesions in the posterior pole. Optical coherence tomography demonstrated retinal edema, particularly in the inner retina. On the basis of these findings, a diagnosis of Purtscher's retinopathy was made. One month after the initial examination, the visual acuity in the left eye deteriorated to 0.01 in decimal chart, and the IOP increased to 37 mmHg. Gonioscopy showed angle neovascularization. The patient received an intravitreal bevacizumab injection and panretinal photocoagulation. Subsequently, the IOP normalized and the angle neovascularization regressed.Keywords: blurred vision, visual field, retinal edema, head injury, head trauma

  5. Reduction of artificial source effect in the high-resolution aeromagnetic survey in the Hanshin region; Hanshin chiiki no komitsudo kuchu jiki tansa ni okeru jinko noise source no eikyo no jokyo

    Energy Technology Data Exchange (ETDEWEB)

    Nakatsuka, T; Makino, M; Morijiri, R; Okuma, S [Geological Survey of Japan, Tsukuba (Japan)

    1997-05-27

    A high-resolution aeromagnetic survey was carried out in December 1995 on areas from Kobe City to Kyoto City in relation to the Hyogoken-nanbu Earthquake in 1995. It was found in the survey that effects of electric trains driven by direct current and man-made structures cannot be avoided, working as a large noise factor in extraction and analysis of geological information. This paper describes a quantitative analysis on magnetic anomaly suspected to have been caused from artificial sources seen in the magnetic map of the Hanshin area obtained from the above exploration data. The paper also gives considerations on methods to remove the effects therefrom. It then describes a quantitative analysis and the result of attempts on removal of the anomaly, taking up the following factors: (1) distribution of specific and remarkable magnetic anomalies which correspond to railroad positions of the Hanshin Railways running through the Nishinomiya-Toyonaka area, (2) the magnetic anomaly trend in positive and negative pair seen in the seafront area of Kobe City, and (3) typical bipolar isolated type magnetic anomaly in the north-west part of Kobe City. The cause for (1) was loop current flown for the railway operation, that for (2) was man-made structures in the improved seafront area, and that for (3) was a provisionally built metal waste storage yard. 9 figs.

  6. Application of VSP to geological investigation; P ha oyobi S ha VSP wo mochiita shinso chishitsu chosa

    Energy Technology Data Exchange (ETDEWEB)

    Kinugasa, Y [Geological Survey of Japan, Tsukuba (Japan); Feng, S; Sugiyama, T; Ishikawa, K [Chuoh Kaihatsu Corp., Tokyo (Japan)

    1997-05-27

    Discussed in this paper are the P-wave and S-wave zero-offset VSPs carried out utilizing boreholes located in Nada Ward, Kobe City, and Hokudan-cho, Hyogo Prefecture, as part of the deep layer boring survey following Hanshin Earthquake Disaster. This effort aims at the elucidation of P-wave and S-wave velocity structures, high-precision identification of data obtained by the surface reflection method, and collection of basic data for active faults investigation in the future. Among the velocity structures obtained for various layers, the S-wave velocity structures in particular agree with the stratigraphy excellently and may be utilized in seismic analyses to be conducted in the future. Reflection from geological boundaries is received with precision, providing accurate information about correlation between reflection and geological cross sections. The records will be useful in formulating plans for reflection surveys for instance of the boundary between the Osaka group and Kobe group. Generally speaking, reflection coefficients are large when the reflection is from a boundary where difference is great in elastic wave impedance (mainly difference in velocity). In the case of the boundary between the Kobe group and granite in Awaji Island, however, no strong reflection is found despite the great difference in velocity. This is attributed to the complicated, sharp inclination of the basement rock and to its weathering. 4 refs., 8 figs.

  7. Erection of the Meiko-Central bridge; Meiko chuo ohashi no kasetsu

    Energy Technology Data Exchange (ETDEWEB)

    Kaneda, S.; Nishikawa, K.; Nagai, Y.; Ishihara, S.; Tsunekawa, M.; Yoshino, S. [Kawasaki Heavy Industries, Ltd., Kobe (Japan)

    1997-10-20

    This is a 1170m-long triple-span continuous steel cable-stayed bridge with the central span measuring 590m, built to traverse Nagoya Port as part of the Isewangan highway. The 190m-high main towers are A-shaped, and have an octagonal cross section to stay stable against winds. The joints were designed to be welded mainly on the spot so as not to affect the surrounding landscape, and in this welding process the achievement of prescribed accuracy was the important technological task. The main girder was a 37m-wide multi-chamber/single-box type, and the steel stabs were installed by on-site welding. Since the erection was carried out above the ship course, a method was used in which the main girder was hung over with the cable stretched long, which demanded constant prudence to assure accuracy throughout the work. The cable is a 17-stage 2-face multi-fan type, a semi-parallel wire strand coated with polyethylene and white fluoroethylene resin. As for accuracy management for erection, it was accomplished by adjusting the amount of shim introduced into each of the four cables every time one stage of cable was erected for the side span and central span. Every accuracy management requirement met the target value with an adequate margin. 6 refs., 10 figs., 4 tabs.

  8. Social Health Inequalities and eHealth: A Literature Review With Qualitative Synthesis of Theoretical and Empirical Studies.

    Science.gov (United States)

    Latulippe, Karine; Hamel, Christine; Giroux, Dominique

    2017-04-27

    eHealth is developing rapidly and brings with it a promise to reduce social health inequalities (SHIs). Yet, it appears that it also has the potential to increase them. The general objective of this review was to set out how to ensure that eHealth contributes to reducing SHIs rather than exacerbating them. This review has three objectives: (1) identifying characteristics of people at risk of experiencing social inequality in health; (2) determining the possibilities of developing eHealth tools that avoid increasing SHI; and (3) modeling the process of using an eHealth tool by people vulnerable to SHI. Following the EPPI approach (Evidence for Policy and Practice of Information of the Institute of Education at the University of London), two databases were searched for the terms SHIs and eHealth and their derivatives in titles and abstracts. Qualitative, quantitative, and mixed articles were included and evaluated. The software NVivo (QSR International) was employed to extract the data and allow for a metasynthesis of the data. Of the 73 articles retained, 10 were theoretical, 7 were from reviews, and 56 were based on empirical studies. Of the latter, 40 used a quantitative approach, 8 used a qualitative approach, 4 used mixed methods approach, and only 4 were based on participatory research-action approach. The digital divide in eHealth is a serious barrier and contributes greatly to SHI. Ethnicity and low income are the most commonly used characteristics to identify people at risk of SHI. The most promising actions for reducing SHI via eHealth are to aim for universal access to the tool of eHealth, become aware of users' literacy level, create eHealth tools that respect the cultural attributes of future users, and encourage the participation of people at risk of SHI. eHealth has the potential to widen the gulf between those at risk of SHI and the rest of the population. The widespread expansion of eHealth technologies calls for rigorous consideration of

  9. From scheme to system: social health insurance funds and the transformation of health financing in Kyrgyzstan and Moldova.

    Science.gov (United States)

    Kutzin, Joseph; Jakab, Melitta; Shishkin, Sergey

    2009-01-01

    The aim of the paper is to bring evidence and lessons from two low- and middle-income countries (LMIs) of the former USSR into the global debate on health financing in poor countries. In particular, we analyze the introduction of social health insurance (SHI) in Kyrgyzstan and Moldova. To some extent, the intent of SHI introduction in these countries was similar to that in LMIs elsewhere: increase prepaid revenues for health and incorporate the entire population into the new system. But the approach taken to universality was different. In particular, the SHI fund in each country was used as the key instrument in a comprehensive reform of the health financing system, with the new revenues from payroll taxation used in an explicitly complementary manner to general budget revenues. From a functional perspective, the reforms in these countries involved not only the introduction of a new source of funds, but also the centralization of pooling, a shift from input- to output-based provider payment methods, specification of a benefit package, and greater autonomy for public sector health care providers. Hence, their reforms were not simply the introduction of an SHI scheme, but rather the use of an SHI fund as an instrument to transform the entire system of health financing. The study uses administrative and household data to demonstrate the impact of the reforms on regional inequality and household financial burden. The approach used in these two countries led to improved equity in the geographic distribution of government health spending, improved financial protection, and reduced informal payments. The comprehensive approach taken to reform in these two countries, and particularly the redirection of general budget revenues to the new SHI funds, explain much of the success that was achieved. This experience offers potentially useful lessons for LMIs elsewhere in the world, and for shifting the global debate away from what we see as a false dichotomy between SHI and

  10. Repair of DNA DSB in higher eukaryotes

    International Nuclear Information System (INIS)

    Wang, H.; Perrault, A.R.; Takeda, Y.; Iliakis, G.

    2003-01-01

    Cells of higher eukaryotes process within minutes double strand breaks (DSBs) in their genome using a NHEJ apparatus that engages DNA-PKcs, Ku, DNA ligase IV, XRCC4, and other as of yet unidentified factors. Although chemical inhibition, or mutation, in any of these factors delays processing, cells ultimately remove the majority of DNA DSBs using an alternative pathway operating with slower kinetics. This alternative pathway is active in mutants deficient in genes of the RAD52 epistasis group. We proposed, therefore, that it reflects an alternative form of NHEJ that operates as a backup (B-NHEJ) to the DNA-PK- dependent (D-NHEJ) pathway, rather than homology directed repair of DSBs. We studied the role of Ku and DNA-PKcs in the coordination of these pathways using as a model end joining of restriction endonuclease linearized plasmid DNA in whole cell extracts. Efficient error-free endjoining observed in such in-vitro reactions is strongly inhibited by anti-Ku antibodies. The inhibition requires DNA-PKcs, despite that fact that Ku efficiently binds DNA ends in the presence of antibodies, or in the absence of DNA-PKcs. Strong inhibition of DNA endjoining is also mediated by wortmannin, an inhibitor of DNA-PKcs, in the presence but not in the absence of Ku, and this inhibition can be rescued by pre-incubating the reaction with double stranded oligonucleotides. The results are compatible with a role of Ku in directing endjoining to a DNA-PK dependent pathway, mediated by efficient end binding and productive interactions with DNA-PKcs. On the other hand, efficient end joining is observed in extracts of cells lacking DNA-PKcs, as well as in Ku-depleted extracts sugggesting the operation of alternative pathways. Extracts depleted of Ku and DNA-PKcs rejoin blunt ends, as well as homologous ends with 3' or 5' protruding single strands with similar efficiency, but addition of Ku suppresses joining of blunt ends and homologous ends with 3' overhangs. We propose that the

  11. Dynamics of social health insurance development: examining the determinants of Chinese basic health insurance coverage with panel data.

    Science.gov (United States)

    Liu, Jun-Qiang

    2011-08-01

    Social health insurance (SHI) is gaining popularity in many developing countries, but there are few systematic empirical studies on the dynamics of SHI development. This study investigates the determinants of coverage of the Basic Healthcare Insurance for Urban Employees (BHI) in China. Using a panel database ranging from 1999 to 2007, the study finds that: (1) economic development plays a valuable role in BHI development; (2) strong financial capacity and administrative capacity in the government contributes to BHI progress; (3) higher trade union density is closely related to more rapid BHI expansion; and (4) taxation agencies are better at collecting SHI premiums. These findings provide evidence-based lessons for new and ongoing SHI programs. In addition, this article aims to make a more general contribution to the study of social policy development by expanding the scope of current theories on social policy development. Copyright © 2011 Elsevier Ltd. All rights reserved.

  12. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  13. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  14. Volcanology of Tuzo pipe (Gahcho Kué cluster) — Root-diatreme processes re-interpreted

    Science.gov (United States)

    Seghedi, I.; Maicher, D.; Kurszlaukis, S.

    2009-11-01

    The Middle Cambrian (~ 540 Ma) Gahcho Kué Kimberlite Field is situated about 275 km ENE of Yellowknife, NWT, Canada. The kimberlites were emplaced into 2.6 Ga Archean granitic rocks of the Yellowknife Supergroup. Four larger kimberlite bodies (5034, Tesla, Tuzo, and Hearne) as well as a number of smaller pipes and associated sheets occur in the field. In plan view, the Tuzo pipe has a circular outline at the surface, and it widens towards deeper levels. The pipe infill consists of several types of coherent and fragmental kimberlite facies. Coherent or apparent coherent (possibly welded) kimberlite facies dominate at depth, but also occur at shallow levels, as dikes intruded late in the eruptive sequence or individual coherent kimberlite clasts. The central and shallower portions of the pipe consist of several fragmental kimberlite varieties that are texturally classified as Tuffisitic Kimberlites. The definition, geometry and extent of the geological units are complex and zones controlled by vertical elements are most significant. The fluidal outlines of some of the coherent kimberlite clasts suggest that at least some are the product of disruption of magma that was in a semi-plastic state or even of welded material. Ragged clasts at low levels are inferred to form part of a complex peperite-like system that intrudes the base of the root zone. A variable, often high abundance of local wall-rock xenoliths between and within the kimberlite phases is observed, varying in size from sub-millimeter to several tens of meters. Wall-rock fragments are common at all locations within the pipe but are especially frequent in a domain with a belt-like geometry between 120 and 200 m depth in the pipe. Steeply outward-dipping bedded deposits made up of wall-rock fragments occur in deep levels of the pipe and are especially common under the downward-widening roof segments. The gradational contact relationships of these deposits with the surrounding kimberlite-bearing rocks as well

  15. The influence of shyness on children's test performance.

    Science.gov (United States)

    Crozier, W Ray; Hostettler, Kirsten

    2003-09-01

    Research has shown that shy children differ from their peers not only in their use of language in routine social encounters but also in formal assessments of their language development, including psychometric tests of vocabulary. There has been little examination of factors contributing to these individual differences. To investigate cognitive-competence and social anxiety interpretations of differences in children's performance on tests of vocabulary. To examine the performance of shy and less shy children under different conditions of test administration, individually with an examiner or among their peers within the familiar classroom setting. The sample consisted of 240 Year 5 pupils (122 male, 118 female) from 24 primary schools. Shy and less shy children, identified by teacher nomination and checklist ratings, completed vocabulary and mental arithmetic tests in one of three conditions, in a between-subjects design. The conditions varied individual and group administration, and oral and written responses. The conditions of test administration influenced the vocabulary test performance of shy children. They performed significantly more poorly than their peers in the two face-to-face conditions but not in the group test condition. A comparable trend for the arithmetic test was not statistically significant. Across the sample as a whole, shyness correlated significantly with test scores. Shyness does influence children's cognitive test performance and its impact is larger when children are tested face-to-face rather than in a more anonymous group setting. The results are of significance for theories of shyness and have implications for the assessment of schoolchildren.

  16. Beyond repair foci: DNA double-strand break repair in euchromatic and heterochromatic compartments analyzed by transmission electron microscopy.

    Directory of Open Access Journals (Sweden)

    Yvonne Lorat

    Full Text Available DNA double-strand breaks (DSBs generated by ionizing radiation pose a serious threat to the preservation of genetic and epigenetic information. The known importance of local chromatin configuration in DSB repair raises the question of whether breaks in different chromatin environments are recognized and repaired by the same repair machinery and with similar efficiency. An essential step in DSB processing by non-homologous end joining is the high-affinity binding of Ku70-Ku80 and DNA-PKcs to double-stranded DNA ends that holds the ends in physical proximity for subsequent repair.Using transmission electron microscopy to localize gold-labeled pKu70 and pDNA-PKcs within nuclear ultrastructure, we monitored the formation and repair of actual DSBs within euchromatin (electron-lucent and heterochromatin (electron-dense in cortical neurons of irradiated mouse brain.While DNA lesions in euchromatin (characterized by two pKu70-gold beads, reflecting the Ku70-Ku80 heterodimer are promptly sensed and rejoined, DNA packaging in heterochromatin appears to retard DSB processing, due to the time needed to unravel higher-order chromatin structures. Complex pKu70-clusters formed in heterochromatin (consisting of 4 or ≥ 6 gold beads may represent multiple breaks in close proximity caused by ionizing radiation of highly-compacted DNA. All pKu70-clusters disappeared within 72 hours post-irradiation, indicating efficient DSB rejoining. However, persistent 53BP1 clusters in heterochromatin (comprising ≥ 10 gold beads, occasionally co-localizing with γH2AX, but not pKu70 or pDNA-PKcs, may reflect incomplete or incorrect restoration of chromatin structure rather than persistently unrepaired DNA damage.Higher-order organization of chromatin determines the accessibility of DNA lesions to repair complexes, defining how readily DSBs are detected and processed. DNA lesions in heterochromatin appear to be more complex, with multiple breaks in spatial vicinity inducing

  17. Effect of Heat Treatment on the Lycopene Content of Tomato Puree.

    African Journals Online (AJOL)

    MBI

    2013-04-03

    Apr 3, 2013 ... foods is mainly due to lycopene (Shi et al, 2002). Lycopene is a naturally .... containing the 5 g sample to solubilized the lycopene (Shi and Maguer, .... Nigeria, 33(1): 178-. 180. Perkins-Veazie P, Collins J K, Pair S D, Robert S.

  18. The effect of shyness on children's formation and retention of novel word-object mappings.

    Science.gov (United States)

    Hilton, Matt; Westermann, Gert

    2017-11-01

    This study set out to examine whether shyness, an aversion to novelty and unfamiliar social situations, can affect the processes that underlie early word learning. Twenty-four-month-old children (n =32) were presented with sets of one novel and two familiar objects, and it was found that shyer children were less likely to select a novel object as the referent of a novel label. Furthermore, not-shy children then showed evidence of retaining these novel mappings, but shy children did not. These findings suggest that shy children's aversion to novelty and to the unfamiliar context can impact on their word learning.

  19. Constraints on Excuse Making: The Deterring Effects of Shyness and Anticipated Retest.

    Science.gov (United States)

    Shepperd, James A.; And Others

    1995-01-01

    Examined whether the apparent absence of an egocentric bias among shy individuals is reflected in their excuse making following poor performance and whether anticipating a challenge to one's excuses would dissuade even nonshy individuals from making excuses. Shy individuals refrained form making consistency-lowering excuses regardless of…

  20. Feasibility study of superharmonic imaging using chirps

    NARCIS (Netherlands)

    Van Neer, P.; Danilouchkine, M.G.; Matte, G.; Voormolen, M.M.; Verweij, M.D.; De Jong, N.

    2010-01-01

    Superharmonic imaging (SHI) targets a combination of the 3rd to 5th harmonics. It was proven to have certain advantages in comparison with the established imaging standards in medical utrasound. SHI enhances the spatial resolution and improves the quality of echographic images, mainly by eliminating

  1. Näitus nagu kuu / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    2005-01-01

    Näitusest "Expat-Art-Centre" Tallinna Kunstihoone fuajees, Ku fassaadil ja Ku-Ku kohvikus kuni 12. I. Näituse ja sellega kaasneva ajakirja on koostanud Mathieu Copeland, osalevad Brian Eno, Pierre Huyghe (sünd. 1962), Ben Kinmont, Claude Leveque (sünd. 1953), Didier Marcel, Olivier Mosset (sünd. 1933), Shimabuku (sünd. 1969), Dan Walsh (sünd. 1962), Ian Wilson (sünd. 1940)

  2. Subclinical hyperthyroidism and cardiovascular risk: recommendations for treatment.

    Science.gov (United States)

    Palmeiro, Christopher; Davila, Maria I; Bhat, Mallika; Frishman, William H; Weiss, Irene A

    2013-01-01

    Subclinical hyperthyroidism (SHy), the mildest form of hyperthyroidism, is diagnosed in patients having a persistently low or undetectable serum concentration of thyroid-stimulating hormone (TSH) with normal free T4 and T3 concentrations. Although overt hyperthyroidism is associated with an increased risk of adverse cardiovascular outcomes, the cardiovascular risk of SHy is controversial. Multiple studies have demonstrated an increased risk of atrial fibrillation, especially in older individuals with TSH levels effects of SHy on all-cause and cardiovascular mortality are not clear, but recent meta-analyses suggest a modest increase in mortality, with the risk increasing with age and associated with the lowest TSH levels. The long-term consequences of SHy in young- and middle-aged adults, and in those with TSH levels are mildly low, are uncertain. For these reasons, guidelines for treatment are based on patient age, the degree of TSH suppression, symptoms consistent with hyperthyroidism, and overall cardiovascular and osteoporotic fracture risks.

  3. Out of pocket payments and social health insurance for private hospital care: Evidence from Greece.

    Science.gov (United States)

    Grigorakis, Nikolaos; Floros, Christos; Tsangari, Haritini; Tsoukatos, Evangelos

    2016-08-01

    The Greek state has reduced their funding on health as part of broader efforts to limit the large fiscal deficits and rising debt ratios to GDP. Benefits cuts and limitations of Social Health Insurance (SHI) reimbursements result in substantial Out of Pocket (OOP) payments in the Greek population. In this paper, we examine social health insurance's risk pooling mechanisms and the catastrophic impact that OOP payments may have on insured's income and well-being. Using data collected from a cross sectional survey in Greece, we find that the OOP payments for inpatient care in private hospitals have a positive relationship with SHI funding. Moreover, we show that the SHI funding is inadequate to total inpatient financing. We argue that the Greek health policy makers have to give serious consideration to the perspective of a SHI system which should be supplemented by the Private Health Insurance (PHI) sector. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  4. Keskmiselt kobe vaatamine / Küllike Rooväli

    Index Scriptorium Estoniae

    Rooväli, Küllike, 1969-

    2004-01-01

    Eesti komöödiafilm "Vanad ja kobedad saavad jalad alla" : režissöör Rando Pettai : operaator Mait Mäekivi : näitlejad Henrik Normann, Madis Milling, Robert Gutman jt. : muusika - ansambel Genialistid : Ruut Pictures 2003

  5. Natural course of sensitization to hen's egg in children not previously exposed to egg ingestion.

    Science.gov (United States)

    de Boissieu, D; Dupont, C

    2006-04-01

    Clinical adverse reactions to egg may occur in infants or children who have never eaten egg. They may be sensitized or even react at first egg ingestion. Few studies are available concerning the reality of egg white allergy in such sensitized children, the natural evolution of this condition and the appropriate decisions to make. To analyze the actuality and natural course of egg allergy in children sensitized without previous of hen's egg ingestion. We set up a clinical decision tree based on clinical history and specific egg white IgE to manage patients who had never ingested egg but were sensitized as demonstrated by a positive SPT and report a cohort of 30 such children The mean level of egg white specific IgE at first analysis, i.e. before 12 months, was high, 28.3 KU(A) /L, with a large range, from 0.6 to >100 KU(A) /L, below 6 KU(A) /L in only 8 patients. In 6 children ("no challenge" group), IgE values remained >8 KU(A) /L by the end of the survey and the oral challenge with egg was always denied. Their mean + SD IgE level was at 51.7 + 38 KU(A) /L at 1 year and 19.7 + 13 KU(A) /L at a mean age of 34 + 5 months. All had an associated anaphylactic reaction with milk and 5 were still allergic to milk by the end of the survey. In the remaining 24 infants, egg was given for the first time at a mean age of 30 + 9 months, by error in 4 cases, all exhibiting an immediate reaction, and in a hospital setting in 20, among whom 14 reacted. Among those 18, with a specific IgE level at 9.1 + 10 KU(A) /L at 28 + 9 months, 4 became tolerant between 3 and 4 years, with specific IgE levels below 1.3 KU(A) /L and a 5th one with specific IgE >100 KU(A) /L at 6 months tolerated scrambled eggs at age 7 year, with specific IgE at 2.6 KU(A) /L. In the 6 others, labeled "non allergic", egg white specific IgE levels were significantly lower, whatever the age, than in the "no challenge" group. The age at challenge was 35 + 8 months, with a mean specific IgE level at 1.0 + 0.9 KU

  6. Validitas dan Reliabilitas Konstruk Pengukuran Perpustakaan Ideal Berbasis Pemakai dengan Pendekatan LIBQUAL

    Directory of Open Access Journals (Sweden)

    Yulyanti Fahruna

    2017-08-01

    Full Text Available This study aims to measure the validity and reliability construct satisfaction and quality of library services based on the user using LIBQUAL (library quality method with a touch of marketing management. Data analysis by Cronbach Alpha and Pearson Correlation. The research was conducted in Tanjungpura University (UNTAN by taking samples of visitors (students at six (6 faculty libraries namely three (3 social faculty of 150 people and three (3 science faculty of 150 people. The sample is chosen by purposive sampling method. Reliability test results show that the five US, IC, LP, LQ and KU variables show high instrument reliability. The result of pearson correlation test shows that the measurement instrument used has problem validity on some question items. At minimum service item with correlation value smaller than 0.30 is IC2, IC5 and LQ5 so it is declared invalid. At service expectation items with correlation value smaller than 0.30 ie AS8, IC1, IC2, IC4, LP1, KU1, KU2, KU4, and KU8. And at present service items with correlation values smaller than 0.30 ie IC1, IC3, LP1, LP3, LQ1, LQ3, LQ4 and KU1.

  7. Patient-reported symptom questionnaires in laryngeal cancer: voice, speech and swallowing.

    Science.gov (United States)

    Rinkel, R N P M; Verdonck-de Leeuw, I M; van den Brakel, N; de Bree, R; Eerenstein, S E J; Aaronson, N; Leemans, C R

    2014-08-01

    To validate questionnaires on voice, speech, and swallowing among laryngeal cancer patients, to assess the need for and use of rehabilitation services, and to determine the association between voice, speech, and swallowing problems, and quality of life and distress. Laryngeal cancer patients at least three months post-treatment completed the VHI (voice), SHI (speech), SWAL-QOL (swallowing), EORTC QLQ-C30, QLQ-HN35, HADS, and study-specific questions on rehabilitation. Eighty-eight patients and 110 healthy controls participated. Cut off scores of 15, 6, and 14 were defined for the VHI, SHI, and SWAL-QOL (sensitivity > 90%; specificity > 80%). Based on these scores, 56% of the patients reported voice, 63% speech, and 54% swallowing problems. VHI, SHI, and SWAL-QOL scores were associated significantly with quality of life (EORTC QLQ-C30 global quality of life scale) (r = .43 (VHI and SHI) and r = .46 (SWAL-QOL)) and distress (r = .50 (VHI and SHI) and r = .58 (SWAL-QOL)). In retrospect, 32% of the patients indicated the need for rehabilitation at time of treatment, and 81% of these patients availed themselves of such services. Post-treatment, 8% of the patients expressed a need for rehabilitation, and 20% of these patients actually made use of such services. Psychometric characteristics of the VHI, SHI, and SWAL-QOL in laryngeal cancer patients are good. The prevalence of voice, speech, and swallowing problems is high, and clearly related to quality of life and distress. Although higher during than after treatment, the perceived need for and use of rehabilitation services is limited. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Validity of patient-reported swallowing and speech outcomes in relation to objectively measured oral function among patients treated for oral or oropharyngeal cancer.

    Science.gov (United States)

    Rinkel, R N P M; Verdonck-de Leeuw, I M; de Bree, R; Aaronson, N K; Leemans, C R

    2015-04-01

    The objective of this study was to test the construct validity of the patient-reported outcomes Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI) in relation to objectively measured oral function among patients treated for oral or oropharyngeal cancer. The study sample consisted of patients treated for oral or oropharyngeal cancer. Outcome measures were the SWAL-QOL and the SHI, and the Functional Rehabilitation Outcomes Grade (FROG), a test to measure oral and shoulder function. Spearman's rank correlation coefficient was used to test associations between the SHI and SWAL-QOL scales, and the FROG scales. During a study period of 3 months, 38 patients (21 males, 17 females; mean age 54 years) were included who visited the outpatient clinic for follow-up care 6-155 months after surgical treatment (n = 14) or combined surgery and radiotherapy (n = 24) for oral (n = 21) or oropharyngeal cancer (n = 17). Most SWAL-QOL and SHI scales (except the SWAL-QOL Fatigue scale) correlated significantly with one or more FROG oral function scales. None of the SWAL-QOL and SHI scales correlated significantly with the FROG shoulder function scale. These results support the construct validity of the SWAL-QOL and SHI questionnaires for assessing speech and swallowing problems in daily life that are moderately but significantly related to oral function. A multidimensional assessment protocol is recommended for use in clinical practice and for research purposes for measuring oral function and swallowing- and speech-related problems in daily life among head and neck cancer patients.

  9. Siim Nestor soovitab : Odessa Pop. Neoandertals / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2007-01-01

    Indieüritusest Odessa Pop 17. veebr. Tallinnas baar-klubis Juuksur. Ultrabrutaalse death-metali duo Neoandertals heliplaadi "Neoandertals Were Master Butchers" esitluskontserdist 17. veebr. Tallinnas KuKu klubis

  10. ONR Far East Scientific Bulletin, Volume 12, Number 4, October-December 1987,

    Science.gov (United States)

    1987-12-01

    magnetic Japan Control Engineers Measurements (CPEM󈨜) 1-35-28-303 Hongo , Bunkyo-ku, Tokyo 113 June The 7th International Kyoto, Professor Isao Yamada...Physics-Material Japan Faculty of Engineering, 0 Research Society) Inter- Tokyo University national Conference on 7-3-1 Hongo , Bunkyo-ku, Tokyo 113...o Department of Psychological 39-FlOO-J200 Chemistry and Nutrition, Faculty of Medicine, University of Tokyo 7-3-1 Hongo , Bunkyo-ku, Tokyo 113

  11. On the domestic fuel channel for BWR

    International Nuclear Information System (INIS)

    Fukada, Hiroshi

    1979-01-01

    Kobe Steel Ltd. started the domestic manufacture of fuel channel boxes for BWRs in 1967, and entered the actual production stage four years after that. Since 1976, the mass production system was adopted with the increase of the demand. The requirements about the surface contamination and the dimensional accuracy over whole length are very strict in the fuel channel boxes, moreover, special consideration must be given so as to prevent the deformation in use. The unique working methods such as electron beam welding, high temperature press forming and so on are employed in Kobe Steel Ltd. to satisfy such strict requirements, therefore the quality of the produced fuel channel boxes is superior to imported ones. At present, the fuel channel boxes domestically made by Kobe Steel Ltd. are used for almost all BWRs in Japan. The functions of fuel channel boxes are to flow boiling coolant uniformly upward, to guide control rods, and to increase the rigidity of fuel assembly. The fuel channel boxes are the square tubes of zircaloy 4 of 134.06 mm inside width, 2.03 mm thickness, and 4118 or 4239 mm length. The progress of the development and the features of the fuel channel boxes and the manufacturing processes are described. Zircaloy plates are formed into channels, and two channels are electron beam-welded after the edge preparation, to make a box. Ultrasonic examination and stress relief treatment are applied, and clips and spacers are welded. (Kako, I.)

  12. Risky health seeking practice among pregnant women in rural Congo

    DEFF Research Database (Denmark)

    Hørby, Laila

    2007-01-01

    the clinics at M’shi., and to analyze the practice and logic of the untrained helpers, in the villages and the professional staff at M’shi. To do that I have done a fieldwork study in the area around M’shi., using qualitative methods such as Interviews, Focus Group Discussions and observations. I have used...... they are part of the tradition and the culture. The women make a perfectly normal choice when they choose the TBAs for care as they are part of the folk sector. The TBA’s are there, culturally sensitive, trusted and respected. They have certain knowledge and skills. The professional, medical system may as well...

  13. Is universal coverage via social health insurance financially feasible ...

    African Journals Online (AJOL)

    SHI would take up an increasing proportion of total health expenditure over the simulation period and become the dominant health financing mechanism. In principle, and on the basis of the assumed policy variables, universal coverage could be reached within 6 years through the implementation of an SHI scheme based ...

  14. Split hand muscle echo intensity index as a reliable imaging marker for differential diagnosis of amyotrophic lateral sclerosis.

    Science.gov (United States)

    Seok, Hung Youl; Park, Jinseok; Kim, Yoo Hwan; Oh, Ki-Wook; Kim, Seung Hyun; Kim, Byung-Jo

    2018-04-17

    The objective of this study was to investigate the usefulness of muscle ultrasound in evaluating dissociated small hand muscle atrophy, termed 'split hand', and its feasibility in the diagnosis of amyotrophic lateral sclerosis (ALS). Forty-four patients with ALS, 18 normal subjects and 9 patients with other neuromuscular disorders were included in this study. The hand muscles were divided into three regions, the median-innervated lateral hand muscle group (ML), the ulnar-innervated lateral hand muscle (UL) and the ulnar-innervated medial hand muscle (UM), and the muscle echo intensity (EI) and compound muscle action potential (CMAP) were measured. We calculated the split hand index (SHI) using muscle EI (SHI mEI ) and CMAP (SHI CMAP ) for comparison among groups. The SHI was derived by dividing muscle EI (or CMAP) measured at the ML and UL by that measured at the UM. The SHI mEI was significantly higher in patients with ALS (51.7±28.3) than in normal controls (29.7±9.9) and disease controls with other neuromuscular disorders (36.5±7.3; Pdifferentiating ALS from other neuromuscular disorders and healthy controls. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  15. Forodesine in the treatment of relapsed/refractory peripheral T-cell lymphoma: an evidence-based review

    Directory of Open Access Journals (Sweden)

    Makita S

    2018-04-01

    Full Text Available Shinichi Makita,1 Akiko Miyagi Maeshima,2 Dai Maruyama,1 Koji Izutsu,1 Kensei Tobinai1 1Department of Hematology, 2Department of Pathology, National Cancer Center Hospital, Chuo-ku, Tokyo, Japan Abstract: T-cell lymphoma is a rare hematologic malignancy with an incidence rate between 10% and 20% of that of non-Hodgkin lymphomas. Patients with peripheral T-cell lymphoma (PTCL generally have a poor prognosis when treated with cyclophosphamide, doxorubicin, vincristine, and prednisolone (CHOP/CHOP-like chemotherapy; once relapse occurs, it is mostly regarded as an incurable disease. To overcome the chemorefractoriness of PTCL, several novel agents have been developed. Since the first approval of pralatrexate, a dihydrofolate reductase inhibitor, for relapsed/refractory PTCL by the US Food and Drug Administration, several new agents, such as romidepsin (histone deacetylase inhibitor, brentuximab vedotin (antibody–drug conjugate targeting CD30, chidamide (histone deacetylase inhibitor, and mogamulizumab (anti-CC chemokine receptor 4 monoclonal antibody, have been approved as a therapeutic option for relapsed/refractory PTCL in several countries, including the US, Europe, China, and Japan. Forodesine is a novel, potent purine nucleoside phosphorylase inhibitor that is effective against T-cell malignancies. Although the clinical development of forodesine was discontinued in the US and Europe, a multicenter Phase I/II study of oral forodesine for relapsed PTCL was recently completed in Japan. The overall response rate was 24% (10 of 41 patients, which included four patients with complete response. In general, the toxicity of forodesine is manageable. As the study met the primary end point, forodesine was approved for the treatment of relapsed/refractory PTCL in Japan in March 2017, which was the first approval of forodesine in the world. As forodesine is an oral formulation, it is more convenient than other novel intravenous agents approved for PTCL

  16. A novel method for calculating the energy cost of turning during running

    OpenAIRE

    Hatamoto, Yoichi; Yamada,Yosuke; Higaki,Yasuki; Kiyonaga,Akira; Tanaka,Hiroaki; Fujii,Tatsuya

    2013-01-01

    Yoichi Hatamoto,1 Yosuke Yamada,2 Tatsuya Fujii,3 Yasuki Higaki,3 Akira Kiyonaga,3 Hiroaki Tanaka31Graduate School of Sports and Health Science, Fukuoka University, Nanakuma Jonan-ku Fukuoka, Japan; 2The Fukuoka University Institute for Physical Activity, Nanakuma Jonan-ku Fukuoka, Japan; 3Faculty of Sports and Health Science, Fukuoka University, Nanakuma Jonan-ku Fukuoka, JapanAbstract: Although changes of direction are one of the essential locomotor patterns in ball sports, the physiologica...

  17. Parliamentary Majorities and National Minorities: Moldova’s Accommodation of the Gagauz

    Science.gov (United States)

    2007-01-01

    Al R.S.S. Moldova Pentru Problemele i and Mihai Cotorobai, 26 . Nationale Shi Autoadminstrararea Locala Shi Economia Locala, signed by A. Arsen...No ———. Avizul Comissiilor Permanente Ale Soveitului Suprem al R.S.S. Moldova p şi Autoadminstrararea Localâ şi Economia Localâ. Signed by A. Arseni

  18. Evaluation of mutagenic potential of contaminated atmosphere at Ibirapuera Park, Sao Paulo - SP, Brazil, using the Tradescantia stamen-hair assay

    International Nuclear Information System (INIS)

    Ferreira, Maria Izildinha; Domingos, Marisa; Gomes, Heliana de A; Saldiva, Paulo H.N.; Assuncao, Joao V. de

    2007-01-01

    Trad-SHM assay was used to check mutagenic potential of atmospheric contamination at Ibirapuera Park, located in Sao Paulo city, Brazil, and variation of risk along the year, besides determining which Tradescantia clone, BNL 4430 or KU-20, better indicates risk. Thirty pots of both clones were exposed during one-year period (September, 2002-August, 2003). Twenty inflorescences were taken from each clone twice a month in the morning, in order to estimate the frequency of mutations in stamen hairs. Results were compared to air pollution and climatic data measured next to the exposure site. KU-20 showed stamen-hair mutations greater than BNL 4430. Greatest mutation rates in KU-20 were observed in condition of high monthly mean of NO 2 and average peak concentrations of NO during the day, indicating that mutagenic effects originated from vehicular pollution. Clone KU-20 revealed to be more appropriate for biomonitoring purposes at the Park. - Clone KU-20 showed to be more appropriate than clone BNL 4430 to indicate vehicular pollution mutagenic risks in Trad-SHM assay

  19. Kunstnike Liidu volikogu koosolek toimus 20. X Ku-Ku klubis

    Index Scriptorium Estoniae

    2003-01-01

    Kinnitati EKLi 2004. a. eelarve, selle toetustest. Harry Liivrand tutvustas Kunstihoone ja selle galerii, Reet Varblane Linnagalerii, Elin Kard Hobusepea ja Draakoni galerii 2004. a. näituseplaane. Ateljee Vabaduse väljak 6-35 otsustati anda rendile Ülle Marksile, ateljee Ristiku 27 müüa Rafael Arutjunjanile. EKLi uued liikmed: Andrus Joonas, Alice Kask, Hermes Sarapuu, Epp Viires, Kristel Sibul

  20. Lifting of a sector block for YE-2 at Kawasaki.

    CERN Multimedia

    R. Loveless/U. of Wisconsin

    2000-01-01

    YE-2 is build from machined sector blocks. Trial assembly is carried out horizontally. This picture represents the lifting of a machined sector block destined to the trial assembly of a half disk YE-2 at Kawasaki (KHI) Kobe, Japan.