Energy Technology Data Exchange (ETDEWEB)
Egli, Martin [Vanderbilt Univ., Nashville, TN (United States); Pattanayek, Rekha [Vanderbilt Univ., Nashville, TN (United States); Sheehan, Jonathan H. [Vanderbilt Univ., Nashville, TN (United States); Xu, Yao [Vanderbilt Univ., Nashville, TN (United States); Mori, Tetsuya [Vanderbilt Univ., Nashville, TN (United States); Smith, Jarrod A. [Vanderbilt Univ., Nashville, TN (United States); Johnson, Carl H. [Vanderbilt Univ., Nashville, TN (United States)
2013-01-25
We found that the Synechococcus elongatus KaiA, KaiB, and KaiC proteins in the presence of ATP generate a post-translational oscillator that runs in a temperature-compensated manner with a period of 24 h. KaiA dimer stimulates phosphorylation of KaiC hexamer at two sites per subunit, T432 and S431, and KaiB dimers antagonize KaiA action and induce KaiC subunit exchange. Neither the mechanism of KaiA-stimulated KaiC phosphorylation nor that of KaiB-mediated KaiC dephosphorylation is understood in detail at present. We demonstrate here that the A422V KaiC mutant sheds light on the former mechanism. It was previously reported that A422V is less sensitive to dark pulse-induced phase resetting and has a reduced amplitude of the KaiC phosphorylation rhythm in vivo. A422 maps to a loop (422-loop) that continues toward the phosphorylation sites. By pulling on the C-terminal peptide of KaiC (A-loop), KaiA removes restraints from the adjacent 422-loop whose increased flexibility indirectly promotes kinase activity. We found in the crystal structure that A422V KaiC lacks phosphorylation at S431 and exhibits a subtle, local conformational change relative to wild-type KaiC. Molecular dynamics simulations indicate higher mobility of the 422-loop in the absence of the A-loop and mobility differences in other areas associated with phosphorylation activity between wild-type and mutant KaiCs. Finally, the A-loop–422-loop relay that informs KaiC phosphorylation sites of KaiA dimer binding propagates to loops from neighboring KaiC subunits, thus providing support for a concerted allosteric mechanism of phosphorylation.
Energy Technology Data Exchange (ETDEWEB)
Villarreal, Seth A.; Pattanayek, Rekha; Williams, Dewight R.; Mori, Tetsuya; Qin, Ximing; Johnson, Carl H.; Egli, Martin; Stewart, Phoebe L. [Case Western; (Vanderbilt); (Vanderbilt-MED)
2014-10-02
The circadian control of cellular processes in cyanobacteria is regulated by a posttranslational oscillator formed by three Kai proteins. During the oscillator cycle, KaiA serves to promote autophosphorylation of KaiC while KaiB counteracts this effect. Here, we present a crystallographic structure of the wild-type Synechococcus elongatus KaiB and a cryo-electron microscopy (cryoEM) structure of a KaiBC complex. The crystal structure shows the expected dimer core structure and significant conformational variations of the KaiB C-terminal region, which is functionally important in maintaining rhythmicity. The KaiBC sample was formed with a C-terminally truncated form of KaiC, KaiC-Δ489, which is persistently phosphorylated. The KaiB–KaiC-Δ489 structure reveals that the KaiC hexamer can bind six monomers of KaiB, which form a continuous ring of density in the KaiBC complex. We performed cryoEM-guided molecular dynamics flexible fitting simulations with crystal structures of KaiB and KaiC to probe the KaiBC protein–protein interface. This analysis indicated a favorable binding mode for the KaiB monomer on the CII end of KaiC, involving two adjacent KaiC subunits and spanning an ATP binding cleft. A KaiC mutation, R468C, which has been shown to affect the affinity of KaiB for KaiC and lengthen the period in a bioluminescence rhythm assay, is found within the middle of the predicted KaiBC interface. The proposed KaiB binding mode blocks access to the ATP binding cleft in the CII ring of KaiC, which provides insight into how KaiB might influence the phosphorylation status of KaiC.
Kai õpetab iseennast / Kai Kaljo ; intervjueerinud R[eet] V[arblane
Kaljo, Kai, 1959-
2011-01-01
Kai Kaljo isikunäitus "Kai õpetab iseennast" Hobusepea galeriis 2.-14. novembrini 2011. Kaks videot seostuvad Kai Kaljo õppejõutööga Tallinna Ülikoolis, ka kaasaegse kunsti professori ametist Tallinna Ülikooli kunstihariduse osakonnas. Näitusel osale külalisesinejana Austraalia kirjanik Luke Davies, näitusel oli tema lühifilm "Õhk"
Survey of Two New (Kai 1 and Kai 2) and Other Blood Groups in Dogs of North America.
Euler, C C; Lee, J H; Kim, H Y; Raj, K; Mizukami, K; Giger, U
2016-09-01
Based upon serology, >10 canine blood group systems have been reported. We surveyed dogs for dog erythrocyte antigen (DEA) 1 and 2 new blood types (Kai 1 and Kai 2), and some samples also were screened for Dal and DEA 3, 4, and 7. Blood samples provided by owners, breeders, animal blood banks, and clinical laboratories were typed for DEA 1 by an immunochromatographic strip technique with a monoclonal antibody and analysis of band intensity. Both new antigens, the Dal and other DEAs (except DEA 7 by tube method), were assessed by a gel column method with either monoclonal or polyclonal antibodies. The same gel column method was applied for alloantibody detection. Of 503 dogs typed, 59.6% were DEA 1+ with 4% weakly, 10% moderately, and 45.6% strongly DEA 1+. Regarding Kai 1 and Kai 2, 94% were Kai 1+/Kai 2-, 5% were Kai 1-/Kai 2- and 1% were Kai 1-/Kai 2+, but none were Kai 1+/Kai 2+. There was no relationship between Kai 1/Kai 2 and other blood types tested. Plasma from DEA 1-, Kai 1-, Kai 2- dogs, or some combination of these contained no detectable alloantibodies against DEA 1 and Kai 1 or Kai, respectively. The new blood types, called Kai 1 and Kai 2, are unrelated to DEA 1, 3, 4, and 7 and Dal. Kai 1+/Kai 2- dogs were most commonly found in North America. The clinical relevance of Kai 1 and Kai 2 in canine transfusion medicine still needs to be elucidated. Copyright © 2016 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.
Dimensionality of the UWES-17: An item response modelling analysis
Deon P. de Bruin; Carin Hill; Carolina M. Henn; Klaus-Peter Muller
2013-01-01
Orientation: Questionnaires, particularly the Utrecht Work Engagement Scale (UWES-17), are an almost standard method by which to measure work engagement. Conflicting evidence regarding the dimensionality of the UWES-17 has led to confusion regarding the interpretation of scores. Research purpose: The main focus of this study was to use the Rasch model to provide insight into the dimensionality of the UWES-17, and to assess whether work engagement should be interpreted as one single overall...
Differential item functioning of the UWES-17 in South Africa
Directory of Open Access Journals (Sweden)
Leanne Goliath-Yarde
2011-11-01
Research purpose: This study assesses the Differential Item Functioning (DIF of the Utrecht Work Engagement Scale (UWES-17 for different South African cultural groups in a South African company. Motivation for the study: Organisations are using the UWES-17 more and more in South Africa to assess work engagement. Therefore, research evidence from psychologists or assessment practitioners on its DIF across different cultural groups is necessary. Research design, approach and method: The researchers conducted a Secondary Data Analysis (SDA on the UWES-17 sample (n = 2429 that they obtained from a cross-sectional survey undertaken in a South African Information and Communication Technology (ICT sector company (n = 24 134. Quantitative item data on the UWES-17 scale enabled the authors to address the research question. Main findings: The researchers found uniform and/or non-uniform DIF on five of the vigour items, four of the dedication items and two of the absorption items. This also showed possible Differential Test Functioning (DTF on the vigour and dedication dimensions. Practical/managerial implications: Based on the DIF, the researchers suggested that organisations should not use the UWES-17 comparatively for different cultural groups or employment decisions in South Africa. Contribution/value add: The study provides evidence on DIF and possible DTF for the UWES-17. However, it also raises questions about possible interaction effects that need further investigation.
Factorial validity of the Utrecht Work Engagement Scale (UWES) across occupational groups in Norway.
Nerstad, Christina G L; Richardsen, Astrid M; Martinussen, Monica
2010-08-01
The present study investigated the factorial validity of the Utrecht Work Engagement Scale (UWES) among 1266 participants from ten different occupational groups. Confirmatory factor analyses of the total sample, as well as multi-group analyses and analyses of each of the ten occupational groups separately, indicated that a three-dimensional model of both the UWES-17 and the short version, UWES-9, provided a better fit to the data than a one- and two-dimensional model. The results of multi-group analyses and analyses of each of the groups separately, indicated that with a few exceptions, the three-factor model of work engagement provided the best fit. Results indicated factorial invariance and the internal consistencies were acceptable. The fit of the UWES-9 was slightly better than the UWES-17. It is concluded that the Norwegian short version may be recommended over the UWES-17.
Hoksbergen, F.T.J.
1985-01-01
Onderzoeksresultaten met jute matten op plantspiegels van pas geplante bomen om deze onkruidvrij te houden bleken gunstig te zijn, vooral op droogtegevoelige gronden en voor de boomsoorten eik en beuk
Work Engagement among Rescue Workers: Psychometric Properties of the Portuguese UWES.
Sinval, Jorge; Marques-Pinto, Alexandra; Queirós, Cristina; Marôco, João
2017-01-01
Rescue workers have a stressful and risky occupation where being engaged is crucial to face physical and emotional risks in order to help other persons. This study aims to estimate work engagement levels of rescue workers (namely comparing nurses, firefighters, and police officers) and to assess the validity evidence related to the internal structure of the Portuguese versions of the UWES-17 and UWES-9, namely, dimensionality, measurement invariance between occupational groups, and reliability of the scores. To evaluate the dimensionality, we compared the fit of the three-factor model with the fit of a second-order model. A Portuguese version of the instrument was applied to a convenience sample of 3,887 rescue workers (50% nurses, 39% firefighters, and 11% police officers). Work engagement levels were moderate to high, with firefighters being the highest and nurses being the lowest engaged. Psychometric properties were evaluated in the three-factor original structure revealing acceptable fit to the data in the UWES-17, although the UWES-9 had better psychometric properties. Given the observed statistically significant correlations between the three original factors, we proposed a 2 nd hierarchal structure that we named work engagement. The UWES-9 first-order model obtained full uniqueness measurement invariance, and the second-order model obtained partial (metric) second-order invariance.
An effective method to increase bandwidth of EIK at 0.34 THz
Li, Shuang; Wang, Guangqiang; Wang, Dongyang
2018-02-01
To increase the bandwidth of Extended Interaction Klystron (EIK) at 0.34 THz, the method of staggered tuning on cavities' configurations is proposed. Based on the analysis of phase relationship between gap voltage and the bunched beam, the buncher cavities in EIK are reasonably staggered-tuned to achieve various resonance frequencies, which is helpful to flat the gain response of the whole device. The characteristics of output cavities with different numbers of gaps are then researched and the issue of start current for the self-oscillation mode is also involved, leading to the optimum number of gaps to enhance the interaction and avoid the instability. By comparing the performances of various typical stagger-tuned models, the final configuration is accordingly confirmed. Particle-in-cell simulation is eventually applied to study performance of the optimised structure, whose gain is 34.8 dB in peak and -3 dB bandwidth reaches about 500 MHz, which is double that of the synchronous-tuned structure.
Directory of Open Access Journals (Sweden)
Ivana B. Petrović
2017-10-01
Full Text Available Work engagement is defined as a positive, affective-motivational state of work-related well-being characterized by vigor, dedication and absorption. The Utrecht Work Engagement Scale (UWES is the most frequently used measure of work engagement. The aim of this study was to analyze the psychometric properties of the Serbian versions of the UWES-17 and UWES-9. The sample consisted of 860 employees from a number of organizations and jobs across Serbia. Based on the UWES-17 findings, the data confirm both the three-factor and one-factor solutions by giving a slight advantage to the three-factor solution. As for the UWES-9, based on the PCFA and CFA, the one-factor solution was obtained as the preferred one. Taking into account the UWES-9 reliability and correlation patterns of its subscales with other well-being variables, both one- and three-factor solutions of the UWES-9 are suggested for future research. Serbian versions of both the UWES-17 and UWES-9 have satisfactory psychometric properties with high reliability, factorial structure in line with the theoretical model, and good predictive validity. The study contributes to enhanced understanding of work engagement by offering an insight from the Serbian cultural and economic context, significantly different from the UWES originating setting. There is still a need for exploring how employees from Serbia conceptualize work engagement, as well as for further, more stringent investigating of the cultural invariance of the UWES factorial structure.
Petrović, Ivana B; Vukelić, Milica; Čizmić, Svetlana
2017-01-01
Work engagement is defined as a positive, affective-motivational state of work-related well-being characterized by vigor, dedication and absorption. The Utrecht Work Engagement Scale (UWES) is the most frequently used measure of work engagement. The aim of this study was to analyze the psychometric properties of the Serbian versions of the UWES-17 and UWES-9. The sample consisted of 860 employees from a number of organizations and jobs across Serbia. Based on the UWES-17 findings, the data confirm both the three-factor and one-factor solutions by giving a slight advantage to the three-factor solution. As for the UWES-9, based on the PCFA and CFA, the one-factor solution was obtained as the preferred one. Taking into account the UWES-9 reliability and correlation patterns of its subscales with other well-being variables, both one- and three-factor solutions of the UWES-9 are suggested for future research. Serbian versions of both the UWES-17 and UWES-9 have satisfactory psychometric properties with high reliability, factorial structure in line with the theoretical model, and good predictive validity. The study contributes to enhanced understanding of work engagement by offering an insight from the Serbian cultural and economic context, significantly different from the UWES originating setting. There is still a need for exploring how employees from Serbia conceptualize work engagement, as well as for further, more stringent investigating of the cultural invariance of the UWES factorial structure.
Zhao, Jing; Wang, Ya Xing; Zhang, Qi; Wei, Wen Bin; Xu, Liang; Jonas, Jost B
2018-03-13
To study macular choroidal layer thickness, 3187 study participants from the population-based Beijing Eye Study underwent spectral-domain optical coherence tomography with enhanced depth imaging for thickness measurements of the macular small-vessel layer, including the choriocapillaris, medium-sized choroidal vessel layer (Sattler's layer) and large choroidal vessel layer (Haller's layer). In multivariate analysis, greater thickness of all three choroidal layers was associated (all P 0.05) associated with the prevalence of open-angle glaucoma or diabetic retinopathy. There was a tendency (0.07 > P > 0.02) toward thinner choroidal layers in chronic angle-closure glaucoma. The ratio of small-vessel layer thickness to total choroidal thickness increased (P layer and Haller's layer thickness to total choroidal thickness decreased. A higher ratio of small-vessel layer thickness to total choroidal thickness was significantly associated with a lower prevalence of AMD (early type, intermediate type, late geographic type). Axial elongation-associated and aging-associated choroidal thinning affected Haller's and Sattler's layers more markedly than the small-vessel layer. Non-exudative and exudative AMD, except for geographic atrophy, was associated with slightly increased choroidal thickness.
Work Engagement among Rescue Workers: Psychometric Properties of the Portuguese UWES
Sinval, Jorge; Marques-Pinto, Alexandra; Queirós, Cristina; Marôco, João
2018-01-01
Rescue workers have a stressful and risky occupation where being engaged is crucial to face physical and emotional risks in order to help other persons. This study aims to estimate work engagement levels of rescue workers (namely comparing nurses, firefighters, and police officers) and to assess the validity evidence related to the internal structure of the Portuguese versions of the UWES-17 and UWES-9, namely, dimensionality, measurement invariance between occupational groups, and reliability of the scores. To evaluate the dimensionality, we compared the fit of the three-factor model with the fit of a second-order model. A Portuguese version of the instrument was applied to a convenience sample of 3,887 rescue workers (50% nurses, 39% firefighters, and 11% police officers). Work engagement levels were moderate to high, with firefighters being the highest and nurses being the lowest engaged. Psychometric properties were evaluated in the three-factor original structure revealing acceptable fit to the data in the UWES-17, although the UWES-9 had better psychometric properties. Given the observed statistically significant correlations between the three original factors, we proposed a 2nd hierarchal structure that we named work engagement. The UWES-9 first-order model obtained full uniqueness measurement invariance, and the second-order model obtained partial (metric) second-order invariance. PMID:29403403
Work Engagement among Rescue Workers: Psychometric Properties of the Portuguese UWES
Directory of Open Access Journals (Sweden)
Jorge Sinval
2018-01-01
Full Text Available Rescue workers have a stressful and risky occupation where being engaged is crucial to face physical and emotional risks in order to help other persons. This study aims to estimate work engagement levels of rescue workers (namely comparing nurses, firefighters, and police officers and to assess the validity evidence related to the internal structure of the Portuguese versions of the UWES-17 and UWES-9, namely, dimensionality, measurement invariance between occupational groups, and reliability of the scores. To evaluate the dimensionality, we compared the fit of the three-factor model with the fit of a second-order model. A Portuguese version of the instrument was applied to a convenience sample of 3,887 rescue workers (50% nurses, 39% firefighters, and 11% police officers. Work engagement levels were moderate to high, with firefighters being the highest and nurses being the lowest engaged. Psychometric properties were evaluated in the three-factor original structure revealing acceptable fit to the data in the UWES-17, although the UWES-9 had better psychometric properties. Given the observed statistically significant correlations between the three original factors, we proposed a 2nd hierarchal structure that we named work engagement. The UWES-9 first-order model obtained full uniqueness measurement invariance, and the second-order model obtained partial (metric second-order invariance.
Dimensionality of the 9-item Utrecht Work Engagement Scale (UWES-9).
de Bruin, Gideon P; Henn, Carolina M
2013-06-01
Despite wide-spread use, questions remain about the dimensionality of the 9-item Utrecht Work Engagement Scale (UWES-9). Theoretical underpinnings of the UWES-9 point toward a hierarchical structure with a general factor and three group or primary factors: Dedication, Vigor, and Absorption. To date, researchers have failed to model the general factor, which contributes to the lack of consensus about the dimensionality of the scale. Bi-factor analysis was used to demonstrate the presence of a very strong general factor and, in comparison, two weak group factors. The results shed additional light on the meaning of the work engagement construct. The implications for research with the UWES-9 are discussed.
Validación de la escala UWES-9 en profesionales de la salud en México
Directory of Open Access Journals (Sweden)
Clara Ivette Hernández Vargas
2016-01-01
Full Text Available Objetivo. Examinar las propiedades psicométricas de la escala breve del engagement o entusiasmo laboral en el trabajo (UWES-9 en comparación con la escala original (UWES-15, en una muestra de profesionales de la salud en México. Método. Se aplicaron las escalas UWES-15 y UWES-9 a una muestra de 475 profesionales del sector salud de México, pertenecientes al Instituto Mexicano del Seguro Social (n = 249 y la Secretaría de Salud (n = 226. Resultados. Los resultados del análisis factorial confirmatorio multigrupo confirmaron la estructura trifactorial (vigor, dedicación y absorción de ambas escalas. Además, la UWES-9 mostró índices de ajuste significativamente mejores que los obtenidos en la versión larga, siendo la estructura invariante en ambas instituciones. Conclusión. Se confirma la validez de la medida breve de la escala UWES en profesionales de la salud mexicanos.
Dimensionality of the UWES-17: An item response modelling analysis
Directory of Open Access Journals (Sweden)
Deon P. de Bruin
2013-10-01
Research purpose: The main focus of this study was to use the Rasch model to provide insight into the dimensionality of the UWES-17, and to assess whether work engagement should be interpreted as one single overall score, three separate scores, or a combination. Motivation for the study: It is unclear whether a summative score is more representative of work engagement or whether scores are more meaningful when interpreted for each dimension separately. Previous work relied on confirmatory factor analysis; the potential of item response models has not been tapped. Research design: A quantitative cross-sectional survey design approach was used. Participants, 2429 employees of a South African Information and Communication Technology (ICT company, completed the UWES-17. Main findings: Findings indicate that work engagement should be treated as a unidimensional construct: individual scores should be interpreted in a summative manner, giving a single global score. Practical/managerial implications: Users of the UWES-17 may interpret a single, summative score for work engagement. Findings of this study should also contribute towards standardising UWES-17 scores, allowing meaningful comparisons to be made. Contribution/value-add: The findings will benefit researchers, organisational consultants and managers. Clarity on dimensionality and interpretation of work engagement will assist researchers in future studies. Managers and consultants will be able to make better-informed decisions when using work engagement data.
Validación de la escala UWES-9 en profesionales de la salud en México
Hernández Vargas, Clara Ivette; Llorens, Susana; Rodríguez Sánchez, Alma María; Dickinson Bannack, María Eloísa
2016-01-01
Objetivo. Examinar las propiedades psicométricas de la escala breve del engagement o entusiasmo laboral en el trabajo (UWES-9) en comparación con la escala original (UWES-15), en una muestra de profesionales de la salud en México. Método. Se aplicaron las escalas UWES-15 y UWES-9 a una muestra de 475 profesionales del sector salud de México, pertenecientes al Instituto Mexicano del Seguro Social (n = 249) y la Secretaría de Salud (n = 226). Resultados. Los resultados del análisis ...
Petrović, Ivana B.; Vukelić, Milica; Čizmić, Svetlana
2017-01-01
Work engagement is defined as a positive, affective-motivational state of work-related well-being characterized by vigor, dedication and absorption. The Utrecht Work Engagement Scale (UWES) is the most frequently used measure of work engagement. The aim of this study was to analyze the psychometric properties of the Serbian versions of the UWES-17 and UWES-9. The sample consisted of 860 employees from a number of organizations and jobs across Serbia. Based on the UWES-17 findings, the data co...
The KAI Cognitive Style Inventory: Was it personality all along?
Von Wittich, D.; Antonakis, J.
2011-01-01
Kirton's Adaption-Innovation Inventory (KAI) is a widely-used measure of "cognitive style." Surprisingly, there is very little research investigating the discriminant and incremental validity of the KAI. In two studies (n = 213), we examined whether (a) we could predict KAI scores with the "big five" personality dimensions and (b) the KAI scores predicted leadership behavior when controlling for personality and ability. Correcting for measurement error, we found that KAI scores were predicted...
Work engagement among rescue workers: psychometric properties of the portuguese UWES
Jorge Sinval; Alexandra Marques-Pinto; Cristina Queirós; João Marôco
2018-01-01
Rescue workers have a stressful and risky occupation where being engaged is crucial to face physical and emotional risks in order to help other persons. This study aims to estimate work engagement levels of rescue workers (namely comparing nurses, firefighters, and police officers) and to assess the validity evidence related to the internal structure of the Portuguese versions of the UWES-17 and UWES-9, namely, dimensionality, measurement invariance between occupational groups, and reliabilit...
Psychometric properties of the Russian version of the utrecht Work engagement scale (UWES-9
Directory of Open Access Journals (Sweden)
Lovakov Andrey V.
2017-03-01
Full Text Available This article aims to analyze the psychometric properties of the Russian version of the Utrecht Work Engagement Scale (UWES-9 by using a sample of 1783 employees of a large Russian organization. We conducted a series of Confirmatory Factor Analysis (CFA tests of the factorial structure and the configural, metric, scalar, factor variance, factor covariance, and factor means invariances of the model across gender and age groups. The validity of the Russian version of the UWES-9 was investigated by study- ing its relationship with burnout, job satisfaction, life satisfaction, and turnover inten- tion. The CFA showed that both the 1-factor and the 3-factor models of the UWES-9 fit well with the data, but the 3-factor model demonstrates a significantly better fit. however, the differences are minor; therefore, in practical terms, the models are iden- tical. Thus the Russian version of the UWES-9 can be used both as a three-scale mea- surement and as a single scale of work engagement. Results from the multi-group CFA provided evidence of factorial invariance of the 3-factor model across gender and age groups. Internal consistencies of the vigor, dedication, and absorption subscales are acceptable. The results also suggested the convergent, discriminant, and incremental validity of the UWES-9, as shown by its relationship with burnout, job satisfaction, life satisfaction, and turnover intention. The article also discusses the differences in levels of work engagement within different gender and age groups. Overall, the results show that the Russian version of the UWES-9 demonstrates acceptable psychometric properties comparable with the original version and those in other languages. The Russian version of the UWES-9 can therefore be recommended for use in research and practice.
Energy Technology Data Exchange (ETDEWEB)
Egli, Martin; Mori, Tetsuya; Pattanayek, Rekha; Xu, Yao; Qin, Ximing; Johnson, Carl H. (Vanderbilt)
2014-10-02
The circadian clock of the cyanobacterium Synechococcus elongatus can be reconstituted in vitro from three proteins, KaiA, KaiB, and KaiC in the presence of ATP, to tick in a temperature-compensated manner. KaiC, the central cog of this oscillator, forms a homohexamer with 12 ATP molecules bound between its N- and C-terminal domains and exhibits unusual properties. Both the N-terminal (CI) and C-terminal (CII) domains harbor ATPase activity, and the subunit interfaces between CII domains are the sites of autokinase and autophosphatase activities. Hydrolysis of ATP correlates with phosphorylation at threonine and serine sites across subunits in an orchestrated manner, such that first T432 and then S431 are phosphorylated, followed by dephosphorylation of these residues in the same order. Although structural work has provided insight into the mechanisms of ATPase and kinase, the location and mechanism of the phosphatase have remained enigmatic. From the available experimental data based on a range of approaches, including KaiC crystal structures and small-angle X-ray scattering models, metal ion dependence, site-directed mutagenesis (i.e., E318, the general base), and measurements of the associated clock periods, phosphorylation patterns, and dephosphorylation courses as well as a lack of sequence motifs in KaiC that are typically associated with known phosphatases, we hypothesized that KaiCII makes use of the same active site for phosphorylation and dephosphorlyation. We observed that wild-type KaiC (wt-KaiC) exhibits an ATP synthase activity that is significantly reduced in the T432A/S431A mutant. We interpret the first observation as evidence that KaiCII is a phosphotransferase instead of a phosphatase and the second that the enzyme is capable of generating ATP, both from ADP and P{sub i} (in a reversal of the ATPase reaction) and from ADP and P-T432/P-S431 (dephosphorylation). This new concept regarding the mechanism of dephosphorylation is also supported by the
ADP Regulates the Structure and Function of the Protein KaiC
2016-08-11
LiWang lab exploited this in vitro clock system to gain an atomic -resolution understanding of a circadian clock. The rationale is that fundamental...researchers are Hispanic. On a peer-reviewed research article from the LiWang lab, a Hispanic undergraduate student was an author, as were two non...Using both NMR and fluorescence spectroscopy , the LiWang lab showed that KaiA enhances KaiB-KaiC binding, and KaiC enhances KaiA-KaiB binding (Tseng et
Eugene O'Neill "Pikk päevatee kaob öösse" / Ellu Eik ; interv. Ene Paaver
Eik, Ellu
2008-01-01
Seoses Eesti Draamateatri suvelavastusega "Pikk päevatee kaob öösse" (autor Eugene O'Neill ja lavastaja Merle Karusoo) räägib Lääne-Tallinna Keskhaigla Sõltuvusravikeskuse psühhiaater Ellu Eik sõltuvuse tagamaadest ja mõjudest
Directory of Open Access Journals (Sweden)
Nelson Ramalho
2017-09-01
Full Text Available Objective: The present study aims to evaluate the items, and respective dimensions, of the Utrecht Work Engagement Scale (UWES-17 of Schaufeli e Bakker (2009, when applied to social workers exercising their profession in Portugal (UWES-17. Method: The Portuguese version of the UWES was applied to a sample of 1369 Portuguese social workers, 94% of which female and 6% male, with an average age of 39 years (standard deviation = 8,99. The most frequent academic qualification is graduation (63,8% and in terms of professional activity they had, in average terms, 12,99 years of experience (standard deviation = 8,28. The reliability of the scale was assessed using the Chronbach alpha coefficient and the validity using the exploratory factorial analysis. Quantitative methodological research was used. Results: The results obtained agree with the values presented in previous studies regarding their internal consistency, both of the 17 items that make up the scale and of its three dimensions ("force", "dedication" and "absorption". The UWES-17 in this study presents a factorial structure of three factors, just like the original study, but the constitution of the items of each dimension is different. The UWES-17 scale presents good psychometric characteristics and good internal consistency. Conclusions: The UWES-17 scale presents good psychometric characteristics and good internal consistency.
Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.
Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H
2002-12-24
KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.
Loza-Correa, Maria; Sahr, Tobias; Rolando, Monica; Daniels, Craig; Petit, Pierre; Skarina, Tania; Valero, Laura Gomez; Dervins-Ravault, Delphine; Honoré, Nadine; Savchenko, Aleksey; Buchrieser, Carmen
2014-01-01
Summary Legionella pneumophila uses aquatic protozoa as replication niche and protection from harsh environments. Although L. pneumophila is not known to have a circadian clock, it encodes homologues of the KaiBC proteins of Cyanobacteria that regulate circadian gene expression. We show that L. pneumophila kaiB, kaiC and the downstream gene lpp1114, are transcribed as a unit under the control of the stress sigma factor RpoS. KaiC and KaiB of L. pneumophila do not interact as evidenced by yeast and bacterial two-hybrid analyses. Fusion of the C-terminal residues of cyanobacterial KaiB to Legionella KaiB restores their interaction. In contrast, KaiC of L. pneumophila conserved autophosphorylation activity, but KaiB does not trigger the dephosphorylation of KaiC like in Cyanobacteria. The crystal structure of L. pneumophila KaiB suggests that it is an oxidoreductase-like protein with a typical thioredoxin fold. Indeed, mutant analyses revealed that the kai operon-encoded proteins increase fitness of L. pneumophila in competitive environments, and confer higher resistance to oxidative and sodium stress. The phylogenetic analysis indicates that L. pneumophila KaiBC resemble Synechosystis KaiC2B2 and not circadian KaiB1C1. Thus, the L. pneumophila Kai proteins do not encode a circadian clock, but enhance stress resistance and adaption to changes in the environments. PMID:23957615
Kai Kaljo: "Aeg-ajalt tuleb ennast peeglist vaadata" / Kai Kaljo ; intervjueerinud Reet Varblane
Kaljo, Kai, 1959-
2009-01-01
Videokunstnik Kai Kaljo oma isikunäitusest "Ainult eestlastele" Tallinna Kunstihoone galeriis, maalikunstisti tähendusest talle, kunstiteostest, mis on teda mõjutanud, Tallinnasse püstitatud Vabadussõja võidusambast
Lühiajaline. Suuremõõtmeline / Indrek Grigor
Grigor, Indrek
2010-01-01
3. septembril 2010 avati Eesti Rahva Muuseumi Raadi mõisapargis skulptuurinäitus töödest, mis valmisid rahvusvahelise skulptuurisümpoosioni "Lühiajaline. Suuremõõtmeline" (25. 08.-03. 09. 2010) käigus ja mis jäävad parki aastaks. Sümpoosioni peakorraldajad: Jevgeni Zolotko ja Bruno Kadak, osalesid: Uwe Schloen (Saksamaa), Csilla Nagy (Ungari), Gleb Netšvolodov (Inglismaa), Ahti Seppet, Eike Eplik ja Jevgeni Zolotko (Eesti)
Eesti disaini uudised / Kai Lobjakas
Lobjakas, Kai, 1975-
2005-01-01
Toivo Raidmetsa isiknäitus "Barokist dadani" Rotermanni soolalaos, tekstiilikunstnik Helena Palmi ehted. Disainitudeng Liina-Kai Raivet sai teise koha Itaalias keraamiliste plaatide konkursil "Marchitecture"
DA Masolo A Review of Kai Kresse's Philosophising in Mombasa ...
African Journals Online (AJOL)
DA Masolo
Kai Kresse's Philosophising in Mombasa: Knowledge, Islam and Intellectual Practice on the Swahili Coast 1. A Review of Kai ... (Edinburgh: Edinburgh University Press, 2007, for the. International African Institute, London, in collaboration with.
Intervjuu Kai Vöckleriga = Interview with Kai Vöckler / intervjueerinud Triin Ojaste
Vöckler, Kai
2011-01-01
Lääne-Saksamaal sündinud urbanist, urbanistikaga tegeleva organisatsiooni Archis Interventions'i üks asutaja Kai Vöckler endast, Archis Interventions'i tegevusest, Ida-Euroopast, Balkanist, uuest arhitektuurist ja linnaehitusest, uue vabaduse antud võimalustest ja selle mõiste mitmetähenduslikkusest
Hea kultuuriantropoloog peab olema empaatiline / Kai Herkel ; intervjueerinud Reet Varblane
Herkel, Kai, 1963-
2009-01-01
Kai Herkeli Tiibeti-teemalisest näitusest "Himaalaja lapsed" Tallinna Linnagaleriis. Eksponeeritud fotod ja videod. Kai Herkel teeb Helsingi ülikooli sotsiaal- ja kultuuriantropoloogia erialal magistritööd lapsmunkade elust, oma kunstiprojektis on ta keskendunud Lamayuru kloostrikoolis õppivatele lapsmunkadele
Kai Kaljo video-workshopil Ljubljanas
2000-01-01
Video-workshop "Crossing Over 4" 9.-23. XII 1999 Ljubljana meedialaboris. Korraldajad videokunsti professor Nina Czegledy Torontost ja bulgaaria kuraator Iliyana Nedkova. Eestit esindanud Kai Kaljo esitas videos "Pathetique" oma versiooni Beethoveni "Pateetilisest sonaadist"
Guillén, Félix; Universidad de Las Palmas de Gran Canaria; Martínez-Alvarado, Julio Román; Universidad Autónoma de Baja California
2014-01-01
. The Utrecht Work Engagement Scale (UWES) is an instrument designed by Schaufeli y Bakker (2003) to measure engagement in the work context. The purpose of the present study is to adapt the UWES to the sports context. The sample consists of 240 national third division Spanish football players between the ages of 15 and 38. The UWES factor structure has been analyzed through exploratory and confirmatory factor analyses. The results reveal a three-factor structure of the scale (vigor, absorp...
Cisplatin Induces Up-Regulation of KAI1, a Metastasis Suppressor ...
African Journals Online (AJOL)
Purpose: To investigate the effect of cisplatin on cell toxicity and metastasis through modulation of KAI1 gene expression. Methods: MCF-7cells were incubated with different concentrations of cisplatin for 24 h. RNA was extracted by trizol and cDNA synthesized. KAI1 and TBP were chosen as target and internal control ...
Pisanti, R; Paplomatas, A; Bertini, M
2008-01-01
Engagement is defined as a positive, fulfilling, work-related state of mind that is characterized by vigor, dedication, and absorption. The main purpose of this study was to examine the psychometric properties of the Utrecht Work Engagement Scale (UWES). Data from a sample of health care workers (N=948) were used to test four propositions concerning dimensionality, internal consistency and construct validity. The UWES Italian version and the Multidimensional Organizational Health Questionnaire (MOHQ) were administered to the subjects (a subsample of 225 health care workers also completed the Maslach Burnout Inventory). The factorial structure has been examined through a series of Explorative Factor Analysis (AFE) and Confirmatory Factor Analysis (CFA). As in the original version, we found a three factor solution. Internal consistency indexes were satisfactory. In addition, the correlations between UWES, MOHQ and MBI revealed a good construct validity. It is concluded that the Italian Version of the UWES has acceptable psychometric properties and that the instrument can be used in studies on positive organizational behavior.
The structure of the karrikin-insensitive protein (KAI2) in Arabidopsis thaliana.
Bythell-Douglas, Rohan; Waters, Mark T; Scaffidi, Adrian; Flematti, Gavin R; Smith, Steven M; Bond, Charles S
2013-01-01
KARRIKIN INSENSITIVE 2 (KAI2) is an α/β hydrolase involved in seed germination and seedling development. It is essential for plant responses to karrikins, a class of butenolide compounds derived from burnt plant material that are structurally similar to strigolactone plant hormones. The mechanistic basis for the function of KAI2 in plant development remains unclear. We have determined the crystal structure of Arabidopsis thaliana KAI2 in space groups P2(1) 2(1) 2(1) (a =63.57 Å, b =66.26 Å, c =78.25 Å) and P2(1) (a =50.20 Å, b =56.04 Å, c =52.43 Å, β =116.12°) to 1.55 and 2.11 Å respectively. The catalytic residues are positioned within a large hydrophobic pocket similar to that of DAD2, a protein required for strigolactone response in Petunia hybrida. KAI2 possesses a second solvent-accessible pocket, adjacent to the active site cavity, which offers the possibility of allosteric regulation. The structure of KAI2 is consistent with its designation as a serine hydrolase, as well as previous data implicating the protein in karrikin and strigolactone signalling.
The structure of the karrikin-insensitive protein (KAI2 in Arabidopsis thaliana.
Directory of Open Access Journals (Sweden)
Rohan Bythell-Douglas
Full Text Available KARRIKIN INSENSITIVE 2 (KAI2 is an α/β hydrolase involved in seed germination and seedling development. It is essential for plant responses to karrikins, a class of butenolide compounds derived from burnt plant material that are structurally similar to strigolactone plant hormones. The mechanistic basis for the function of KAI2 in plant development remains unclear. We have determined the crystal structure of Arabidopsis thaliana KAI2 in space groups P2(1 2(1 2(1 (a =63.57 Å, b =66.26 Å, c =78.25 Å and P2(1 (a =50.20 Å, b =56.04 Å, c =52.43 Å, β =116.12° to 1.55 and 2.11 Å respectively. The catalytic residues are positioned within a large hydrophobic pocket similar to that of DAD2, a protein required for strigolactone response in Petunia hybrida. KAI2 possesses a second solvent-accessible pocket, adjacent to the active site cavity, which offers the possibility of allosteric regulation. The structure of KAI2 is consistent with its designation as a serine hydrolase, as well as previous data implicating the protein in karrikin and strigolactone signalling.
2000-01-01
Kai Kaljo esinemisest kuraator Hans Knolli näitusel "Communication...", New Yorgis Branka Stipancici kureeritud näitusel "Chinese whispers", Lõuna-Koreas Tom van Vliet kureeritud VI Pusani rahvusvahelisel kaasaegse kunsti festivalil, "World Wide Video" festivalil Amsterdamis
Expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder.
Ai, Xing; Zhang, Xu; Wu, Zhun; Ma, Xin; Ju, Zhenghua; Wang, Baojun; Shi, Taoping
2007-02-01
The expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder (TCCB) and its clinical significance were investigated. Immunohistochemistry was used to detect KAI1/CD82 and MRP-1/CD9 protein expression in 52 TCCB specimens. Correlation between the expression of KAI1/CD82 and MRP-1/CD9 to clinicopathologic factors was statistically analyzed. The results showed that the positive rate of KAI1/CD82 and MRP-1/CD9 in TCCB was 50% and 61.5%, respectively. The MRP-1/CD9 and KAI1/CD82 expression was significantly associated with grade of TCCB (PMRP-1/CD9 or KAI1/CD82 expression and clinical stage of TCCB (P>0.05). The expression level of MRP-1/CD9 and KAI1/CD82 in recurrent TCCB samples was lower than that in non-recurrent samples (PMRP-1/CD9 expression was statistically significant (r=0.316, PMRP-1/CD9 expression may be important prognostic indicators and potentially useful for assessing the biological behavior of TCCB.
Boats in fields. Uwe Janson's Peer Gynt (2006
Directory of Open Access Journals (Sweden)
Tanya Thresher
2015-02-01
Full Text Available This article analyses Uwe Janson’s 2006 TV-film adaptation of Peer Gynt. This 81-minute-long film was shot on the island of Usedom in the Baltic Sea and makes extensive use of the landscape in its investigation of identity. The article examines the effects of limiting the geographical space of Peer’s journey of self-discovery and pays particular attention to the symbolic use of boats. It also explores how Janson mirrors the self-reflexivity of Ibsen’s work and maintains the romantic/anti-romantic dichotomy evident in the poetic text.
Kais-Vesik said ebameeldiva vastase / Andres Kalvik
Kalvik, Andres, 1982-
2007-01-01
Stavangeris Suure Slämmi alagrupis kolmanda koha saanud ning koha 24 parema seas taganud Kristjan Kais ja Rivo Vesik lähevad play-off'i avaringis vastamisi Saksamaa duoga Mischa Urbatzka - Jonas Reckermann
Directory of Open Access Journals (Sweden)
Ralph Müller Gilchrist
2013-12-01
Full Text Available RESUMEN: Con la finalidad de aportar evidencias de validez y confiabilidad de los instrumentos para evaluar calidad de vida laboral, el presente estudio evalúa la estructura factorial y la confiabilidad de la escala UWES-17 que mide Engagement o compromiso laboral. Se encuestó a 165 trabajadores de la salud chilenos, de distintas disciplinas sanitarias y calidad contractual, siendo la mayoría mujeres (70.30% y profesionales no médicos (27.88%. A través de un Análisis Factorial Exploratorio, se identificó dos factores: Involucramiento con el trabajo y Entusiasmo por el trabajo, evidenciando confiabilidad suficiente. El estudio evidencia que la escala UWES-17, considerando la estructura factorial antes mencionada, presenta adecuadas propiedades psicométricas para ser utilizadas en trabajadores sanitarios chilenos, lo que apoya su uso para investigar este fenómeno laboral. ABSTRACT: In order to provide evidence of validity and reliability of the instruments to evaluate the quality of working life, this study assesses the factorial structure and the reliability of the UWES-17 scale, measuring Engagement or employment commitment. A group of 165 Chilean Health workers were surveyed from various health disciplines and contract quality, the majority being women (70.30% and non-medical professionals (27.88%. Through a Factorial Exploratory Analysis, we identified two factors: involvement with work and enthusiasm for work, demonstrating sufficient reliability. The study shows that the UWES-17 scale, considering the factorial structure referred to above, presents appropriate psychometric properties to be used in Chilean health workers, which supports its use to investigate this laboral phenomenon.
Sinval, Jorge; Pasian, Sonia; Queirós, Cristina; Marôco, João
2018-01-01
The aim of this paper is to present a revision of international versions of the Utrecht Work Engagement Scale and to describe the psychometric properties of a Portuguese version of the UWES-9 developed simultaneously for Brazil and Portugal, the validity evidence related with the internal structure, namely, Dimensionality, measurement invariance between Brazil and Portugal, and Reliability of the scores. This is the first UWES version developed simultaneously for both countries, and it is an important instrument for understanding employees' work engagement in the organizations, allowing human resources departments to better use workforces, especially when they are migrants. A total of 524 Brazilian workers and 522 Portuguese workers participated in the study. Confirmatory Factor Analysis, group comparisons, and Reliability estimates were used. The use of workers who were primarily professionals or administrative support, according to ISCO-08, reinforced the need to collect data on other professional occupations. Confirmatory factor analysis showed acceptable fit for the UWES-9 original three-factor solution, and a second-order factor structure has been proposed that presented an acceptable fit. Full-scale invariance was obtained between the Portuguese and Brazilian samples, both for the original three-factor first-order and second-order models. Data revealed that Portuguese and Brazilian workers didn't show statistically significant differences in the work engagement dimensions. This version allows for direct comparisons of means and, consequently, for performance of comparative and cross-cultural studies between these two countries.
Directory of Open Access Journals (Sweden)
Jorge Sinval
2018-03-01
Full Text Available The aim of this paper is to present a revision of international versions of the Utrecht Work Engagement Scale and to describe the psychometric properties of a Portuguese version of the UWES-9 developed simultaneously for Brazil and Portugal, the validity evidence related with the internal structure, namely, Dimensionality, measurement invariance between Brazil and Portugal, and Reliability of the scores. This is the first UWES version developed simultaneously for both countries, and it is an important instrument for understanding employees' work engagement in the organizations, allowing human resources departments to better use workforces, especially when they are migrants. A total of 524 Brazilian workers and 522 Portuguese workers participated in the study. Confirmatory Factor Analysis, group comparisons, and Reliability estimates were used. The use of workers who were primarily professionals or administrative support, according to ISCO-08, reinforced the need to collect data on other professional occupations. Confirmatory factor analysis showed acceptable fit for the UWES-9 original three-factor solution, and a second-order factor structure has been proposed that presented an acceptable fit. Full-scale invariance was obtained between the Portuguese and Brazilian samples, both for the original three-factor first-order and second-order models. Data revealed that Portuguese and Brazilian workers didn't show statistically significant differences in the work engagement dimensions. This version allows for direct comparisons of means and, consequently, for performance of comparative and cross-cultural studies between these two countries.
Directory of Open Access Journals (Sweden)
Park Jung-Jin
2012-03-01
Full Text Available Abstract Background KAI1 was initially identified as a metastasis-suppressor gene in prostate cancer. It is a member of the tetraspan transmembrane superfamily (TM4SF of membrane glycoproteins. As part of a tetraspanin-enriched microdomain (TEM, KAI1 inhibits tumor metastasis by negative regulation of Src. However, the underlying regulatory mechanism has not yet been fully elucidated. CUB-domain-containing protein 1 (CDCP1, which was previously known as tetraspanin-interacting protein in TEM, promoted metastasis via enhancement of Src activity. To better understand how KAI1 is involved in the negative regulation of Src, we here examined the function of KAI1 in CDCP1-mediated Src kinase activation and the consequences of this process, focusing on HIF-1 α and VEGF expression. Methods We used the human prostate cancer cell line PC3 which was devoid of KAI1 expression. Vector-transfected cells (PC3-GFP clone #8 and KAI1-expressing PC3 clones (PC3-KAI1 clone #5 and #6 were picked after stable transfection with KAI1 cDNA and selection in 800 μg/ml G418. Protein levels were assessed by immunoblotting and VEGF reporter gene activity was measured by assaying luciferase activitiy. We followed tumor growth in vivo and immunohistochemistry was performed for detection of HIF-1, CDCP1, and VHL protein level. Results We demonstrated that Hypoxia-inducible factor 1α (HIF-1α and VEGF expression were significantly inhibited by restoration of KAI1 in PC3 cells. In response to KAI1 expression, CDCP1-enhanced Src activation was down-regulated and the level of von Hippel-Lindau (VHL protein was significantly increased. In an in vivo xenograft model, KAI1 inhibited the expression of CDCP1 and HIF-1α. Conclusions These novel observations may indicate that KAI1 exerts profound metastasis-suppressor activity in the tumor malignancy process via inhibition of CDCP1-mediated Src activation, followed by VHL-induced HIF-1α degradation and, ultimately, decreased VEGF
Pühendumusuuringute tegemine pole levinud / Kai Vare
Vare, Kai, 1968-
2004-01-01
Reval Hotelligrupp AS-is ja Saku Õlletehases läbi viidud töötajate rahulolu-uuringutest. Kommenteerivad Mari-Liis Eensalu, Kai Prinits ja Tiiu Vilms. Vt. samas: Narva Elektrivõrkudes töötavad Euroopa pühendunuimad inimesed
International Nuclear Information System (INIS)
Ruseva, Zlatna; Geiger, Pamina Xenia Charlotte; Hutzler, Peter; Kotzsch, Matthias; Luber, Birgit; Schmitt, Manfred; Gross, Eva; Reuning, Ute
2009-01-01
The tetraspanin KAI1 had been described as a metastasis suppressor in many different cancer types, a function for which associations of KAI1 with adhesion and signaling receptors of the integrin superfamily likely play a role. In ovarian cancer, integrin αvβ3 correlates with tumor progression and its elevation in vitro provoked enhanced cell adhesion accompanied by significant increases in cell motility and proliferation in the presence of its major ligand vitronectin. In the present study, we characterized integrin αvβ3-mediated tumor biological effects as a function of cellular KAI1 restoration and proved for the first time that KAI1, besides its already known physical crosstalk with β1-integrins, also colocalizes with integrin αvβ3. Functionally, elevated KAI1 levels drastically increased integrin αvβ3/vitronectin-dependent ovarian cancer cell adhesion. Since an intermediate level of cell adhesive strength is required for optimal cell migration, we next studied ovarian cancer cell motility as a function of KAI1 restoration. By time lapse video microscopy, we found impaired integrin αvβ3/vitronectin-mediated cell migration most probably due to strongly enhanced cellular immobilization onto the adhesion-supporting matrix. Moreover, KAI1 reexpression significantly diminished cell proliferation. These data strongly indicate that KAI1 may suppress ovarian cancer progression by inhibiting integrin αvβ3/vitronectin-provoked tumor cell motility and proliferation as important hallmarks of the oncogenic process.
International Nuclear Information System (INIS)
Wu, Chun-Yan; Yan, Jun; Yang, Yue-Feng; Xiao, Feng-Jun; Li, Qing-Fang; Zhang, Qun-Wei; Wang, Li-Sheng; Guo, Xiao-Zhong; Wang, Hua
2011-01-01
Research highlights: → We first investigate the effects of KAI1 on autophagy in MiaPaCa-2 cells. → Our findings demonstrate that KAI1 induces autophagy, which in turn inhibits KAI1-induced apoptosis. → This study also supplies a possible novel therapeutic method for the treatment of pancreatic cancer using autophagy inhibitors. -- Abstract: KAI1, a metastasis-suppressor gene belonging to the tetraspanin family, is known to inhibit cancer metastasis without affecting the primary tumorigenicity by inhibiting the epidermal growth factor (EGF) signaling pathway. Recent studies have shown that hypoxic conditions of solid tumors induce high-level autophagy and KAI1 expression. However, the relationship between autophagy and KAI1 remains unclear. By using transmission electron microscopy, confocal microscopy, and Western blotting, we found that KAI1 can induce autophagy in a dose- and time-dependent manner in the human pancreatic cell line MiaPaCa-2. KAI1-induced autophagy was confirmed by the expression of autophagy-related proteins LC3 and Beclin 1. KAI1 induces autophagy through phosphorylation of extracellular signal-related kinases rather than that of AKT. KAI1-induced autophagy protects MiaPaCa-2 cells from apoptosis and proliferation inhibition partially through the downregulation of poly [adenosine diphosphate (ADP)-ribose] polymerase (PARP) cleavage and caspase-3 activation.
Psychometric properties of the Russian version of the Utrecht work engagement scale (UWES-9)
Lovakov, Andrey V.; Agadullina, Elena R.; Schaufeli, Wilmar B.
2017-01-01
This article aims to analyze the psychometric properties of the Russian version of the Utrecht Work Engagement Scale (UWES-9) by using a sample of 1783 employees of a large Russian organization. We conducted a series of Confirmatory Factor Analysis (CFA) tests of the factorial structure and the
[Liivimaa valgustaja August Wilhelm Hupel 1737- 1819] / Kai Reemann
Reemann, Kai
2010-01-01
Eesti Looduseuurijate Selts raamatukogu juhataja Kai Reemann tutvustab nii raamatukogu kui ka 2004. aastal parimaks ajalooraamatuks tunnistatud teost "Liivimaa valgustaja August Wilhelm Hupel 1737- 1819" (Tallinn, 2004)
O tempora, o mores! / Maria-Kristiina Lotman, Kai Tafenau
Lotman, Maria-Kristiina, 1974-
2011-01-01
Tutvustus: Sallustius. Catilina vandenõu / Gaius Sallustius Crispus ; ladina keelest tõlkinud Maria-Kristiina Lotman ja Kai Tafenau. Tallinn : Tallinna Ülikooli Kirjastus, 2011. (Bibliotheca antiqua (Tallinna Ülikool))
Directory of Open Access Journals (Sweden)
Na Wang
2017-01-01
Full Text Available Kai Xin San is a Chinese herbal formula composed of Radix Ginseng , Poria , Radix Polygalae and Acorus Tatarinowii Rhizome . It has been used in China for many years for treating amnesia. Kai Xin San ameliorates amyloid-β (Aβ-induced cognitive dysfunction and is neuroprotective in vivo , but its precise mechanism remains unclear. Expression of insulin-degrading enzyme (IDE, which degrades Aβ, is strongly correlated with cognitive function. Here, we injected rats with exogenous Aβ42 (200 μM, 5 μL into the hippocampus and subsequently administered Kai Xin San (0.54 or 1.08 g/kg/d intragastrically for 21 consecutive days. Hematoxylin-eosin and Nissl staining revealed that Kai Xin San protected neurons against Aβ-induced damage. Furthermore, enzyme-linked immunosorbent assay, western blot and polymerase chain reaction results showed that Kai Xin San decreased Aβ42 protein levels and increased expression of IDE protein, but not mRNA, in the hippocampus. Our findings reveal that Kai Xin San facilitates hippocampal Aβ degradation and increases IDE expression, which leads, at least in part, to the alleviation of hippocampal neuron injury in rats.
Internationality meets locality - ART IST KUKU NU UT festival in Tartu / Tanel Rander
Rander, Tanel, 1980-
2012-01-01
Kunstifestivalist ART IST KUKU NU UT. Näitusest "Möh? Fui! Öäk! Ossa! Vau! Eesti kaasaegse kunsti klassika" (06.09.-18.11.2012) Tartu Kunstimuuseumis. Festivali projektijuht Kaisa Eiche, kunstiline juht ja näituse kuraator Rael Artel. Näitusel osalesid Jaan Toomik, Raul Meel, Kai Kaljo, Johnson & Johnson, Anna-Stina Treumund ja Flo Kasearu. Chris Fitzpatrick'u kureeritud näitusest "Sõida tasa üle silla" (07.-30.09.2012) galeriis Noorus. Kuku Nunnu stipendiaadi Eike Epliku isikunäitusest "Tüdruk, kes kõike arnastas" (07.09.-28.10.2012) Y-galeriis
Muusikud on koolitatud palgamõrvareiks / Kai Kallastu ; interv. Karol Kallas
Kallastu, Kai, 1970-
2007-01-01
Lauljanna oma eelseisvast esietendusest : Pärnu mudaravilas esietendub täna Sven Kivisildniku audiovisuaalne ooperietendus "Topeltwagner juustuga", teostajaks lavastuse meeskond REPOO ENSEMBLE (Kivisildnik, Andrus ja Kai Kallastu, Indrek ja Leonora Palu, Rein Laos)
Evidências adicionais de validade da UWES-9 em amostras brasileiras
Ferreira, Maria Cristina; Valentini, Felipe; Damásio, Bruno Figueiredo; Mourão, Luciana; Porto, Juliana Barreiros; Chinelato, Renata Silva de Carvalho; Novaes, Vladimir Pinto; Pereira, Michelle Morelo
2016-01-01
Resumo O engajamento no trabalho consiste em um estado motivacional positivo manifesto em sentimentos de vigor, absorção e dedicação ao trabalho. Para avaliá-lo, foi desenvolvida a Escala de Engajamento no Trabalho de Utrecht. O presente trabalho reuniu evidências de validade da versão reduzida da escala (UWES-9) por meio de análises de estrutura interna, de invariância por gênero e setor de trabalho (público ou privado), e de relações com variáveis externas. A amostra foi composta por 2.897 ...
Hotelli Radisson SAS mantra : jah, ma saan! / Kai Vare
Vare, Kai, 1968-
2004-01-01
Radisson SAS hotell Tallinnas on kliendirahulolu-uuringute järgi keti hotellide seas esimeste hulgas. Hotelli direktor Kaido Ojaperv ja müügijuht Ann-Kai Tõrs Radisson SAS-i standarditest, kliendi sajaprotsendilise rahulolu tagamise põhimõtetest, personali valikust, koolitusest. Kommenteerib Sandra Dimitrovich
Predictability of the individual clinical outcome of extracorporeal shock wave therapy for cellulite
Schlaudraff, Kai-Uwe; Kiessling, Maren C; Császár, Nikolaus BM; Schmitz, Christoph
2014-01-01
Kai-Uwe Schlaudraff,1 Maren C Kiessling,2 Nikolaus BM Császár,2 Christoph Schmitz21Concept Clinic, Geneva, Switzerland; 2Department of Anatomy II, Ludwig-Maximilians-University of Munich, Munich, GermanyBackground: Extracorporeal shock wave therapy has been successfully introduced for the treatment of cellulite in recent years. However, it is still unknown whether the individual clinical outcome of cellulite treatment with extracorporeal shock wave therapy can be predict...
Una Herramienta para el Análisis de la Colaboración Diseñada con UWE
Directory of Open Access Journals (Sweden)
Ofelia Uicab Aldana
2017-01-01
Full Text Available UML Web Engineering (UWE es uno de los métodos en Ingeniería Web para el diseño de aplicaciones que se desarrollan para la World Wide Web; utiliza la simbología estándar del Lenguaje de Modelado Unificado, así como simbología propia para desarrollo orientado a la Web. En este trabajo se presenta el diseño de una aplicación Web desarrollada como herramienta de apoyo para analizar la interacción (HAI de estudiantes en su proceso de aprendizaje, donde el modelado básico se realiza mediante UWE. Dicha aplicación recupera el registro de publicaciones que realizan los estudiantes en el muro grupal de Facebook y aplica un modelo diseñado para el análisis de la colaboración con el fin de identificar las habilidades colaborativas de cada uno de los estudiantes.
Videoinstallatsiooni aeg pole ümber : muljeid Amsterdami videofestivalilt / Kai Kaljo
Kaljo, Kai, 1959-
1999-01-01
17. World Wide Video Festival 15.-20. IX Amsterdamis Melkwegi keskuses ja Stedelijki muuseumis. Väljapanekust. Kai Kaljolt oli videofestivalil väljas 'One Way to See America'. Seminaride materjalid: wwvf@wwvf.demon ja www.wwvf.nl
Cisplatin Induces Up-Regulation of KAI1, a Metastasis Suppressor ...
African Journals Online (AJOL)
HP
including breast, testicular, ovarian, cervical, prostate, head and neck, ..... Vertebral bone metastasis in breast cancer: a case report. Rom J Morphol Embryol 2011; 52: 897-. 905. ... KAI1/CD82 on the β1 integrin maturation in highly migratory ...
Directory of Open Access Journals (Sweden)
Alexandra Henteleff
2018-03-01
Full Text Available Introduction: HANS KAI is a unique health promotion intervention to improve participants’ health by focussing on interrelated chronic disease prevention behaviours through peer support and strengthening of social support networks. The study objective was to determine the effectiveness of HANS KAI in an urban Canadian setting. Methods: We used a mixed methods intervention research design that involved multiple sites from November 2010 to April 2015. Data was obtained from participant surveys as well as in-person interviews at zero, 6, 12 and 24 months. Participants met in groups at least once a month during the research period, to self-monitor health indicators, prepare and share a healthy snack, participate in a physical activity, set a healthy lifestyle goal (optional and socialize. Results: There were statistically significant mental health improvements from pre- to post-program, and 66% of the participants described specific behaviour changes as a result of HANS KAI participation. Additional positive health impacts included peer support; acquiring specific health knowledge; inspiration, motivation or accountability; the empowering effect of monitoring one’s own health indicators; overcoming social isolation and knowing how to better access services. Conclusion: The need to identify innovative ways to address chronic disease prevention and management has been the driver for implementing and evaluating HANS KAI. While further research will be required to validate the present findings, it appears that HANS KAI may be an effective approach to create environments that empower community members to support each other while promoting healthy lifestyle choices and detecting early changes in health status.
Kai Kaljo : Autsaiderist staar = Star Outsider / Mari Laaniste
Laaniste, Mari, 1977-
2007-01-01
Vitraaži õppinud Kai Kaljost kui tänapäevasest installatsioonikunstnikust, kelle loomingut iseloomustab irooniline lähenemine eksistentsiaalsetele teemadele ja kes kodumaal on pikka aega "mittesoovitud" olnud. Maailmavaatlemise ja hetketabamise kõrval on tal hinge peal ka kunsti positsioon ühiskonnas ja ühiskonna suhtumine kunstnikku, ta on varmas osutama ümbritseva maailma vildakatele väärtushinnangutele ja eetilisele ambivalentsusele
Sautier, L P; Scherwath, A; Weis, J; Sarkar, S; Bosbach, M; Schendel, M; Ladehoff, N; Koch, U; Mehnert, A
2015-10-01
Our purpose was the psychometric evaluation of the German version of the Utrecht Work Engagement Scale-9 (UWES-9), a self-assessment tool measuring work-related resources consisting of 9 items. Based on a sample of 179 patients with hematological malignancies in in-patient and rehabilitative oncological settings, we tested the dimensional structure by confirmatory and explorative factor analysis. We further evaluated reliability, item characteristics, and construct validity of the UWES-9. The confirmatory factor analysis showed acceptable fit for both a 1-dimensional factor structure and the original 3-factor model. Based on an explorative principal component analysis, we were able to replicate the 1-dimensional factor accounting for 67% of the total variance and showing very high internal consistency (α=0.94) and high factor loads (0.73-0.88). The construct validity was further supported by significant positive correlations between work engagement and meaning of work, corporate feeling, commitment to the workplace, and job satisfaction. The German version of the UWES-9 shows good psychometric qualities in measuring dedication to work in patients with hematological malignancies in in-patient and rehabilitative oncological settings. © Georg Thieme Verlag KG Stuttgart · New York.
Modeled Oceanic Response and Sea Surface Cooling to Typhoon Kai-Tak
Directory of Open Access Journals (Sweden)
Yu-Heng Tseng
2010-01-01
Full Text Available An ocean response to typhoon Kai-Tak is simulated using an accurate fourth-order, basin-scale ocean model. The surface winds of typhoon Kai-Tak were obtained from QuikSCAT satellite images blended with the ECMWF wind fields. An intense nonlinear mesoscale eddy is generated in the northeast South China Sea (SCS with a Rossby number of O(1 and on a 50 - 100 km horizontal scale. Inertial oscillation is clearly observed. Advection dominates as a strong wind shear drives the mixed layer flows outward, away from the typhoon center, thus forcing upwelling from deep levels with a high upwelling velocity (> 30 m day-1. A drop in sea surface temperature (SST of more than 9°C is found in both observation and simulation. We attribute this significant SST drop to the influence of the slow moving typhoon, initial stratification and bathymetry-induced upwelling in the northeast of the SCS where the typhoon hovered.
Wang, Lu; Waters, Mark T; Smith, Steven M
2018-05-04
The control of seed germination in response to environmental conditions is important for plant success. We investigated the role of the karrikin receptor KARRIKIN INSENSITIVE2 (KAI2) in the response of Arabidopsis seeds to osmotic stress, salinity and high temperature. Germination of the kai2 mutant was examined in response to NaCl, mannitol and elevated temperature. The effect of karrikin on germination of wild-type seeds, hypocotyl elongation and the expression of karrikin-responsive genes was also examined in response to such stresses. The kai2 seeds germinated less readily than wild-type seeds and germination was more sensitive to inhibition by abiotic stress. Karrikin-induced KAI2 signalling stimulated germination of wild-type seeds under favourable conditions, but, surprisingly, inhibited germination in the presence of osmolytes or at elevated temperature. By contrast, GA stimulated germination of wild-type seeds and mutants under all conditions. Karrikin induced expression of DLK2 and KUF1 genes and inhibited hypocotyl elongation independently of osmotic stress. Under mild osmotic stress, karrikin enhanced expression of DREB2A, WRKY33 and ERF5 genes, but not ABA signalling genes. Thus, the karrikin-KAI2 signalling system can protect against abiotic stress, first by providing stress tolerance, and second by inhibiting germination under conditions unfavourable to seedling establishment. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
Georgi söögituba Väike-Maarjas / Kai Tort, Ilmar Aasumets
Tort, Kai
2006-01-01
7 ill.; Georg Lurichi järgi nime saanud söögituba asub arhitekt Alar Kotli vanaisale kuulunud hoones; söögitoa kujunduse tegi Kai Tort, mööbli valmistasid kohalikud puusepad, plekist lambid - Ilmar Aasumets, omanik Avo Part
Directory of Open Access Journals (Sweden)
Cecilia Alexandra Portalanza Chavarría
2017-03-01
Full Text Available En el estudio del engagement académico se han desarrollado diversas medidas en función de las teorías o perspectivas que dan soporte a dicho concepto; en consonancia con lo anterior, el presente artículo tiene como objetivo analizar las propiedades psicométricas de una escala de engagement académico, con base en una muestra de 102 estudiantes pertenecientes a una institución de educación superior en Ecuador. El cuestionario empleado fue la versión española de la Utrecht Work Engagement Scale (uwes-s 9. Se analizó la estructura factorial de la escala con el método de estimación robusta. Los resultados obtenidos muestran que el modelo de dos factores presenta mejores índices de ajuste que el de uno y tres factores, por lo que se concluye que la estructura de dos factores es la más apropiada. De igual forma, los resultados llevan a concluir que la escala UWES-S 9 puede ser utilizada para estudiar el engagement en el contexto ecuatoriano.
Kai Adolf Jensen, professor i almindelig patologi
DEFF Research Database (Denmark)
Høiby, Niels
2016-01-01
for the Bacillus Calmette-Guérin vaccine production and supervised many young scientists’ doctoral theses on the aspects of tuberculosis. He became internationally recognized, and he revealed an important scientific fraud in the laboratory of the Austrian professor Ernst Löwenstein (1878-1950), who claimed that he...... could detect M. tuberculosis in blood cultures as a cause of a multitude of diseases. He was a pioneer in eradication of bovine tuberculosis in Denmark which became the first country in the world where this happened. Kai Adolf Jensen held the position as professor of general pathology from 1940 to 1965...
Directory of Open Access Journals (Sweden)
Citlali G. Nieves-Guerrero
2014-06-01
Full Text Available La Ingeniería Web propone nuevos métodos para el diseño de aplicaciones que se ejecutan en esta nueva plataforma que es la World Wide Web. Uno de estos métodos es UWE (UML Web Engineering, el cual aprovecha la notación estándar del UML e incorpora elementos que son propios del desarrollo Web. En este artículo se presenta un caso de estudio para el diseño de un Sistema de Recomendación de Objetos de Aprendizaje, donde el modelado básico se realiza mediante el UWE. Se modela una aplicación Web que permite a los usuarios realizar la composición de los Objetos de Aprendizaje que el mismo sistema le recomienda al usuario previo análisis de las características tanto del mismo como de los Objeto de Aprendizaje almacenados en un repositorio especializado llamado AGORA.
Himaalaja naised eesti naiste silmade läbi / Kai Herkel ; interv. Reet Varblane
Herkel, Kai
2004-01-01
Visuaalantropoloogiline väljapanek "Oskus olla õnnelik arenevas maailmas" Kastellaanimajas 24. märtsini. Väljas on fotod Tiibeti ja Ladakhi küladest, mägedest ja inimestest. Fotograaf Kai Herkeli, tibetoloog Natalia Munatajeva ja tiibeti munga Konchok Sangyas' kangelane on sealne naine. Piltide kõrval on suur tähtsus tekstil
2015-05-18
FTE Equivalent: Total Number: Discipline Yassamin Ihat 0.00 Human biology Montana Altman 0.00 Human biology Michael Montoya 0.00 Human biology 0.00 3...cycles of day and night, because they evolved timekeeping systems called circadian clocks, which regulate biological activities with ~24- h rhythms 1...which together generate a circadian (~24 h ) rhythm of KaiC autophosphorylation, drives the clock of cyanobacteria 13, 14 . We have discovered that KaiB
Rahvaliitlaste rahalaevad roostetavad kai ääres / Sten-Aleks Pihlak
Pihlak, Sten-Aleks
2007-01-01
Rahvaliidule lähedal seisvad ärimehed müüsid riigile maha vanu kalalaevu, et neid õppelaevadena kasutada, kuid nüüd roostetavad laevad kai ääres. Vt. samas: Lobby ekstraklass - minister tegi kõik, mis soovitud; Kalurite liit on tänaseks laiali jooksnud; Undrest jr võitles toetuse välja kohtus; Üheksast õppelaevaks muudetud alusest õpitakse päriselt vaid mõnel. Küsimustele vastab endine põllumajandusminister Ester Tuiksoo. Kommenteerivad Toivo Orgussaar ja Jüri Lember
National Oceanic and Atmospheric Administration, Department of Commerce — Surveys of the marine algae, invertebrates and reef fishes of Waikiki and the Kuapa Pond and Maunalua Bay areas of Hawaii Kai were conducted with the objective of...
National Oceanic and Atmospheric Administration, Department of Commerce — Surveys of the marine algae, invertebrates and reef fishes of Waikiki and the Kuapa Pond and Maunalua Bay areas of Hawaii Kai were conducted with the objective of...
Tulevik on helge: noortele meeldib ettevõtlikkus / Evelin Org, Marge Rahu, Kai Isand ... [jt.
2016-01-01
Sokos Hotels Tallinna müügi- ja turundusdirektori Evelin Orgi, kohviku Maitsvad Muffinid omaniku Marge Rahu, Garage48 SA tegevjuhi Kai Isanda, Swedbanki juriidilise divisjoni direktori Riho Roopõllu, Nortali tegevjuhi ja juhatuse liikme Andre Kulli, Veriff tegevjuhi ja asutaja Kaarel Kotkase ning Esteloni kaasasutaja ja partneri, Eesti Era- ja Riskikapitali Assotsiatsiooni tegevjuhi Kristiina Vassilkova mõtteid edukusest
Directory of Open Access Journals (Sweden)
H. Sendi
2013-01-01
Full Text Available Peat moss (PM is the most widely used growing substrate for the pot culture. Due to diminishing availability and increasing price of PM, researchers are looking for viable alternatives for peat as a growth media component for potted plants. A pot study was conducted with a view to investigate the possibility of using spent mushroom waste (SMW for Kai-lan (Brassica oleracea var. Alboglabra production replacing peat moss (PM in growth media. The treatments evaluated were 100% PM (control, 100% SMW, and mixtures of SMW and PM in different ratios like 1 : 1, 1 : 2, and 2 : 1 (v/v with/without NPK amendment. The experiment was arranged in a completely randomized design with five replications per treatment. Chemical properties like pH and salinity level (EC of SMW were within the acceptable range of crop production but, nutrient content, especially nitrogen content was not enough to provide sufficient nutrition to plant for normal growth. Only PM (100% and SMW and PM mixture in 1 : 1 ratio with NPK amendment performed equally in terms of Kai-lan growth. This study confirms the feasibility of replacing PM by SMW up to a maximum of 50% in the growth media and suggests that NPK supplementation from inorganic sources is to ensure a higher productivity of Kai-lan.
Evidências adicionais de validade da UWES-9 em amostras brasileiras
Directory of Open Access Journals (Sweden)
Maria Cristina Ferreira
Full Text Available Resumo O engajamento no trabalho consiste em um estado motivacional positivo manifesto em sentimentos de vigor, absorção e dedicação ao trabalho. Para avaliá-lo, foi desenvolvida a Escala de Engajamento no Trabalho de Utrecht. O presente trabalho reuniu evidências de validade da versão reduzida da escala (UWES-9 por meio de análises de estrutura interna, de invariância por gênero e setor de trabalho (público ou privado, e de relações com variáveis externas. A amostra foi composta por 2.897 trabalhadores de ambos os sexos (57,3% do sexo feminino, com média de idade de 32,8. Os modelos indicaram que a estrutura unidimensional obteve melhor ajuste e que os parâmetros dos itens não foram significativamente enviesados pelo sexo, setor e tempo de trabalho. A escala apresentou correlações positivas fortes com sentimentos positivos associados ao trabalho. As propriedades psicométricas do instrumento recomendam seu uso futuro em investigações destinadas a avaliar o engajamento no trabalho em amostras brasileiras.
2010-01-01
Vestlusringis osalenud vabakutseline kuraator Rael Artel, Tallinna Ülikooli dotsent, kunstnik Kai Kaljo, EKA fotoosakonna professor, kunstnik Marco Laimre ja EKA fotoosakonna dotsent, kunstnik Marge Monko arutavad, millist rolli peaks KKEK täitma praegu, 21. sajandi teisel kümnendil avatud maailma tingimustes
Yonezawa, Akiyoshi
2014-01-01
The dominant role of Kyoju-kai (the professoriate) in university governance in Japan is now facing a critical examination as part of university reforms in response to global competition. What are the determinants of the characteristics of participation in university governance by individual faculty members? In what way does the organizational…
Çapri, Burhan; Gündüz, Bülent; Akbay, Sinem Evin
2017-01-01
The primary goal of this study is to complete the adaptation, validity and reliability studies of the long (17 items) and short (9 items) forms of UWES-SF. The secondary goal of this study is to study the mediating role of work engagement between academic procrastination and academic responsibility in high school students. The study group consists…
Mäger, Kerttu, 1986-
2016-01-01
Euroopa Inimõiguste Kohtu (EIK) kohtuotsuste jõustamisest Venemaal. EIK kohtuotsuste kohustuslikkusest. EIK kohtuotsuste tõlgendamisest ja valikulisest rakendamisest Venema konstitutsioonikohtu poolt
Designing and Implementing the Intranet for ZhuHai State-Kai Polymer and New Materials Co.,Ltd
Chen, Si; Jiang, Min
2010-01-01
This Thesis was commissioned by Zhuhai State-Kai Polymer and New Materials company, which is a chemical and pharmacy SME in China. The Thesis aimed to design and implement the Intranet with the characteristics of the case company on the basis of the identified requirements. The designed Intranet innovates in a computerized system to replace the current manual system used in its business life. The questionnaire approach was used to gather the information and requirements both from the view...
Morality and ethics in high technology
International Nuclear Information System (INIS)
Schroeter, K.U.
2003-01-01
The ethical debate about what is feasible culminates, for one side, in the indignant moral question whether man is allowed to do all he is able to do and, for the other side, in the very obligation to keep redefining the limits of creation, and to act accordingly. Consequently, the Young Generation, at their meeting in Gronau, Westphalia (about which we reported), discussed about ''High Technology - Responsible on Ethical and Moral Grounds?'' The paper presented to the participants by pastor Kai Uwe Schroeter reflects this dichotomy, but also takes a clear position in favor of the expansion of nuclear power. This issue of atw contains a revised version of the paper. It is published in the hope that it will furnish arguments for the philosophical and ethical debates about high technology. (orig.) [de
Directory of Open Access Journals (Sweden)
Bauer, Bruno
2005-12-01
Full Text Available vascoda (http://www.vascoda.de/ is an internet library portal to interdisciplinary scientific information. It was started in 2003 funded by the German Research Foundation and the Federal Ministry of Education and Research. In the current interview Uwe Rosemann talks about the objectives of vascoda, its partners and financing. Furthermore he informs about the project's office as well as marketing. vascoda's prospects and future development as a foundation stone for a German Digital Library will be mentioned.
Pertunjukan Teater Karo Hip Hop Kontemporer KAI
Directory of Open Access Journals (Sweden)
Silvia Anggreni Purba
2013-11-01
Pertunjukan Teater Karo Hip Hop Kontemporer KAI. The performance of Karo Theater collaborated with Hip Hop stems from a simple idea to collaborate Karo cultural traditions with popular culture. The performances can be enjoyed without having limitation on the language and culture. The process of combining two different cultures is a form of hybrid culture, and it may occur due to the globalization process. Through the process of deposition of the observations and strong impression, this performance is then brought into the form of Hip Hop as a preferred form which is energetic, personal and global. This performance is part of a modern tragedy with its destructive character which has explored the emotion and has presented it to the audiences. The exploration of Karo cultural tradition and Hip Hop dance as a language of symbols is able to reinforce words. The movement is not revealed by the verbal phrase but is presented through the movement of Hip Hop dance. The interpretation of the legend and texts into movement is carried out through the training process at the laboratory as a searching process and experiment, and afterward can be realized by considering the basic elements of Hip Hop, Karo cultural elements and performance. Karo Hip Hop Theatre is expected to become a preferred aesthetic form of a modern theater without losing its tradition form. Keyword: a contemporary Karo theater, Hip Hop, hybrid culture.
Įvairių trąšų įtaka ekologiškai auginamiems žieminiams rugiams
Stelmokas, Svajūnas
2009-01-01
Lietuvos žemės ūkio universiteto Agroekologijos centro ekologinės gamybos ūkyje 2007-2008 m. atlikus fosforo ir kalio trąšų įtakos ekologiškai auginamiems žieminiams rugiams tyrimus nustatyta, kad didžiausias žieminių rugių derlingumas gautas tręšiant P60 fosforitmilčių norma. Didinant normą žieminių rugių derlingumas mažėjo. Lyginant fosforitmilčių normas tarpusavyje bei su netręštais žieminiais rugiais, esminių grūdų derlingumo skirtumų nenustatyta. Tręšimas fosforitmilčiais neturėjo esminė...
A high-order mode extended interaction klystron at 0.34 THz
Wang, Dongyang; Wang, Guangqiang; Wang, Jianguo; Li, Shuang; Zeng, Peng; Teng, Yan
2017-02-01
We propose the concept of high-order mode extended interaction klystron (EIK) at the terahertz band. Compared to the conventional fundamental mode EIK, it operates at the TM31-2π mode, and its remarkable advantage is to obtain a large structure and good performance. The proposed EIK consists of five identical cavities with five gaps in each cavity. The method is discussed to suppress the mode competition and self-oscillation in the high-order mode cavity. Particle-in-cell simulation demonstrates that the EIK indeed operates at TM31-2π mode without self-oscillation while other modes are well suppressed. Driven by the electron beam with a voltage of 15 kV and a current of 0.3 A, the saturation gain of 43 dB and the output power of 60 W are achieved at the center frequency of 342.4 GHz. The EIK operating at high-order mode seems a promising approach to generate high power terahertz waves.
Directory of Open Access Journals (Sweden)
Nils Plath
2015-12-01
Full Text Available The paper concentrates on selected passages from Uwe Johnsonʼs opus magnum, Jahrestage (Anniversaries, in which the Prague Spring and the events of 1968 play a key role, and develops some ideas on how narrations of history and critique of language can jointly (as a translation of sorts be understood as a critical approach to what is taken to be the present and the reality of the past. It is argued that Hannah Arendtʼs notion of the unpredictability of the future and of the event variously influenced the modalities of narration as employed by Johnson. The central issue of Jacques Derridaʼs Prague lecture on how a city determines ‘our’ modes of (self-preception and how a location can be grasped and ‘dated’ in writing is put to use in order to develop a singular perspective on some neglected aspects in Johnsonʼs work. Johnson’s novel and its commentaries form a diverse reflection on time, reality, and the media which can affirm its contemporaneity when understood as exemplary in contesting, by the voice of literature, the functionalization of history and its narrative.
Laffranque, Julia, 1974-
2016-01-01
Eesti kohta tehtud EIK lahendite, sh kaudselt Eesti õiguse ja kohtupraktika mõjust EIK üldisele praktikale. Praktika mõjust ühiskonna arengu, karistusõiguse, kriminaalmenetluse ja kinnipeetavate tingimuste aspektist
2015-06-01
context of regression. Tran, Gaber , and Sattler (2014) describe recent change-detection efforts as applied to streaming data. -2 -1 0 1 2 3 4 -2 -1 0 1 Y...human monitors: A signal detection analysis. Human-Computer Interaction, 1(1), 49–75. Tran, D. H., Gaber , M. M., & Sattler, K. U. (2014). Change
Ettevaatust, šoti tantsu pisik! / Anu Mõttus
Mõttus, Anu
2006-01-01
Šoti keilitantsudest ja sellest, kuidas tantsud Eike Albert-Undi kaudu Eestisse jõudsid. Koostöös TLÜ rahvatantsuansambli Soveldajad juhi Angela Arraste ja Tallinna Ülikooliga on Eike Albert-Undil ilmunud ka raamat "Šoti keilitantsud"
Termiškai aktyvių membraninių tekstilės medžiagų plazminis apdorojimas siekiant superhidrofobiškumo
Directory of Open Access Journals (Sweden)
Adam TWARDOWSKI
2012-06-01
Full Text Available Specialios paskirties lauko drabužiai turi atitikti aukštus patvarumo, šiluminės ištaigos ir drėgmės pernašos reikalavimus. Šiems tikslams dažnai naudojamos membraninės termiškai aktyvios tekstilės medžiagos. Siekiant pagerinti šių tekstilės medžiagų išvaizda, gali būti naudojami įvairūs poveikiai, užtikrinantys superhidrofobinį savaime besivalantį paviršių (žinomą kaip lotoso efektas. Įgyvendinant šią idėją, buvo atlikti žėrinčiojo išlydžio radijo dažnio inertinių dujų bei angliavandenilių dujų plazmos poveikio pramoninėms medžiagoms tyrimai. Gauti geri rezultatai tiriant savaiminio valymosi savybes empiriškai, tam naudojant dulkes ir kietąsias daleles. Skirtingos poveikio sąlygos buvo lyginamos matuojant kontaktinį vandens drėkinimo kampą. Daugeliu atvejų paveiktų medžiagų kontaktinis kampas buvo gerokai didesnis nei pradinių medžiagų. Didžiausia kampo vertė siekė 155°. Paviršiaus ištirtas naudojant skenuojamąjį elektroninį mikroskopą (SEM bei SEM-EDX spektroskopiją. Silikoorganinių dujų plazma apdoroto pluošto paviršiuje aptiktas plonas būdingos sferinės struktūros sluoksnis.DOI: http://dx.doi.org/10.5755/j01.ms.18.2.1920
Directory of Open Access Journals (Sweden)
Jonas Palionis
2011-12-01
Full Text Available ZUR ENSTEHUNG EINIGER SELTENER ORTSNAMEN (Greikónys, Grìkapėdis, Plasapnỹkai, Pušė́nai, Silgiónys, Tauliùkai, VaĩsodžiaiZusammenfassungIm vorliegenden Artikel werden sieben seltene Dorfnamen aus dem südlitauischen Gebiet behandelt. Die Analyse der Entstehung dieser Ortsnamen stützt sich vorwiegend auf das handschriftliche Material der Tauf- und Trauungsurkunden der zweiten Hälfte des 17. und der ersten Hälfte des 18. Jhs der Gemeinde Punià, die gegenwärtig dem Bezirks Alytùs angehört.Greikónys, die ältere Form ist bereits 1659 in einer Taufurkunde verzeichnet (de Gireykancow; das scheint eine Ableitung von dem Familiennamen *Gireika zu sein. Dieser Name läßt sich mit dem Verb gìrti ‘rühmen, loben’ in Verbindung setzen: *gireika- einer, der eine besondere Neigung sich zu rühmen aufweist, Prahlhans ist.Grìkapėdis ist, ohne Zweifel, ebenfalls anthroponymischen Ursprungs, da der Familienname Grìkpėdis im nordwestlichen Teil von Žemaitija vorkommt. Die Bedeutung der Komponenten dieses zusammengesetzten Familiennamens (grìkas ‘Buchweizen’ + pė́das ‘die Getreidegarbe’ zeigt eine metaphorische Basis der Entstehung des Kompositums. Die gegenwärtige Singularform ist wahrscheinlich eine spätere Bildung: in den Taufurkunden der zweiten Hälfte des 17. Jhs findet man Pluralformen (de Grikopedziow, de Grikiepedzow.Plasapnỹkai, änlich wie Greikonys und Grikapėdis, läßt ebenfalls einen anthroponymischen Ursprung vermuten, obwohl dies nicht so augenscheinlich ist. Dieser Ortsname konnte vom Familiennamen *Plasapnỹkas entstanden sein: *Plasapnỹkas < *plasa + *upinykas, d. h. ‘ein an dem Fluß Plasãupė Wohnender’. Das erste Glied dieser kontrahierter Zusammensetzung könnte man auf eine Form des Verbs plàsti ‘breiter werden’ zurückführen.Pušė́nai kommt in der zweiten Hälfte des 17. und der ersten Hälfte des 18. Jhs als Puišėnai (de Puyszany vor. Diese ältere Form weist
Directory of Open Access Journals (Sweden)
Siripen Traichaiyaporn
2012-01-01
Full Text Available Enhancement of the carotenoid and chlorophyll content of an edible freshwater alga (Kai:Cladophora sp. by supplementary inorganic phosphate in canteen wastewater was investigated. Themass cultivation of the alga was conducted at ambient temperature and light intensity in dilutedcanteen wastewater enhanced with dipotassium hydrogen phosphate at 5-20 mg L-1. An increase intotal carotenoid and chlorophyll was observed. However, it had no effect on biomass production. Asa result of the algal cultivation, there was a dramatic improvement in the quality of canteen wastewater.
Põllumajanduskeskkond / Eike Lepmets
Lepmets, Eike
2005-01-01
Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 121-124. Eesti maaelu arengukava 2004-2006 raames, kus keskkonnatoetuste eelarve moodustab ca 38%, toetati 2004. a. keskkonnasõbralikku ja mahepõllumajanduslikku tootmist ning eesti tõugu hobuse kasvatamist
Directory of Open Access Journals (Sweden)
Steffen Röhrs
2017-02-01
Full Text Available As a result of its topic and its narrative style, Uwe Timm’s novel ‘Morenga’ (1978 marks an important step in the development of postcolonial German literature. The main theme of the book is the bloody suppression of the Herero and the Nama uprisings through the German army in South-West Africa at the beginning of the 20th century. With recourse to historical and fictional documents and by using different narrative perspectives, the text achieves a plurality of voices and thereby destabilizes a one-dimensional view on colonialism. The present article discusses the functions of the nonhuman animals appearing in ‘Morenga’. It is assumed that the animal representations are an essential part of the plot and underscore the criticism of colonial rule in a narrative manner too. The novel contains several descriptions of suffering animals and links them to the harm of the Herero and the Nama in order to point out the ruthlessness of the colonists. Moreover, the book features a story-telling ox, which initiates a reflection process about possible ways of narrating colonial history. The talking ox adds a specific animal-centered perspective on colonial oppression and raises questions about emancipation, self-determination, and the agency of the nonhuman ‘other’
Directory of Open Access Journals (Sweden)
Konrad Kulikowski
2017-04-01
Full Text Available Work engagement as a predictor of health is an emerging concept in occupational science and the Utrecht Work Engagement Scale (UWES is the most popular work engagement measurement tool. However, despite its popularity, the UWES is not free from controversy concerning its factorial validity. In this paper, 21 research studies on both UWES-9 and UWES-17 factorial validity within the confirmatory factor analysis (CFA approach have been reviewed in order to answer the question as to which of the UWES factorial structures displays greater validity. The originally proposed threefactor structure of the UWES has been recognized as superior in 6 studies. In further 6 studies, the UWES structure with 1 general factor has been found to be superior. In 8 studies, the authors have concluded that the one- and three-factor structures could be considered equivalent. One study has failed to confirm either the one- or three-factor structure of the UWES. These ambiguous results from studies focusing on the UWES factorial validity are puzzling because they not only indicate a lack of validity for the UWES as a measurement tool but might also challenge the whole concept of work engagement as a three-factor structure of dedication, vigor and absorption. Int J Occup Med Environ Health 2017;30(2:161–175
Lu, Linna; Xu, Shiqiong; He, Fangling; Liu, Yan; Zhang, Yidan; Wang, Jing; Wang, Zhiliang; Fan, Xianqun
2016-03-01
Age-related macular degeneration (AMD) is a major cause of irreversible blindness. Choroidal structural changes seem to be inevitable in AMD pathogenesis. Our study revealed associated choroidal microstructural changes in AMD eyes.The aim of the study was to compare choroidal microstructural changes in eyes with AMD of different stages.The study was a retrospective, cross-sectional case series.The participants comprised of 32 age-matched normal eyes as controls, and 26 fellow uninvolved eyes of intermediate/late AMD, 29 of early AMD, 28 of intermediate AMD, and 39 of late AMD.All subjects underwent comprehensive ophthalmologic examination. The choroid images, including subfoveal choroidal thickness, percentage of Sattler layer area, and en face images of the choroid, were obtained using spectral-domain optical coherence tomography.The main outcome measures were subfoveal choroidal thickness changes, percentage of Sattler layer area changes, and en face images of the choroid in AMD eyes.One hundred fifty-four eyes of 96 individuals with mean age of 67.1±9.2 years were included. The mean subfoveal choroidal thickness was 295.4 ± 56.8 μm in age-matched normal eyes, 306.7 ± 68.4 μm in fellow uninvolved eyes with AMD, 293.8 ± 80.4 μm in early AMD, 215.6 ± 80.4 μm in intermediate AMD, and 200.4 ± 66.6 μm in late AMD (F = 14.2, all P < 0.001). Choroidal thickness was greater in early AMD eyes than in intermediate/late AMD eyes (P < 0.001). Mean percentage of Sattler layer area in each group showed a similar tendency. Microstructure of the choroid showed reduced vascular density of Sattler layer areas in late AMD eyes compared with normal eyes.Decreasing subfoveal choroidal thickness and percentage of Sattler layer area were demonstrated in the progression of AMD. The choroidal change was related to atrophy of the microstructural changes of underlying capillaries and medium-sized vessels.
Kulikowski, Konrad
2017-03-30
Work engagement as a predictor of health is an emerging concept in occupational science and the Utrecht Work Engagement Scale (UWES) is the most popular work engagement measurement tool. However, despite its popularity, the UWES is not free from controversy concerning its factorial validity. In this paper, 21 research studies on both UWES-9 and UWES-17 factorial validity within the confirmatory factor analysis (CFA) approach have been reviewed in order to answer the question as to which of the UWES factorial structures displays greater validity. The originally proposed threefactor structure of the UWES has been recognized as superior in 6 studies. In further 6 studies, the UWES structure with 1 general factor has been found to be superior. In 8 studies, the authors have concluded that the one- and three-factor structures could be considered equivalent. One study has failed to confirm either the one- or three-factor structure of the UWES. These ambiguous results from studies focusing on the UWES factorial validity are puzzling because they not only indicate a lack of validity for the UWES as a measurement tool but might also challenge the whole concept of work engagement as a three-factor structure of dedication, vigor and absorption. Int J Occup Med Environ Health 2017;30(2):161-175. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.
Directory of Open Access Journals (Sweden)
Kyu Hyun Kim
2014-06-01
Full Text Available On May 20, 1938, two American-made Chinese airplanes—Martin B-10 monoplane bombers—took off from Ningbo, Fujian province, in the direction of southwestern Japan. Instead of dropping bombs, they released propaganda materials produced by the Nationalist Party (Guomindang, pleading with the industrial workers, farmers, and petty bourgeois citizens of Japan to stop fighting China and resist their militarist government. This “humanitarian bombardment,” masterminded by Chiang Kai-shek, is little known today—perhaps deservedly so, for it had its embarrassing features. For one, the planes never reached the strategically important areas and merely flew over sparsely populated regions of Kumamoto and Miyazaki prefectures. Further, the propaganda materials were either voluntarily turned over to or confiscated by the Japanese authorities almost as soon as they hit the ground. As far as we can tell, the operation had little impact on the Japanese attitude toward China or on the Second Sino-Japanese War (1937–1945... Iechika Ryōko 家近亮子,Shō Kaiseki no gaikō senryaku to Nitchū sensō 蒋介石の外交戦略と日中戦争[Chiang Kai-shek's diplomatic strategies and the Sino-Japanese War]. Tokyo: Iwanami Shoten, 2012. ISBN: 978-4-00-025865-4. Nakami Tatsuo 中見立夫, 'Manmō mondai' no rekishiteki kōzu 満蒙問題の歴史的構図 [The historical composition of the “Manchurian-Mongolian problem”]. Tokyo: Daigaku Shuppankai, 2013. ISBN: 978-4-86-337131-6.
Vallières, Frédérique; McAuliffe, Eilish; Hyland, Philip; Galligan, Marie; Ghee, Annette
2017-01-01
This study examines the concept of volunteer work engagement in a sample of 334 community health workers in Bonthe District, Sierra Leone. Structural equation modelling was used to validate both the 9-item and the 17-item Utrecht Work Engagement Scale (UWES-9 and UWES-17, respectively). Results assessing the UWES-17 invalidated the three-factor structure within this cohort of community health workers, as high correlations were found between latent factors. Findings for the validity of the UWE...
Effect of kai xin san on learning and memory in a rat model of paradoxical sleep deprivation.
Hu, Yuan; Liu, Ming; Liu, Ping; Yan, Juan-Juan; Liu, Ming-Yue; Zhang, Gang-Qiang; Zhou, Xiao-Jiang; Yu, Bing-Ying
2013-04-01
The present study aimed to evaluate the effect of kai xin san (KXS, at doses of 500, 250, and 125 mg/kg body weight per day), a well-known traditional Chinese medicine, on learning and memory in paradoxical sleep deprivation (PSD)-induced cognition deficit rats. Two behavior tests (the Open Field test and the Morris water maze task) were used for testing the effects of KXS on a PSD-induced learning and memory deficit model. Furthermore, its effect on the glutamic acid (GLU) and γ-amino-butyric acid (GABA) levels in the brain tissue, brain-derived neurotrophic factor (BDNF), cyclic AMP response element binding protein (CREB), and phosphorylated-CREB (p-CREB) expression in the hippocampus was also tested. KXS exerted the greatest cognition against the 48 h PSD-induced cognitive deficit and these effects may be mediated by decreasing the GLU and GABA levels and increasing the levels of BDNF, CREB, and p-CREB. This study indicates that the effect of KXS on learning and memory in a rat model of PSD could be associated with the modulation of neurotransmitter levels and the expression of some genes in the brain that contribute to memory functions.
Directory of Open Access Journals (Sweden)
Frédérique Vallières
2017-04-01
Full Text Available This study examines the concept of volunteer work engagement in a sample of 334 community health workers in Bonthe District, Sierra Leone. Structural equation modelling was used to validate both the 9-item and the 17-item Utrecht Work Engagement Scale (UWES-9 and UWES-17, respectively. Results assessing the UWES-17 invalidated the three-factor structure within this cohort of community health workers, as high correlations were found between latent factors. Findings for the validity of the UWES-9 were largely consistent with those of the UWES-17. Model fit for the UWES-9 were generally equivalent for the one-factor, three-factor, and bifactor solutions, however the three-factor model was once again rejected due to high factor correlations. Based on these results, the current sample provides evidence that work engagement is best represented as a unidimensional construct in this context. Findings are considered alongside previous research to offer support for the utilization of the shortened UWES-9 in this context, as it appears to provide a good representation of work engagement and possess a parsimonious unidimensional scoring scheme.
Konrad Kulikowski
2017-01-01
Work engagement as a predictor of health is an emerging concept in occupational science and the Utrecht Work Engagement Scale (UWES) is the most popular work engagement measurement tool. However, despite its popularity, the UWES is not free from controversy concerning its factorial validity. In this paper, 21 research studies on both UWES-9 and UWES-17 factorial validity within the confirmatory factor analysis (CFA) approach have been reviewed in order to answer the question as to which of th...
Kilpailustrategia käsityöalan case-mikroyritykselle
Sorri, Reetta
2010-01-01
Käsityöalan mikroyritysten nykytilanne on haasteellinen Suomessa. Käsityöyrittäjät joutuvat markkinoilla kovaan kilpailuun teollisten tuotteiden, halpatuonnin, ja suurten tuotantomäärien kanssa. Ongelmaksi on myös muodostunut tuotteiden kopiointi. Usein käsityöalan mikroyrittäjälle yrittäminen on elämäntapa, eikä yrityksellä ole resursseja eikä halua kasvaa. Käsityöalan mikroyritysten tulisi uudistaa toimintamallejaan niin, että ne olisivat kilpailukykyisempiä. Yritysten menestymisen sal...
Fong, Ted Chun-tat; Ng, Siu-man
2012-09-01
Work engagement is a positive work-related state of fulfillment characterized by vigor, dedication, and absorption. Previous studies have operationalized the construct through development of the Utrecht Work Engagement Scale. Apart from the original three-factor 17-item version of the instrument (UWES-17), there exists a nine-item shortened revised version (UWES-9). The current study explored the psychometric properties of the Chinese version of the Utrecht Work Engagement Scale in terms of factorial validity, scale reliability, descriptive statistics, and construct validity. A cross-sectional questionnaire survey was conducted in 2009 among 992 workers from over 30 elderly service units in Hong Kong. Confirmatory factor analyses revealed a better fit for the three-factor model of the UWES-9 than the UWES-17 and the one-factor model of the UWES-9. The three factors showed acceptable internal consistency and strong correlations with factors in the original versions. Engagement was negatively associated with perceived stress and burnout while positively with age and holistic care climate. The UWES-9 demonstrates adequate psychometric properties, supporting its use in future research in the Chinese context.
Validation of Nepalese version of Utrecht Work Engagement Scale.
Panthee, Bimala; Shimazu, Akihito; Kawakami, Norito
2014-01-01
The objective of the current study was to examine the psychometric properties of the Nepalese version of the Utrecht Work Engagement Scale (UWES-N) in a sample of hospital nurses. Registered nurses from three hospitals in Nepal (total N=438) voluntarily completed a self-administered paper-and-pencil questionnaire. Confirmatory factor analysis revealed that the hypothesized three-factor model of the 9-item version of the UWES-N (UWES-N-9) fitted the data best. The internal consistency of the scale was acceptable. Work engagement was positively related to job satisfaction, job performance, happiness and health, and it was negatively related to psychological distress, confirming its construct validity. In conclusion, the findings of our study indicated that the UWES-N-9 has satisfactory psychometric properties and provided supportive evidence for use of the UWES-N-9 in the Nepalese context.
Kulikowski, Konrad
2017-10-11
Work engagement, as conceptualized by the Utrecht Work Engagement Scale (UWES), is a work-related positive state of mind that is characterized by vigour, dedication and absorption; however, it still remains unclear how many dimensions work engagement comprises. This study tested the factorial validity of 11 different UWES factorial models that are available in the literature using a confirmatory factor analysis approach on a large sample of multi-occupational Polish employees (N = 1420). The two-factor UWES-6, comprising vigour and dedication, was found to be reliable and remained invariant across samples drawn from four different organizational positions. It also presented a better fit than the three-factor UWES-9, which is a scale used as a standard in contemporary research on work engagement. The findings suggest that the three-factor UWES-9 might not be an optimal measure of work engagement in Poland.
Directory of Open Access Journals (Sweden)
Caroline Rupprecht
2010-01-01
Full Text Available This article analyzes the writings of East German author Uwe Johnson (1934-84 in terms of his experimental style—specifically transitions between descriptive passages—in conjunction with maternal imagery, as discussed through reference to Susan Suleiman’s concept of a “1.5 generation” of Holocaust survivors. A non-Jewish German author, Johnson addresses German history from the position of the perpetrators, yet born in 1934, he experienced National Socialism from the point of view of a child. In his tetralogy, Anniversaries: From the Life of Gesine Cresspahl (1970-83, feelings of guilt and attempts to understand the German past are negotiated through the maternal figure. This figure is linked, in turn, to water as both a structural and symbolic element throughout the novel. As this article demonstrates, the effect of “blurred boundaries” is achieved through water, which functions as paradigm for the mother-daughter relationship: the narrator-protagonist Gesine’s memory is shaped by the experience of near-drowning before the eyes of her mother, Lisbeth, who commits suicide via self-immolation during Reichskristallnacht . As this article concludes, the author himself seems caught in the predicament of Suleiman’s 1.5 Generation, where perception is blurred, and immersing oneself in (imaginary bodies of water becomes a response to the madness of fascism.
Directory of Open Access Journals (Sweden)
Yuki Miyamoto
2018-05-01
Full Text Available The small town of Minamata is infamous for the industrial disease named after the city. This disease resulted from having ingested methyl mercury, a substance released for more than three decades by a factory owned by the Chisso Corporation. Upon entering the human body, mercury affects the nervous system, resulting in paralysis, and often leading to a slow death. Examining how such violence was inflicted on human beings and on the environment involves a complex array of economic, environmental, and sociocultural issues, all revolving around the notions of justice and responsibility. This article analyzes the local residents’ responses to the irreparable damage done to them, focusing in particular on the thoughts and actions put forward by Ogata Masato and a group called Hongan no kai, who chose to carve bodhisattva statues. Investigating the victims’ religiosity, the author argues that the praxis put forward by the Minamata people resonates with the perspective articulated by Italian philosopher Giorgio Agamben. After having witnessed how justice had been exhausted and their case had been lost in the Japanese legal system, the victims showed their resilience in coming up with original responses, which also offer valuable insight into current discussions centered on environmental ethics.
Small molecule and peptide-mediated inhibition of Epstein-Barr virus nuclear antigen 1 dimerization
International Nuclear Information System (INIS)
Kim, Sun Young; Song, Kyung-A; Kieff, Elliott; Kang, Myung-Soo
2012-01-01
Highlights: ► Evidence that targeting EBNA1 dimer, an EBV onco-antigen, can be achievable. ► A small molecule and a peptide as EBNA1 dimerization inhibitors identified. ► Both inhibitors associated with EBNA1 and blocked EBNA1 DNA binding activity. ► Also, prevented its dimerization, and repressed viral gene transcription. -- Abstract: Latent Epstein-Barr virus (EBV) infection is associated with human B cell lymphomas and certain carcinomas. EBV episome persistence, replication, and gene expression are dependent on EBV-encoded nuclear antigen 1 (EBNA1)’s DNA binding domain (DBD)/dimerization domain (DD)-mediated sequence-specific DNA binding activity. Homodimerization of EBNA1 is essential for EBNA1 DNA binding and transactivation. In this study, we characterized a novel small molecule EBNA1 inhibitor EiK1, screened from the previous high throughput screening (HTS). The EiK1 compound specifically inhibited the EBNA1-dependent, OriP-enhanced transcription, but not EBNA1-independent transcription. A Surface Plasmon Resonance Biacore assay revealed that EiK1 associates with EBNA1 amino acid 459–607 DBD/DD. Consistent with the SPR data, in vitro gel shift assays showed that EiK1 suppressed the activity of EBNA1 binding to the cognate familial repeats (FR) sequence, but not control RBP-Jκ binding to the Jκ site. Subsequently, a cross-linker-mediated in vitro multimerization assay and EBNA1 homodimerization-dependent yeast two-hybrid assay showed that EiK1 significantly inhibited EBNA1 dimerization. In an attempt to identify more highly specific peptide inhibitors, small peptides encompassing the EBNA1 DBD/DD were screened for inhibition of EBNA1 DBD-mediated DNA binding function. The small peptide P85, covering EBNA1 a.a. 560–574, significantly blocked EBNA1 DNA binding activity in vitro, prevented dimerization in vitro and in vivo, associated with EBNA1 in vitro, and repressed EBNA1-dependent transcription in vivo. Collectively, this study describes two
Small molecule and peptide-mediated inhibition of Epstein-Barr virus nuclear antigen 1 dimerization
Energy Technology Data Exchange (ETDEWEB)
Kim, Sun Young; Song, Kyung-A [Samsung Advanced Institute for Health Sciences and Technology (SAIHST), Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Samsung Biomedical Research Institute (SBRI), Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Kieff, Elliott [Department of Medicine, Brigham and Women' s Hospital and Harvard Medical School, Boston, MA 02115 (United States); Kang, Myung-Soo, E-mail: mkang@skku.edu [Samsung Advanced Institute for Health Sciences and Technology (SAIHST), Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Samsung Biomedical Research Institute (SBRI), Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Department of Medicine, Brigham and Women' s Hospital and Harvard Medical School, Boston, MA 02115 (United States)
2012-07-27
Highlights: Black-Right-Pointing-Pointer Evidence that targeting EBNA1 dimer, an EBV onco-antigen, can be achievable. Black-Right-Pointing-Pointer A small molecule and a peptide as EBNA1 dimerization inhibitors identified. Black-Right-Pointing-Pointer Both inhibitors associated with EBNA1 and blocked EBNA1 DNA binding activity. Black-Right-Pointing-Pointer Also, prevented its dimerization, and repressed viral gene transcription. -- Abstract: Latent Epstein-Barr virus (EBV) infection is associated with human B cell lymphomas and certain carcinomas. EBV episome persistence, replication, and gene expression are dependent on EBV-encoded nuclear antigen 1 (EBNA1)'s DNA binding domain (DBD)/dimerization domain (DD)-mediated sequence-specific DNA binding activity. Homodimerization of EBNA1 is essential for EBNA1 DNA binding and transactivation. In this study, we characterized a novel small molecule EBNA1 inhibitor EiK1, screened from the previous high throughput screening (HTS). The EiK1 compound specifically inhibited the EBNA1-dependent, OriP-enhanced transcription, but not EBNA1-independent transcription. A Surface Plasmon Resonance Biacore assay revealed that EiK1 associates with EBNA1 amino acid 459-607 DBD/DD. Consistent with the SPR data, in vitro gel shift assays showed that EiK1 suppressed the activity of EBNA1 binding to the cognate familial repeats (FR) sequence, but not control RBP-J{kappa} binding to the J{kappa} site. Subsequently, a cross-linker-mediated in vitro multimerization assay and EBNA1 homodimerization-dependent yeast two-hybrid assay showed that EiK1 significantly inhibited EBNA1 dimerization. In an attempt to identify more highly specific peptide inhibitors, small peptides encompassing the EBNA1 DBD/DD were screened for inhibition of EBNA1 DBD-mediated DNA binding function. The small peptide P85, covering EBNA1 a.a. 560-574, significantly blocked EBNA1 DNA binding activity in vitro, prevented dimerization in vitro and in vivo, associated
Roelen, C A M; van Hoffen, M F A; Groothoff, J W; de Bruin, J; Schaufeli, W B; van Rhenen, W
2015-05-01
To investigate the Maslach Burnout Inventory-General Survey (MBI-GS) and the Utrecht Work Engagement Scale (UWES) for their ability to identify non-sicklisted employees at increased risk of long-term sickness absence (LTSA). One-year prospective cohort study including 4,921 employees participating in occupational health surveys in the period 2008-2010. The MBI-GS and UWES were part of the health survey questionnaire and LTSA in the year following the health survey was retrieved from an occupational health register. Associations of baseline MBI-GS and UWES scores with LTSA during 1-year follow-up were stratified by the cause (mental, musculoskeletal, and other somatic illness) of LTSA. Discrimination was assessed by the area (AUC) under the receiver operating characteristic curve and considered practically useful for AUC ≥0.75. During 1-year follow-up, 103 employees (2%) had LTSA due to mental (N = 43), musculoskeletal (N = 31), or other somatic (N = 29) illness. MBI-GS scores were positively and UWES scores negatively associated with mental LTSA, but not musculoskeletal or other somatic LTSA. Discrimination between employees at high and low risk of mental LTSA was moderate: AUC = 0.68 for the MBI-GS and AUC = 0.70 for the UWES. Discrimination did not improve when the MBI-GS and UWES were used simultaneously. The MBI-GS and UWES predicted future mental LTSA in non-sicklisted employees, but discrimination was not practically useful for identifying employees at high risk of LTSA. However, both instruments could be used to select employees for further assessment of mental LTSA risk.
Minimal tool set for a prokaryotic circadian clock.
Schmelling, Nicolas M; Lehmann, Robert; Chaudhury, Paushali; Beck, Christian; Albers, Sonja-Verena; Axmann, Ilka M; Wiegard, Anika
2017-07-21
Circadian clocks are found in organisms of almost all domains including photosynthetic Cyanobacteria, whereby large diversity exists within the protein components involved. In the model cyanobacterium Synechococcus elongatus PCC 7942 circadian rhythms are driven by a unique KaiABC protein clock, which is embedded in a network of input and output factors. Homologous proteins to the KaiABC clock have been observed in Bacteria and Archaea, where evidence for circadian behavior in these domains is accumulating. However, interaction and function of non-cyanobacterial Kai-proteins as well as homologous input and output components remain mainly unclear. Using a universal BLAST analyses, we identified putative KaiC-based timing systems in organisms outside as well as variations within Cyanobacteria. A systematic analyses of publicly available microarray data elucidated interesting variations in circadian gene expression between different cyanobacterial strains, which might be correlated to the diversity of genome encoded clock components. Based on statistical analyses of co-occurrences of the clock components homologous to Synechococcus elongatus PCC 7942, we propose putative networks of reduced and fully functional clock systems. Further, we studied KaiC sequence conservation to determine functionally important regions of diverged KaiC homologs. Biochemical characterization of exemplary cyanobacterial KaiC proteins as well as homologs from two thermophilic Archaea demonstrated that kinase activity is always present. However, a KaiA-mediated phosphorylation is only detectable in KaiC1 orthologs. Our analysis of 11,264 genomes clearly demonstrates that components of the Synechococcus elongatus PCC 7942 circadian clock are present in Bacteria and Archaea. However, all components are less abundant in other organisms than Cyanobacteria and KaiA, Pex, LdpA, and CdpA are only present in the latter. Thus, only reduced KaiBC-based or even simpler, solely KaiC-based timing systems
Design and optimization of G-band extended interaction klystron with high output power
Li, Renjie; Ruan, Cunjun; Zhang, Huafeng
2018-03-01
A ladder-type Extended Interaction Klystron (EIK) with unequal-length slots in the G-band is proposed and designed. The key parameters of resonance cavities working in the π mode are obtained based on the theoretical analysis and 3D simulation. The influence of the device fabrication tolerance on the high-frequency performance is analyzed in detail, and it is found that at least 5 μm of machining precision is required. Thus, the dynamic tuning is required to compensate for the frequency shift and increase the bandwidth. The input and output coupling hole dimensions are carefully designed to achieve high output power along with a broad bandwidth. The effect of surface roughness of the metallic material on the output power has been investigated, and it is proposed that lower surface roughness leads to higher output power. The focusing magnetic field is also optimized to 0.75 T in order to maintain the beam transportation and achieve high output power. With 16.5 kV operating voltage and 0.30 A beam current, the output power of 360 W, the efficiency of 7.27%, the gain of 38.6 dB, and the 3 dB bandwidth of 500 MHz are predicted. The output properties of the EIK show great stability with the effective suppression of oscillation and mode competition. Moreover, small-signal theory analysis and 1D code AJDISK calculations are carried out to verify the results of 3D PIC simulations. A close agreement among the three methods proves the relative validity and the reliability of the designed EIK. Thus, it is indicated that the EIK with unequal-length slots has potential for power improvement and bandwidth extension.
A psychometric analysis of the Utrecht Work Engagement Scale in the South African police service
Directory of Open Access Journals (Sweden)
K. Storm
2003-10-01
Full Text Available The objectives of this research were to validate the Utrecht Work Engagement Scale (UWES for the South African Police Service (SAPS and to determine its construct equivalence and bias in different race groups. A cross-sectional survey design was used. Stratified random samples (N = 2396 were taken of police members of nine provinces in South Africa. The UWES and a biographical questionnaire were administered. Structural equation modelling confirmed a 3-factor model of work engagement, consisting of Vigour, Dedication and Absorption. These three factors have acceptable internal consistencies. Exploratory factor analysis with target rotations showed equivalence of the three factors for different race groups in the SAPS. No evidence was found for uniform or non-uniform bias of the items of the UWES for different race groups. Opsomming Die doelstellings van hierdie navorsing was om die Utrecht- werksbegeesteringskaal (UWES te valideer vir die Suid- Afrikaanse Polisiediens (SAPD en die konstrukekwivalensie daarvan vir verskillende rassegroepe te bepaal. ’n Dwarssnee opname-ontwerp is gebruik. Gestratifiseerde ewekansige steekproewe (N = 2396 is van polisielede uit nege provinsies geneem. Die UWES en ’n biografiese vraelys is afgeneem. Strukturele vergelykingsmodellering het ’n 3-faktormodel, bestaande uit Energie, Toewyding en Absorpsie, aangetoon. Hierdie drie faktore het aanvaarbare interne konsekwentheid getoon. Eksploratiewe faktoranalise met teikenrotasies het konstrukekwivalensie vir die drie faktore vir verskillende rassegroepe in die SAPD getoon. Bewyse is nie gevind vir uniforme of nie-uniforme sydigheid van die items van die UWES vir verskillende rassegroepe nie.
Adaptors and Innovators: A Description and Measure
Kirton, Michael
1976-01-01
Describes development of the Kirton Adaption Innovation Inventory (KAI) for rating respondents on a continuum of adaptiveness-innovativeness, discusses tests of the validity and utility of the KAI model, and evaluates the KAI model's characteristics. For availability see EA 507 670. (Author/JG)
Directory of Open Access Journals (Sweden)
Zsolt Czigányik
2016-01-01
Full Text Available After defining utopianism Czigányik gives a brief introduction to Hungarian utopian literature. While he discusses Tariménes utazása [‘The Voyage of Tariménes’], written by György Bessenyei in 1804, the utopian scenes of Imre Madách’s Az ember tragédiája [‘The Tragedy of Man’, 1862] and Frigyes Karinthy’s short utopian piece, Utazás Faremidoba [‘Voyage to Faremido’, 1916], the bulk of the paper deals with Mór Jókai’s monumental novel, A jövő század regénye, [‘The Novel of the Century to Come’, 1872]. Jókai, who had taken an active part in the 1848 uprising, depicts in this novel a future world of an imaginary twentieth century, where Hungary has primacy within the Habsburg empire (with the emperor king being Árpád Habsburg and the invention of the airplane (by a Hungarian brings lasting peace, stability and prosperity to the world. Besides introducing the Hungarian utopian tradition, the paper will reflect upon the role of individuals in imagined societies and how an agency-centered narrative overwrites the essentially structuralist view of history, that usually permeates utopias.
Validity and reliability of the Utrecht Work Engagement Scale-Student Version in Sri Lanka.
Wickramasinghe, Nuwan Darshana; Dissanayake, Devani Sakunthala; Abeywardena, Gihan Sajiwa
2018-05-04
The present study was aimed at assessing the validity and the reliability of the Sinhala version of the Utrecht Work Engagement Scale-Student Version (UWES-S) among collegiate cycle students in Sri Lanka. The 17-item UWES-S was translated to Sinhala and the judgmental validity was assessed by a multi-disciplinary panel of experts. Construct validity of the UWES-S was appraised by using multi-trait scaling analysis and exploratory factor analysis (EFA) on data obtained from a sample of 194 grade thirteen students in the Kurunegala district, Sri Lanka. Reliability of the UWES-S was assessed by using internal consistency and test-retest reliability. Except for item 13, all other items showed good psychometric properties in judgemental validity, item-convergent validity and item-discriminant validity. EFA using principal component analysis with Oblimin rotation, suggested a three-factor solution (including vigor, dedication and absorption subscales) explaining 65.4% of the total variance for the 16-item UWES-S (with item 13 deleted). All three subscales show high internal consistency with Cronbach's α coefficient values of 0.867, 0.819, and 0.903 and test-retest reliability was high (p valid and a reliable instrument to assess work engagement among collegiate cycle students in Sri Lanka.
Directory of Open Access Journals (Sweden)
Xanthopoulou, D.
2012-01-01
Full Text Available This study examines the factor structure and invariance of the instruments measuring burnout (Maslach Burnout Inventory - General Survey / MBI-GS and work engagement (Utrecht Work Engagement Scale / UWES in a sample of Dutch (N = 162 and Greek (N = 206 employees. Confirmatory factor analyses in both samples supported the superiority of the proposed three-factor structure of both the MBI-GS (exhaustion, cynicism, and reduced professional efficacy and the UWES (vigor, dedication, and absorption. Alternative two-factor and one-factor models did not show a better fit to the data. In addition, results of multigroup analyses partly supported the invariance of the three-factor model of the MBI-GS, and fully supported the invariance of the three-factor model of the UWES across the two national samples. These results suggest that the MBI-GS and the UWES are not only valid instruments for testing burnout and engagement but also allow comparisons across countries.
Mothers' Judgement Of The Representativeness Of Their Sons ...
African Journals Online (AJOL)
KATEVG
Intelligence Scale (Thorndike, Hagen, and Sattler 1986). Thal et al. (1999) also correlated parents' .... All participants were to have normal intelligence, language abilities, and hearing according to ..... cannot be attributed to multiple conjoining using and or and then, as sentences conjoined by these connecting devices were ...
Representing chemicals using OWL, description graphs and rules
CSIR Research Space (South Africa)
Hastings, J
2010-06-01
Full Text Available OWL, Description Graphs and Rules Janna Hastings1;2;3?, Michel Dumontier4, Duncan Hull1, Matthew Horridge5, Christoph Steinbeck1, Ulrike Sattler5, Robert Stevens5, Tertia H orne2, and Katarina Britz2;3 1 European Bioinformatics Institute, UK 2...
Representing chemicals using OWL, description graphs and rules
CSIR Research Space (South Africa)
Hastings, J
2010-06-01
Full Text Available , Description Graphs and Rules Janna Hastings1;2;3?, Michel Dumontier4, Duncan Hull1, Matthew Horridge5, Christoph Steinbeck1, Ulrike Sattler5, Robert Stevens5, Tertia H orne2, and Katarina Britz2;3 1 European Bioinformatics Institute, UK 2 University...
An allele of the crm gene blocks cyanobacterial circadian rhythms.
Boyd, Joseph S; Bordowitz, Juliana R; Bree, Anna C; Golden, Susan S
2013-08-20
The SasA-RpaA two-component system constitutes a key output pathway of the cyanobacterial Kai circadian oscillator. To date, rhythm of phycobilisome associated (rpaA) is the only gene other than kaiA, kaiB, and kaiC, which encode the oscillator itself, whose mutation causes completely arrhythmic gene expression. Here we report a unique transposon insertion allele in a small ORF located immediately upstream of rpaA in Synechococcus elongatus PCC 7942 termed crm (for circadian rhythmicity modulator), which results in arrhythmic promoter activity but does not affect steady-state levels of RpaA. The crm ORF complements the defect when expressed in trans, but only if it can be translated, suggesting that crm encodes a small protein. The crm1 insertion allele phenotypes are distinct from those of an rpaA null; crm1 mutants are able to grow in a light:dark cycle and have no detectable oscillations of KaiC phosphorylation, whereas low-amplitude KaiC phosphorylation rhythms persist in the absence of RpaA. Levels of phosphorylated RpaA in vivo measured over time are significantly altered compared with WT in the crm1 mutant as well as in the absence of KaiC. Taken together, these results are consistent with the hypothesis that the Crm polypeptide modulates a circadian-specific activity of RpaA.
Kas hakkas hirm võõrale maale ära kaduda? / Mööna Tilder
Tilder, Mööna
2010-01-01
Eike Ülevainu, Jaak Sapase ning Eneli Meresmaa lavastus "Estonia Meets Africa ehk Vaade eemalt", mis kannab tinglikult dokumentaallavastuse nime ja esitatakse nüüdistantsu ja -teatri vormis. Esietendus 9. dets. Tallinna Meistrite Hoovi teatrisaalis
Tantsuline vaade kodusele Eestimaale Aafrikast / Tiiu Laks
Laks, Tiiu, 1984-
2009-01-01
9. dets. esietendub Tallinna Meistrite Hoovi teatrisaalis Eike Ülevainu, Jaak Sapase ning Eneli Meresmaa lavastus "Estonia Meets Africa ehk Vaade eemalt", mis kannab tinglikult dokumentaallavastuse nime ja esitatakse nüüdistantsu ja -teatri vormis
African Journals Online (AJOL)
Items 151 - 200 of 204 ... ... note on the distribution and relative importance of bean Bruchid species Aconthoscelides obtectus (Say.) ... DE Mushi, LA Mtenga, LO Eik ... MC Kalumuna, ST Ikerra, GJ Ley, B Kiwambo, JA Kamasho, RR Weil.
The Role of Attention for Context-Context Binding of Intrinsic and Extrinsic Features
Boywitt, C. Dennis; Meiser, Thorsten
2012-01-01
There is converging evidence that the feeling of conscious recollection is usually accompanied by the bound retrieval of context features of the encoding episode (e.g., Meiser, Sattler, & Weiber, 2008). Recently, however, important limiting conditions have been identified for the binding between context features in memory. For example, focusing on…
African Journals Online (AJOL)
Sattler, I. Vol 38, No 3 (2012) - Articles New Glucopyranosylglyceryl-N-Octenyl Adipate and Bioactivity of Retro and Condensed Chalcones from Toussaintia Orientalis Abstract PDF. ISSN: 2507-7961. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
De baard van Koning Winter - ijshaar of haarijs
Vossestein, M.; Mulder, S.
2009-01-01
IJshaar of haarijs is soms in beuken- of gemengde bossen met beuken of eiken te vinden. Tot nu toe is dit zeer zeldzame fenomeen alleen aangetroffen op dode takken van eik en beuk, waarvan de schors net is losgeraakt
Couzens, Donna; Cuskelly, Monica; Haynes, Michele
2011-01-01
Growth models for subtests of the Stanford-Binet Intelligence Scale, 4th edition (R. L. Thorndike, E. P. Hagen, & J. M. Sattler, 1986a, 1986b) were developed for individuals with Down syndrome. Models were based on the assessments of 208 individuals who participated in longitudinal and cross-sectional research between 1987 and 2004. Variation…
Maailma sporthobuste kasvatajad Inglismaal. I-II osa / Raigo Kollom
Kollom, Raigo, 1936-
2013-01-01
Maailma Sporthobuste Kasvatajate Föderatsiooni peaassambleel Inglismaal Newmarketi väikelinnas toimunud külastustest British Racing School'i, British Racing Museum'i ning Dubai valitseja ja Araabia Ühinenud Emiraatide asepresidendi šeik Mohammed bin Rashid Al Maktoumi hobusekasvandusse Darley Stud
Külas tippterroristil / Aadu Hiietamm
Hiietamm, Aadu, 1954-
2006-01-01
Briti nädalaajalehe The Sunday Times artiklist, milles kirjeldatakse Iraagi sunniitide vastupanuliikumise ühe juhi šeik Abu Omar al Ansari kohtumist Iraagis enim tagaotsitava terroristi Abu Musab al-Zarqawi'ga, et arutada koostööd okupatsioonijõudude ründamisel
Series solutions and a perturbation formula for the extended ...
Indian Academy of Sciences (India)
1Department of Mathematics, Sri Manakula Vinayagar Engineering College, ... Though this method has been used in many examples of basic flows in the Rayleigh ... Here, the real part of W(z)eik(x−ct) is the vertical velocity of a normal mode ...
Directory of Open Access Journals (Sweden)
Lu Yan
2017-12-01
Full Text Available Kai-Xin-San (KXS, a Chinese herbal decoction, has been applied to medical care of depression for thousands of years. It is composed of two functional paired-herbs: Ginseng Radix et Rhizoma (GR-Polygalae Radix (PR and Acori Tatarinowii Rhizoma (ATR-Poria (PO. The compatibility of the paired-herbs has been frequently changed to meet the criteria of syndrome differentiation and treatment variation. Currently, a modified KXS (namely KXS2012 was prepared by optimizing the combinations of GR-PR and ATR-PO: the new herbal formula was shown to be very effective in animal studies. However, the cellular mechanism of KXS2012 against depression has not been fully investigated. Here, the study on KXS2012-induced neuronal differentiation in cultured PC12 cells was analyzed. In PC12 cultures, single application of KXS2012 showed no effect on the neuronal differentiation, but which showed robust effects in potentiating nerve growth factor (NGF-induced neurite outgrowth and neurofilament expression. The potentiating effect of KXS2012 was mediated through NGF receptor, tropomyosin receptor kinase (Trk A: because the receptor expression and activity was markedly up-regulated in the presence of KXS2012, and the potentiating effect was blocked by k252a, an inhibitor of Trk A. Our current results in cell cultures fully support the therapeutic efficacy of KXS2012 against depression.
Toward Control of Universal Scaling in Critical Dynamics
2016-01-27
program that aims to synergistically combine two powerful and very successful theories for non-linear stochastic dynamics of cooperative multi...RESPONSIBLE PERSON 19b. TELEPHONE NUMBER Uwe Tauber Uwe C. T? uber , Michel Pleimling, Daniel J. Stilwell 611102 c. THIS PAGE The public reporting burden...to synergistically combine two powerful and very successful theories for non-linear stochastic dynamics of cooperative multi-component systems, namely
Maina, William K; Kim, Andrea A; Rutherford, George W; Harper, Malayah; K'Oyugi, Boniface O; Sharif, Shahnaaz; Kichamu, George; Muraguri, Nicholas M; Akhwale, Willis; De Cock, Kevin M
2014-05-01
AIDS Indicator Surveys are standardized surveillance tools used by countries with generalized HIV epidemics to provide, in a timely fashion, indicators for effective monitoring of HIV. Such data should guide responses to the HIV epidemic, meet program reporting requirements, and ensure comparability of findings across countries and over time. Kenya has conducted 2 AIDS Indicator Surveys, in 2007 (KAIS 2007) and 2012-2013 (KAIS 2012). These nationally representative surveys have provided essential epidemiologic, sociodemographic, behavioral, and biologic data on HIV and related indicators to evaluate the national HIV response and inform policies for prevention and treatment of the disease. We present a summary of findings from KAIS 2007 and KAIS 2012 and the impact that these data have had on changing HIV policies and practice.
Zhu, Kevin Yue; Mao, Qing-Qiu; Ip, Siu-Po; Choi, Roy Chi-Yan; Dong, Tina Ting-Xia; Lau, David Tai-Wai; Tsim, Karl Wah-Keung
2012-01-01
Kai-xin-san (KXS), a Chinese herbal decoction being prescribed by Sun Simiao in Beiji Qianjin Yaofang about 1400 years ago, contains Ginseng Radix et Rhizoma, Polygalae Radix, Acori tatarinowii Rhizoma, and Poria. KXS has been used to treat stress-related psychiatric disease with the symptoms of depression and forgetfulness in ancient China until today. However, the mechanism of its antidepression action is still unknown. Here, the chronic mild-stress-(CMS-) induced depressive rats were applied in exploring the action mechanisms of KXS treatment. Daily intragastric administration of KXS for four weeks significantly alleviated the CMS-induced depressive symptoms displayed by enhanced sucrose consumption. In addition, the expressions of those molecular bio-markers relating to depression in rat brains were altered by the treatment of KXS. These KXS-regulated brain biomarkers included: (i) the levels of dopamine, norepinephrine, and serotonin (ii) the transcript levels of proteins relating to neurotransmitter metabolism; (iii) the transcript levels of neurotrophic factors and their receptors. The results suggested that the anti-depressant-like action of KXS might be mediated by an increase of neurotransmitters and expression of neurotrophic factors and its corresponding receptors in the brain. Thus, KXS could serve as alternative medicine, or health food supplement, for patients suffering from depression. PMID:22973399
Directory of Open Access Journals (Sweden)
Kevin Yue Zhu
2012-01-01
Full Text Available Kai-xin-san (KXS, a Chinese herbal decoction being prescribed by Sun Simiao in Beiji Qianjin Yaofang about 1400 years ago, contains Ginseng Radix et Rhizoma, Polygalae Radix, Acori tatarinowii Rhizoma, and Poria. KXS has been used to treat stress-related psychiatric disease with the symptoms of depression and forgetfulness in ancient China until today. However, the mechanism of its antidepression action is still unknown. Here, the chronic mild-stress-(CMS- induced depressive rats were applied in exploring the action mechanisms of KXS treatment. Daily intragastric administration of KXS for four weeks significantly alleviated the CMS-induced depressive symptoms displayed by enhanced sucrose consumption. In addition, the expressions of those molecular bio-markers relating to depression in rat brains were altered by the treatment of KXS. These KXS-regulated brain biomarkers included: (i the levels of dopamine, norepinephrine, and serotonin (ii the transcript levels of proteins relating to neurotransmitter metabolism; (iii the transcript levels of neurotrophic factors and their receptors. The results suggested that the anti-depressant-like action of KXS might be mediated by an increase of neurotransmitters and expression of neurotrophic factors and its corresponding receptors in the brain. Thus, KXS could serve as alternative medicine, or health food supplement, for patients suffering from depression.
24. III avati Tallinna Linnagaleriis Ilja Sundelevitshi näitus "Täht"
2004-01-01
Väljas on Tel Avivi lähistel valminud maakunstiprojekti fotodokumentatsioon ning videoinstallatsioon, mille muusika autor on Jaan-Eik Tulve. I. Sundelevitsh mõtiskleb keele tähenduse ja terrori üle, võrdleb tähti ja märke, paneb neid mitmesse kultuurikonteksti
Gyraitė, Lina; Bivainiennė, Lina
2008-01-01
Straipsnyje analizuojamas marketingo komunikacijos elementų taikymas Šiaulių universitete vykdomiems ES struktūrinių fondų projektams. Marketingo komunikaciją galima apibūdinti kaip būdą, kai naudojant įvairias komunikacijos priemones, pasiekiamos numatytos tikslinės auditorijos, perduodama reikalinga informacija ir taip siekiama jas paveikti. Straipsnyje teoriškai ir praktiškai analizuojamos marketingo komunikacijos Šiaulių universitete vykdomų ES struktūrinių fondų projektų pavyzdžiu. Moksl...
Directory of Open Access Journals (Sweden)
Kern KU
2013-07-01
Full Text Available Kai-Uwe Kern,1 Janice England,2 Andrea Roth-Daniek,3 Till Wagner3 1Institute for Pain Medicine/Pain Practice, Wiesbaden, Germany; 2Pain Medicine and Anaesthesia, The Christie National Health Service Foundation Trust, Manchester, UK; 3Pain Therapy and Palliative Care Department, Medizinisches Zentrum Städteregion Aachen, Aachen, Germany Abstract: Neuropathic pain is difficult to treat and can have a severe effect on quality of life. The capsaicin 8% patch is a novel treatment option that directly targets the source of peripheral neuropathic pain. It can provide pain relief for up to 12 weeks in patients with peripheral neuropathic pain. Treatment with the capsaicin 8% patch follows a clearly defined procedure, and patch application must be carried out by a physician or a health care professional under the supervision of a physician. Nonetheless, in our experience, nurses often take the lead role in capsaicin 8% patch application without the involvement of a physician. We believe that the nurse's key role is of benefit to the patients, as he or she may be better placed, because of time constraints and patient relationships, to support the patient through the application procedure than a physician. Moreover, a number of frequently prescribed drugs, including botulinum toxin and infliximab, can be administered by health care professionals without the requirement for physician supervision. Here we argue that current guidance should be amended to remove the requirement for physician supervision during application of the capsaicin 8% patch. Keywords: capsaicin, neuropathic pain, topical, health care professional, physician, nurse
Employee engagement and management standards: a concurrent evaluation.
Ravalier, J M; Dandil, Y; Limehouse, H
2015-08-01
The UK Health & Safety Executive's Management Standards Indicator Tool (MSIT) has been used to assess areas of work design, which may act as psychosocial hazards leading to burnout. These have not been assessed as predictors of employee engagement. To determine the utility of the MSIT in evaluating employee engagement as measured by the Utrecht Work Engagement Scale (UWES). A cross-sectional survey of employees from two sales organizations in London was performed using the MSIT and UWES. MSIT scores were analysed stratifying medium-high versus low engagement. Multivariate linear regression evaluated the association of all MSIT scores with UWES factors. Control, managerial support, peer support and employee role differed by engagement level. Demands, peer support and role exceeded MSIT benchmark guidance that would warrant urgent improvement. Role ambiguity was the only factor significantly associated with all subdomains of engagement. Role appears to play a major part in determining employee engagement. Assessment of the relationship between factors measured by the MSIT and UWES requires further investigation in wider organizational settings, particularly the influence of employee role on positive psychological outcomes. © The Author 2015. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Measuring Engagement at Work: Validation of the Chinese Version of the Utrecht Work Engagement Scale
Ng, Sm; Fong, TCt
2011-01-01
Background: Work engagement is a positive work-related state of fulfillment characterized by vigor, dedication, and absorption. Previous studies have operationalized the construct through development of the Utrecht Work Engagement Scale. Apart from the original three-factor 17-item version of the instrument (UWES-17), there exists a nine-item shortened revised version (UWES-9). Purpose: The current study explored the psychometric properties of the Chinese version of the Utrecht Work Engagemen...
Measuring Engagement at Work: Validation of the Chinese Version of the Utrecht Work Engagement Scale
Fong, Ted Chun-tat; Ng, Siu-man
2011-01-01
Background Work engagement is a positive work-related state of fulfillment characterized by vigor, dedication, and absorption. Previous studies have operationalized the construct through development of the Utrecht Work Engagement Scale. Apart from the original three-factor 17-item version of the instrument (UWES-17), there exists a nine-item shortened revised version (UWES-9). Purpose The current study explored the psychometric properties of the Chinese version of the Utrecht Work Engagement ...
Engineered Surfaces to Control Secondary Electron Yield for Multipactor Suppression
2017-09-14
Air Force Institute of Technology AFIT Scholar Theses and Dissertations 9-14-2017 Engineered Surfaces to Control Secondary Electron Yield for...Multipactor Suppression James M. Sattler Follow this and additional works at: https://scholar.afit.edu/etd Part of the Electrical and Electronics Commons... TECHNOLOGY Wright-Patterson Air Force Base, Ohio DISTRIBUTION STATEMENT A. APPROVED FOR PUBLIC RELEASE; DISTRIBUTION UNLIMITED
An application of adaption-innovation theory to bioremediation
Energy Technology Data Exchange (ETDEWEB)
Guerin, L.J. [World Trade Centre, Melbourne, Victoria (Australia); Guerin, T.F. [Minenco Bioremediation Services, Bundoora, Victoria (Australia)
1995-12-31
This paper provides a discussion of the potential application of the Kirton Adaption-Innovation Inventory (KAI) for assessing the adaptive-innovative cognitive style of individuals and organizations within the bioremediation industry. Human-resource and line managers, or other individuals responsible for staff evaluation, selection, and project planning, should consider using the KAI to assist them in selecting individuals for specific roles requiring either an innovative or adaptive style. The KAI, a measure for assessing adaption-innovation at the individual employee level, is introduced and its potential value in the bioremediation industry is discussed.
Sociopato portreto vaizdavimas kinematografijoje
Uldukis, Vytautas
2014-01-01
Diplominiame darbe „Sociopato portreto vaizdavimas kinematografijoje“ nagrinėjama kaip ir kokiomis priemonėmis kino filmuose vaizduojami sociopatijos paveikti asmenys. Šis reiškinys psichologiškai dar nėra visiškai išnagrinėtas, todėl yra labai sunku visuomenėje nustatyti sociopatus. Pasireiškia tik atskiri atvejai kai jie yra demaskuojami dėl to, kad nusižengė įstatymams ir nepakluso teisėtvarkai. Nemažai įvairaus laikotarpio filmų sukuriama remiantis sociopatijos reiškiniu, kuriuose sukuria...
Keller, Robert T.; Holland, Winford E.
1979-01-01
A cross-validation study of the Kirton Adaption-Innovation Inventory (KAI) was conducted with 256 professional employees from three applied research and development organizations. The KAI correlated well with both direct and indirect measures of innovativeness in all three organizations. (Author/MH)
Kurg, Andres, 1975-
2004-01-01
Okupatsioonide muuseumist, 7. "Europani" arhitektuurikonkursil äramärgitud tööst "Alvar" (autoreiks Londonis töötavad arhitektid Eike Sindlinger, Ulrike Steven, Gareth Morris büroost 7-degrees), mis püüab positiivselt sekkuda Tallinna Lasnamäe praegusesse hoonestusse, võimalustest teha sotsiaalselt tundlikku arhitektuuri
Art Loft Berliini südames / Dagmar Reinolt
Reinolt, Dagmar
2015-01-01
Berliini südames asub Saksa arhitektuuribüroo Eike Beckeri poolt loodud kümnekorruseline mängulise fassaadiga hoone. Eesti sisearhitektid Tiina Kesküla, Kätlin Ölluk ja Katy Seppel on loonud sealsetesse korteritesse hubase interjööri. Artiklis on vaatluse all üks korteritest - galeriikorter
Directory of Open Access Journals (Sweden)
Cinthya Flores Jiménez
2015-12-01
Full Text Available RESUMEN El entusiasmo por el trabajo (work engagement es un constructo que integra sentimientos de Vigor, Dedicación y Absorción (Schaufeli, Salanova, González-Romá y Bakker, 2002. El presente estudio tiene por objetivo investigar la validez factorial de la Utrecht Work Engagement Scale (UWES en las versiones de 15 y 9 ítems en una muestra de 145 profesores de la ciudad de Lima, Perú. Se utilizaron análisis exploratorios y análisis factoriales confirmatorios. Los resultados mostraron que la UWES tiene adecuadas propiedades psicométricas, respetando su estructura tridimensional y, particularmente, la versión de 9 ítems evidenció los mejores índices de ajuste. Futuros estudios deberán confirmar estos hallazgos. ABSTRACT Work engagement is a construct that integrates feelings of vigor, dedication and absorption (Schaufeli, Salanova, Gonzalez-Roma and Bakker, 2002. The purpose of this study is to investigate the factorial validity of the Utrecht Work Engagement Scale (UWES with versions of 15 and 9 items, in a sample by 145 teachers from Lima, Peru. We used exploratory analysis and confirmatory factor analysis. The results show that the UWES has adequate psychometric properties, while respecting its three-dimensional structure, and particularly the 9 items version showed better indices of adjustment. Future studies will be required to confirm these findings.
4. VII kell 17 avatakse Haapsalu Evald Okase muuseumis rahvusvaheline klaasinäitus...
2004-01-01
Ühtlasi lõpevad II Haapsalu klaasipäevad "Maritima". Korraldaja Kai Koppel. Klaasi puhuvad Rait Parts, Robert Tannahill Kanadast, Sun Hwan Hong Koreast, Kai Koppel. Näitusel näeb eesti klaasikunstnike Mare Saare, Ivo Lille, Rait Präätsa jt. töid
African Journals Online (AJOL)
Items 951 - 1000 of 1346 ... Vol 32, No 3 (2015), Silvopastoral system based on Ficus thonningii: an adaptation to climate change in northern Ethiopia, Abstract. M Balehegn, L.O. Eik, Y Tesfay. Vol 6, No 1 (1971), Simple model for crop photosynthesis in terms of weather variables and crop character, Abstract. de Jager JM.
Kunstitudengid näitavad Maarjamäe lossi pargis oma vabadussamba tõlgendusi
2008-01-01
Eesti Kunstiakadeemia skulptuuritudengid Marit Mardla, Matthias-Jakob Sildnik, Mikk Madisson, Liis Dvorjanski, Uku Sepisvart, Hannes Aasamets, Kadri Allekand, Kristin Orav, Loore Raav, Jekaterina Kultajeva, Li Yang, Kristel Aasjõe, Liivi Tantaal, Jass Kaselaan, Edith Karlson, Kadri Metstak, Berit Talpsepp ja Eike Eplik näitavad oma töid näitusel "Vabaduse monumendid"
Energy Technology Data Exchange (ETDEWEB)
Lowe, G A; Richardson, D J [Univ. of the West of England, Faculty of Engineering, Bristol (United Kingdom)
1996-09-01
Within the EC project JOULE 2, the University of the West of England (UWE) tested a carbon fibre reinforced epoxy (CFRE) full scale wind turbine blade together with an associated material test coupon programme. All the work was closely linked with the manufacturer Polymarine BV of the Netherlands, who designed and manufactured the blade and provided test specimens, the UWE carried out the research into the validation of the design calculations together with a check of the strength and fatigue life of the blade. (au)
Construct Validity of Three Self-Report Measures of Creativity.
Fleenor, John W.; Taylor, Sylvester
1994-01-01
Relations were examined among the CPI Creativity Scale (CPI-CT), the MBTI Creativity Index (MBTI-CI), and the Kirton Adaption-Innovation Inventory (KAI; a style measure of behavioral preference) for samples of 431 to 12,115 managers. KAI scores were related to CPI-CT and MBTI-CI creativity levels. (SLD)
Brand Extensions: A Qualitative Meta-Analysis Of 20 Years Of Marketing Research
Elise Prosser; Melissa St. James
2011-01-01
Brand extensions, or new product introductions under an existing brand name, have become increasingly popular over the past 20 years. Marketers tout brand extensions as enjoying higher market share and profitability than launching new brand names that require exorbitant advertising expenditures (Smith & Park 1992). According to some estimates, brand extensions account for more than 90% of new product introductions in some categories (Volckner & Sattler 2002). However, one study found that 27%...
Koletis sündis kurvast eluloost / Eike Kingsepp
Kingsepp, Eike
2007-01-01
Mängufilm "Koletis" ("Monster") : režissöör ja stsenarist Patty Jenkins : peaosas Charlize Theron : Ameerika Ühendriigid - Saksamaa 2003. Peaosatäitja prototüübiks oli USA naissarimõrvar Aileen Wuornos
Mida loed sina? / Indrek Hargla
Hargla, Indrek, pseud., 1970-
2007-01-01
Tutvustus: Pérez-Reverte, Arturo. Dumas̀ klubi ehk Richelieu vari. Tallinn : Varrak, 2006 ; Belials, Veiko. Jumalate vandenõu. Tallinn : Varrak, 2006 ; Põder, Rein. Eike. Tallinn : Eesti Raamat, 2006 ; Reeve, Philip. Kuldseeklid. Tallinn : Tiritamm, 2006 ; Martin, George R. R. Troonide mäng. Esimene raamat / tlk. Mario Kivistik. Tallinn : Varrak, 2006. (Jää ja tule laul) (F-sari)
CSIR ScienceScope: Art and science of modelling and simulation
CSIR Research Space (South Africa)
CSIR
2008-03-01
Full Text Available -2780 I CSRR Ma)ewialx Science and Manufac)uwing Pretoria 012 841-4392 Johannesburg 011 482-1300 Port olizabeth 041 508-3200 Cape Town 021 685-4329 I CSRR Na)uwal Rexouwcex and )he En0iwonmen) Pretoria 012 841-4005 Johannesburg 011 358...) En0iwonmen) Pretoria 012 841-3871 Stellenbosch 021 888-2508 I CSRR Defencec Neacec Safe)y and Secuwi)y Pretoria 012 841-2780 I CSRR Ma)ewialx Science and Manufac)uwing Pretoria 012 841-4392 Johannesburg 011 482-1300 Port olizabeth 041 508...
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-05-01
The paper arranged the FY 2000 results of the field test on the photovoltaic power generation for public facility use, etc. This report described in detail the results obtained at 237 places including the following: Social Welfare Corp. Seimei-kai, Kobe City (Hyogo Prefecture), Iitaka Town of Iinan County (Mie Prefecture), Kyushu Electric Safety Association, Educational Corp. Kongo Gakuen, Social Welfare Corp. Izumi-kai, Educational Corp. Shiobara Ikuei-kai, Educational Corp. Aiko Gakuen, Social Welfare Corp. Tachibana-kai, Cooperative Association Co-op Kobe, Social Welfare Corp. Hoshizuki-no-sato, Tochigi-Fuji Industrial Co., Hirabayashi Section of Gamo Town of Gamo County (Shiga Prefecture), Yanagawa City (Fukuoka Prefecture), Imadate City of Imadate County (Fukui Prefecture), Osaka Prefecture, Yamanashi Prefecture, Utazu Town of Ayauta County (Kagawa Prefecture), Educational Corp. Fukuyama Gakuen, New Energy Business Cooperative Association, Meitec Corp., Shikoku Medicom Co., Shizen Kobo Co., Educational Corp. Horikoshi Gakuen, Matama Town of Nishi-Kunisaki County (Oita Prefecture), Nio Town of Mitoyo County (Kagawa Prefecture), Educational Corp. Koshien Gakuin, Sansei Giken Co., Mitsui Greenland Co., AWI Mach Co., Nagoya City and Educational Corp. Kibogaoka Gakuen. (NEDO)
Directory of Open Access Journals (Sweden)
Jian Li
Full Text Available Refined Qing-Kai-Ling (QKL, a modified Chinese medicine, consists of three main ingredients (Baicalin, Jasminoidin and Desoxycholic acid, plays a synergistic effect on the treatment of the acute stage of ischemic stroke. However, the rules of the combination and synergism are still unknown. Based on the ischemic stroke mice model, all different kinds of combination of Baicalin, Jasminoidin, and Desoxycholic acid were investigated by the methods of neurological examination, microarray, and genomics analysis. As a result, it confirmed that the combination of three drugs offered a better therapeutical effect on ischemic stroke than monotherapy of each drug. Additionally, we used Ingenuity pathway Analysis (IPA and principal component analysis (PCA to extract the dominant information of expression changes in 373 ischemia-related genes. The results suggested that 5 principal components (PC1-5 could account for more than 95% energy in the gene data. Moreover, 3 clusters (PC1, PC2+PC5, and PC3+PC4 were addressed with cluster analysis. Furthermore, we matched PCs on the drug-target networks, the findings demonstrated that Baicalin related with PC1 that played the leading role in the combination; Jasminoidin related with PC2+PC5 that played a compensatory role; while Desoxycholic acid had the least performance alone which could relate with PC3+PC4 that played a compatible role. These manifestations were accorded with the principle of herbal formulae of Traditional Chinese Medicine (TCM, emperor-minister-adjuvant-courier. In conclusion, we firstly provided scientific evidence to the classic theory of TCM formulae, an initiating holistic viewpoint of combination therapy of TCM. This study also illustrated that PCA might be an applicable method to analyze the complicated data of drug combination.
Algasid etendustesarja "Suveaaria 2009" proovid / Silja Joon
Joon, Silja, 1966-
2009-01-01
10. juulist 10. augustini Pärnu Vanalinna Põhikooli õuel toimuvast Pärnu Ooperi korraldatavast etendustesarjast "Suveaaria", mille raames tuuakse installatsioon-ooperite sarjas "Kataloog" uuena välja soprani ja tenori duettide projekt "Armustseene kvaliteetooperitest" (laulavad Kai Kallastu ja Roland Liiv, etenduse lavastaja on koreograaf Kaspar Aus, kunstnik Pille Neeve, muusikalise lahenduse eest vastutavad heliloojad Andrus Kallastu ja Hans-Gunter Lock ning pianist Jorma Toots). Korratakse "Hullumisstseene kvaliteetooperitest" (esinevad sopran Kai Kallastu ja flötist Leonora Palu) ja eelmisel aastal mudaravilasse komponeeritud Locki eksperimentaalset muusikateatrietendust "Mudamuusikateraapia laboratoorium". Esitatakse Andrus Kallastu loomingul põhinev müsteerium "Valgus ja vari", milles kõlab "Stabat mater" elektroonikale, "Stabat mater" häälele (laulab Kai Kallastu, saateks Anima Mea elektroonika)
Directory of Open Access Journals (Sweden)
Jean Pierre Matus A.
2005-01-01
Full Text Available En este artículo se reseña el texto del Prof. Dr. Kai Ambos, Der Allgemeine Teil des Völkerstrafrechts y, al mismo tiempo, se propone la aplicación de los principales resultados de esa obra para un eventual enjuiciamiento de la tortura masiva y sistemática aplicada en Chile entre 1973 y 1990, tal y como se describe en el Informe de la Comisión Nacional de Prisión Política y Tortura (Informe Valech. Así, se comienza describiendo y analizando la sistematización propuesta por Ambos para una parte general del derecho penal internacional, luego se analiza la tortura como crimen contra la humanidad, sujeto a las reglas del derecho penal internacional. En este apartado se determinan sus elementos principales (el carácter masivo y sistemático, el Tribunal competente en Chile para conocer de estas causas y el procedimiento aplicable. A continuación se describen los hechos, tal y como se dieron a conocer en el Informe Valech, que permiten concluir que en Chile se aplicó la tortura de manera masiva y sistemática durante el régimen militar, favorecida por éste, mediante el establecimiento de una "maquinaria" de represión "legalizada". Enseguida, se determina la existencia de una responsabilidad penal internacional individual derivada de estos hechos, para, a continuación, pasar a analizar los principales problemas de la parte general del derecho penal internacional que se presentarían en el caso de juzgarse tales responsabilidades individuales, siguiendo el esquema de análisis en dos niveles propuesto por Kai Ambos, a saber, discutiendo primero los presupuestos objetivos y subjetivos de esa responsabilidad, para finalizar analizando las principales defensas que podrían oponerse por los eventuales acusados.This article reviews Prof. Dr. Kai Ambos' book, Der Allgemeine Teil des Völkerstrafrechts, and proposes the application of the main results of this book to the possible trial of the acts of massive and systematic torture carried out
Buchanan, Teresa M; Reilly, Patricia M; Vafides, Carol; Dykes, Patricia
Stress and anxiety are experienced by health care providers as a consequence of caregiving and may result in physical, emotional, and psychological outcomes that negatively impact work engagement. The purpose of this study was to determine whether auricular acupuncture can reduce provider anxiety and improve work engagement. Study participants received 5 auricular acupuncture sessions within a 16-week period utilizing the National Acupuncture Detoxification Association protocol for treating emotional trauma. Each participant completed the State-Trait Anxiety Inventory and the Utrecht Work Engagement Scale (UWES-9) prior to their first session and again after their fifth treatment. Significant reductions were found in state and trait anxiety (State-Trait Anxiety Inventory), as well as significant increases in the overall scores on the UWES as compared with baseline. Only the dedication subcategory of the UWES showed significant improvement. Engagement has been linked to increased productivity and well-being and improved patient and organizational outcomes. Providing effective strategies such as auricular acupuncture to support health care providers in reducing anxiety in the workplace may improve engagement.
The struggle with employee engagement: Measures and construct clarification using five samples.
Byrne, Zinta S; Peters, Janet M; Weston, James W
2016-09-01
Among scholarly researchers, the Utrecht Work Engagement Scale (UWES) is a popular scale for assessing employee or work engagement. However, challenges to the scale's validity have raised major concerns about the measurement and conceptualization of engagement as a construct. Across 4 field samples, we examined 2 measures of engagement, the UWES and the Job Engagement Scale (JES), in both factor structure and patterns of relationships with theoretically hypothesized antecedents and consequences. In a fifth field sample, we examined the construct-level relationships between engagement and related variables, while controlling for sources of measurement error (i.e., item-specific factor, scale-specific factor, random response, and transient). By examining 2 measures, each derived from different theoretical bases, we provide unique insight into the measurement and construct of engagement. Our results show that, although correlated, the JES and UWES are not interchangeable. The UWES, more so than the JES, assesses engagement with overlap from other job attitudes, requiring improvement in the measurement of engagement. We offer guidance as to when to use each measure. Furthermore, by isolating the construct versus measurement of engagement relative to burnout, commitment, stress, and psychological meaningfulness and availability, we determined (a) the engagement construct is not the same as the opposite of burnout, warranting a reevaluation of the opposite-of-burnout conceptualization of engagement; and (b) psychological meaningfulness and engagement are highly correlated and likely reciprocally related, necessitating a modification to the self-role-expression conceptualization of engagement. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
Iisraelis tabati vene natsid / Uwe Gnadenteich
Gnadenteich, Uwe
2007-01-01
Iisraelis vahistati neonatside rühm, mille liikmed on pärit endise NSVL-i aladelt. Parlamendiliikmed tahavad neilt kodakondsuse ära võtta ja nad Iisraelist välja saata, selle vastu on asepeaminister Avigdor Lieberman
The validation of the Utrecht work engagement scale for emergency medical technicians in Gauteng
Directory of Open Access Journals (Sweden)
JLP Naudé
2004-04-01
Full Text Available The objectives of this study were to validate the Utrecht Work Engagement Scale (UWES for emergency medical technicians in the Gauteng Province of South Africa and to determine its construct equivalence and bias for different language groups. A cross-sectional survey design was used with a convenient sample (N = 318 of emergency medical technicians in Gauteng. The UWES and a biographical questionnaire were administered. A two-factor model of work engagement, consisting of Vigour/Dedication and Absorption was found. Exploratory factor analysis with target rotations confirmed the construct equivalence of the work engagement construct for white and black employees.
Impact of Flight Departure Delay on Airline Choice Behavior
Directory of Open Access Journals (Sweden)
Taylor Tae-Hwee Lee
2017-12-01
Full Text Available The Korean aviation industry (KAI has been expanded significantly, because the Incheon International Airport opened in 2001 and low cost carriers (LCC entered the KAI market. But following the KAI's growth, flight departure delays (FDDs have increased six-fold during the past decade. In terms of these situations, this study firstly adds the FDD variable to an airline choice behavior (ACB model and secondly analyses how FDD impact the ACB. As a result, FDD is relatively less influential on ACB than other attributes. Both the flight service and available schedule are positively related to the choice of full service carriers (FSC. The analysis shows that FSCs’ allotment rate (AR is 85.3%, while LCCs’ one is 14.7%.
El argumento de probabilidad (τὸ εἰκός en la retórica griega
Directory of Open Access Journals (Sweden)
Heiner Mercado Percia
2015-01-01
Full Text Available Los discursos de oradores como Isócrates, Gorgias, Antifonte, Lisias, entre otros, e igualmente, los dos tratados de retórica que conservamos de la segunda mitad del siglo IV a. C no sólo pueden considerarse como piezas literarias construidas con gran habilidad o como manuales con recetas para aplicar, sino como fuente de conceptos de interés para la filosofía. En este artículo se analiza uno de esos conceptos, τὸ εἰκός. Traducido normalmente como “probable” o “verosímil”, los eikóta son recursos argumentativos utilizados desde los orígenes de la práctica de arte retórico, sobre todo en espacios judiciales y, particularmente, fueron usados en aquellos litigios en los que la falta de testigos o testimonios hacía difícil inclinar favorablemente al juez. Pero también los eikóta ocuparon el centro de la crítica platónica por ser definidos como opuestos a la verdad (ἀλήθεια.
Capillary Condensation in Confined Media
Charlaix, Elisabeth; Ciccotti, Matteo
2009-01-01
28 pages - To appear in 2010 in the Handbook of Nanophysics - Vol 1 - Edited by Klaus Sattler - CRC Press; We review here the physics of capillary condensation of liquids in confined media, with a special regard to the application in nanotechnologies. The thermodynamics of capillary condensation and thin film adsorption are first exposed along with all the relevant notions. The focus is then shifted to the modelling of capillary forces, to their measurements techniques (including SFA, AFM and...
Directory of Open Access Journals (Sweden)
eyed Ataollah Sadat Shandiz
2016-02-01
Full Text Available Objective: To evaluate the effect of imatinib mesylate on KAI1 gene expression and apoptosis properties in human gastric carcinoma AGS cell line. Methods: Cell viability was assessed by MTT assay and quantitative real time PCR method was applied for investigation of Bax, Bcl-2, and KAI1 gene expression in AGS cells. The quantity of KAI1, Bax, and Bcl-2 compared to GAPDH gene expressions were examined using the formula 2-∆∆Ct. Furthermore, cell apoptosis/necrosis was carried out by annexin V/PI staining and quantified with flow cytometry after treatment with imatinib. Results: Imatinib mesylate was showed to have a dose-dependent toxicity effect against AGS cells. KAI1/GAPDH gene expression ratios were 1.07 ± 0.02 (P > 0.05, 1.68 ± 0.19 (P > 0.05, 3.60 ± 0.55 (P < 0.05, 6.54 ± 0.27 (P < 0.001 for 20, 50, 80 and 100 μmol/L of imatinib concentrations. The mRNA levels of Bax detected by real-time PCR after treatment with imatinib mesylate were significantly increased. Also, the number of apoptotic cells was increased from 3.72% (statistically significant; P < 0.05 in untreated AGS cells to 21.72%, 83.04% and 85.80%, respectively, following treatment with 20, 40, and 60 μmol/L imatinib mesylate. Conclusions: The results suggest that imatinib mesylate can induce apoptosis pathway in a dose-dependent mode and might modulate metastasis by up regulating KAI1 gene expression in human gastric carcinoma AGS cell line.
The effects of hydrogen peroxide on the circadian rhythms of Microcystis aeruginosa.
Directory of Open Access Journals (Sweden)
Haifeng Qian
Full Text Available BACKGROUND: The cyanobacterium Microcystis aeruginosa is one of the principal bloom-forming cyanobacteria present in a wide range of freshwater ecosystems. M. aeruginosa produces cyanotoxins, which can harm human and animal health. Many metabolic pathways in M. aeruginosa, including photosynthesis and microcystin synthesis, are controlled by its circadian rhythms. However, whether xenobiotics affect the cyanobacterial circadian system and change its growth, physiology and biochemistry is unknown. We used real-time PCR to study the effect of hydrogen peroxide (H(2O(2 on the expression of clock genes and some circadian genes in M. aeruginosa during the light/dark (LD cycle. RESULTS: The results revealed that H(2O(2 changes the expression patterns of clock genes (kaiA, kaiB, kaiC and sasA and significantly decreases the transcript levels of kaiB, kaiC and sasA. H(2O(2 treatment also decreased the transcription of circadian genes, such as photosynthesis-related genes (psaB, psbD1 and rbcL and microcystin-related genes (mcyA, mcyD and mcyH, and changed their circadian expression patterns. Moreover, the physiological functions of M. aeruginosa, including its growth and microcystin synthesis, were greatly influenced by H(2O(2 treatment during LD. These results indicate that changes in the cyanobacterial circadian system can affect its physiological and metabolic pathways. CONCLUSION: Our findings show that a xenobiotic can change the circadian expression patterns of its clock genes to influence clock-controlled gene regulation, and these influences are evident at the level of cellular physiology.
Fuel cells science and engineering. Materials, processes, systems and technology. Vol. 2
Energy Technology Data Exchange (ETDEWEB)
Stolten, Detlef; Emonts, Bernd (eds.) [Forschungszentrum Juelich GmbH (DE). Inst. fuer Energieforschung (IEF), Brennstoffzellen (IEF-3)
2012-07-01
The second volume is divided in four parts and 19 chapters. It is structured as follows: PART V: Modeling and Simulation. Chapter 23: Messages from Analytical Modeling of Fuel Cells (Andrei Kulikovsky); 24: Stochastic Modeling of Fuel-Cell Components (Ralf Thiedmann, Gerd Gaiselmann, Werner Lehnert and Volker Schmidt); 25: Computational Fluid Dynamic Simulation Using Supercomputer Calculation Capacity (Ralf Peters and Florian Scharf); 26 Modeling Solid Oxide Fuel Cells from the Macroscale to the Nanoscale (Emily M. Ryan and Mohammad A. Khaleel); 27: Numerical Modeling of the Thermomechanically Induced Stress in Solid Oxide Fuel Cells (Murat Peksen); 28: Modeling of Molten Carbonate Fuel Cells (Peter Heidebrecht, Silvia Piewek and Kai Sundmacher); Chapter 29: High-Temperature Polymer Electrolyte Fuel-Cell Modeling (Uwe Reimer); Chapter 30: Modeling of Polymer Electrolyte Membrane Fuel-Cell Components (Yun Wang and Ken S. Chen); 31: Modeling of Polymer Electrolyte Membrane Fuel Cells and Stacks (Yun Wang and Ken S. Chen). PART VI: Balance of Plant Design and Components. Chapter 32: Principles of Systems Engineering (Ludger Blum, Ralf Peters and Remzi Can Samsun); 33: System Technology for Solid Oxide Fuel Cells (Nguyen Q. Minh); 34: Desulfurization for Fuel-Cell Systems (Joachim Pasel and Ralf Peters); 35: Design Criteria and Components for Fuel Cell Powertrains (Lutz Eckstein and Bruno Gnoerich); 36: Hybridization for Fuel Cells (Joerg Wilhelm). PART VII: Systems Verification and Market Introduction. Chapter 37: Off-Grid Power Supply and Premium Power Generation (Kerry-Ann Adamson); 38: Demonstration Projects and Market Introduction (Kristin Deason). PART VIII: Knowledge Distribution and Public Awareness. Chapter 39: A Sustainable Framework for International Collaboration: the IEA HIA and Its Strategic Plan for 2009-2015 (Mary-Rose de Valladares); 40: Overview of Fuel Cell and Hydrogen Organizations and Initiatives Worldwide (Bernd Emonts) 41: Contributions for
Magistritööd : [Olga Volossova jt.
2000-01-01
20. sept. 2000 kaitseb TPÜ-s matemaatika magistritööde kaitsmisnõukogu ees Olga Volossova magistritööd "Liftingud q-mõõtuvates ruumides". 27. sept. kaitseb TPÜ-s sotsiaaltöö magistrinõukogu ees Eike Käsi magistritööd "Tööjuhendamine sotsiaaltöös" ja Maarika Pukk magistritööd "Koolieeliku elukeskkond lasteasutuses : Reggio-Emilia meetodi rakendamine Eestis"
The liquid scintillation counter of the NAVF-It-district Central Norway
International Nuclear Information System (INIS)
Traetteberg, J.
1979-01-01
NAVF have placed an automatic liquid sciuntillation counter at the disposal of Prof. K. Eik-Nes of the Institute of Biophysics at Trondheim Univ.,Norges Tekniske Hoegskole. The instrument is an uncooled Searle Isocap 300, and is mainly used in biochemical research with radioactive tracers. The apparatus and its operation in 1978 are briefly described. Experience has shown that the instrument is very reliable. (JIW)
Liiketoimintasuunnitelma aloittavalle yritykselle : Tilitoimisto TiliEnna Oy
Rinne, Enna
2015-01-01
Opinnäytetyön tavoitteena oli luoda toimiva liiketoimintasuunnitelma perustettavalle tilitoimistolle. Tavoitteena oli luoda liiketoimintasuunnitelma, joka on toteutettavissa ja jonka avulla aloittava yrittäjä voi kiinnittää huomiota kaikkiin yrityksen perustamisen kannalta olennaisiin seikkoihin. Yrityksen perustaminen ei ole riskitöntä, eikä sitä kannata tehdä hetken mielijohteesta. Huolellisilla esivalmisteluilla ja riskit tiedostamalla, voi uuden yrityksen perustaminen parhaimmillaan tarjo...
Directory of Open Access Journals (Sweden)
Xu X
2017-03-01
Full Text Available Xu-Dong Xu,1 Han-Bin Shen,1 Li Zhu,2 Jian-Qin Lu,2 Lin Zhang,3 Zhi-Yong Luo,3 Ya-Qun Wu3 1Department of Thyroid and Breast Surgery, The Fifth Hospital of Wuhan, Hanyang District, 2Department of Oncology, 3Department of Thyroid and Breast Surgery, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, Hubei, People’s Republic of China Abstract: Overexpression of RhoC in breast cancer cells indicates poor prognosis. In the present study, we aim to investigate the possible antitumor effects of anti-RhoC small-interfering RNA (siRNA in inflammatory breast cancer cells. In this study, a specific anti-RhoC siRNA was used to inhibit RhoC synthesis. Transfection of anti-RhoC siRNA into two IBC cells SUM149 and SUM190 induced extensive degradation of target mRNA and led to significant decrease in the synthesis of protein. Anti-RhoC siRNA inhibited cell proliferation and invasion, increased cell apoptosis, and induced cell cycle arrest in vitro. Moreover, the transfection of siRNA increased the expression of KAI1 and decreased the expression of MMP9 and CXCR4 in both mRNA and protein levels. Furthermore, transplantation tumor experiments in BALB/c-nu mice showed that intratumoral injection of anti-RhoC siRNA inhibited tumor growth and increased survival rate. Our results suggested that RhoC gene silencing with specific anti-RhoC siRNA would be a potential therapeutic method for metastatic breast cancer. Keywords: gene silencing, proliferation, apoptosis, cell cycle arrest
Kemp, Thomas F; Dannatt, Hugh R W; Barrow, Nathan S; Watts, Anthony; Brown, Steven P; Newton, Mark E; Dupree, Ray
2016-04-01
A Dynamic Nuclear Polarisation (DNP) enhanced solid-state Magic Angle Spinning (MAS) NMR spectrometer which uses a 187 GHz (corresponding to (1)H NMR frequency of 284 MHz) Extended Interaction Klystron (EIK) amplifier as the microwave source is briefly described. Its performance is demonstrated for a biomolecule (bacteriorhodopsin), a pharmaceutical, and surface functionalised silica. The EIK is very compact and easily incorporated into an existing spectrometer. The bandwidth of the amplifier is sufficient that it obviates the need for a sweepable magnetic field, once set, for all commonly used radicals. The variable power (CW or pulsed) output from the EIK is transmitted to the DNP-NMR probe using a quasi-optic system with a high power isolator and a corrugated waveguide which feeds the microwaves into the DNP-NMR probe. Curved mirrors inside the probe project the microwaves down the axis of the MAS rotor, giving a very efficient system such that maximum DNP enhancement is achieved with less than 3 W output from the microwave source. The DNP-NMR probe operates with a sample temperature down to 90K whilst spinning at 8 kHz. Significant enhancements, in excess of 100 for bacteriorhodopsin in purple membrane (bR in PM), are shown along with spectra which are enhanced by ≈25 with respect to room temperature, for both the pharmaceutical furosemide and surface functionalised silica. These enhancements allow hitherto prohibitively time consuming experiments to be undertaken. The power at which the DNP enhancement in bR in PM saturates does not change significantly between 90K and 170 K even though the enhancement drops by a factor of ≈11. As the DNP build up time decreases by a factor 3 over this temperature range, the reduction in T1n is presumably a significant contribution to the drop in enhancement. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Employee engagement within the NHS: a cross-sectional study.
Jeve, Yadava Bapurao; Oppenheimer, Christina; Konje, Justin
2015-02-01
Employee engagement is the emotional commitment of the employee towards the organisation. We aimed to analyse baseline work engagement using Utrecht Work Engagement Scale (UWES) at a teaching hospital. We have conducted a cross-sectional study within the National Health Service (NHS) Teaching Hospital in the UK. All participants were working age population from both genders directly employed by the hospital. UWES has three constituting dimensions of work engagement as vigor, dedication, and absorption. We conducted the study using UWES-9 tool. Outcome measures were mean score for each dimension of work engagement (vigor, dedication, absorption) and total score compared with control score from test manual. We found that the score for vigor and dedication is significantly lower than comparison group (Pengagement level is below average within the NHS employees. Vigor and dedication are significantly lower, these are characterised by energy, mental resilience, the willingness to invest one's effort, and persistence as well as a sense of significance, enthusiasm, inspiration, pride, and challenge. The NHS employees are immersed in work. Urgent need to explore strategies to improve work engagement as it is vital for improving productivity, safety and patient experience.
Employee engagement within the NHS: a cross-sectional study
Jeve, Yadava Bapurao; Oppenheimer, Christina; Konje, Justin
2015-01-01
Background: Employee engagement is the emotional commitment of the employee towards the organisation. We aimed to analyse baseline work engagement using Utrecht Work Engagement Scale (UWES) at a teaching hospital. Methods: We have conducted a cross-sectional study within the National Health Service (NHS) Teaching Hospital in the UK. All participants were working age population from both genders directly employed by the hospital. UWES has three constituting dimensions of work engagement as vigor, dedication, and absorption. We conducted the study using UWES-9 tool. Outcome measures were mean score for each dimension of work engagement (vigor, dedication, absorption) and total score compared with control score from test manual. Results: We found that the score for vigor and dedication is significantly lower than comparison group (Pemployees. Vigor and dedication are significantly lower, these are characterised by energy, mental resilience, the willingness to invest one’s effort, and persistence as well as a sense of significance, enthusiasm, inspiration, pride, and challenge. The NHS employees are immersed in work. Urgent need to explore strategies to improve work engagement as it is vital for improving productivity, safety and patient experience PMID:25674571
Zhang, Xia; Ma, Jin; Wang, Yuhan; Li, Lüe; Gao, Lu; Guo, Xiaopeng; Xing, Bing; Zhong, Yong
2018-03-01
1) To compare the retinal, choroidal, Haller's layer, and Sattler's/choriocapillaris thicknesses of untreated acromegaly patients without chiasm compression or diabetes mellitus and healthy controls. 2) To evaluate the correlations of retinal and choroidal thicknesses with serum growth hormone (GH) and insulin-like growth factor 1 (IGF) burden. This prospective, case-control study included 27 untreated acromegaly patients and 27 sex-matched and age-matched controls. Subfoveal choroidal, Haller's layer and Sattler's/choriocapillaris thicknesses were determined by enhanced-depth imaging optical coherence tomography (EDI-OCT). Foveal and macular retinal thicknesses were determined with SD-OCT. GH and IGF-1 burdens were defined as the product of disease duration and treatment-naïve serum GH and IGF-1 levels. Compared with healthy controls, patients with acromegaly exhibited significantly increased foveal retinal (p = 0.003), subfoveal choroidal (p IGF-1 level (p = 0.03) and IGF-1 burden (p = 0.009). No significant correlations were detected between choroidal thickness and GH burden (p = 0.44). Retinal thickness was not significantly correlated with any factor. The choroidal thickness of acromegaly patients was greater than that of healthy controls and was significantly correlated with disease duration, IGF-1 level and IGF-1 burden, indicating that excessive serum IGF-1 and its exposure time have a combined effect on choroidal thickness.
Low power high growth rate deposition of microcrystalline silicon
Feltrin, A; Bugnon, G; Meillaud, F; Bailat, J; Ballif, C
2008-01-01
Microcrystalline growth regimes and solar cells obtained in different pressure and silane depletion conditions are studied in a large area KAI-S plasma reactor. The microcrystalline material quality is systematically investigated by Fourier Transform Photocurrent Spectroscopy (FTPS) to evaluate the defect density. It is shown that higher pressure and silane depletion positively affect the material quality. A clear correlation between FTPS measurements and cell efficiency is established, showi...
ORF Alignment: NC_005861 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Parachlamydia sp. UWE25] ... Length = 287 ... Query: 222 RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDG...LAHLTPLTALQHLD 281 ... RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDGLAHLT...PLTALQHLD Sbjct: 1 ... RFSKKIEALNFSENAYLTDAHLLALKVCKNLKVLHLEACQAITDDGLAHLTPLTALQHLD 60 ... Query: 342 GLVHLSPLIAL
Keskkonnatoetuse küsijaid tuleb aina juurde / Eike Lepmets
Lepmets, Eike
2005-01-01
Vt. ka Molodjozh Estonii : Krestjanin 3. dets. lk. 3.Põllumajanduslike keskkonnatoetuste taotlemisest 2005. aastal: koos 2004. aastal kohustuse võtnud tootjatega oli keskkonnatoetuse taotlejaid 6086
Klaasarhitektuur Berliinis / Pille Nagel
Nagel, Pille
2004-01-01
Helmut Jahni loodud Sony keskus (1993...2000) ja Kranzlereck (1992...2000), Potsdami platsi jaam (bürood Hilmer & Sattler und Albrecht, Modersohn & Freiesleben ja Hermann + Öttl, 1997...2000), intelligentse klaasfassaadiga Debise büroohoone (Renzo Piano koostöös Critoph Kohlbeckeriga, 1991...1997) ja GSW büroohoone (Sauerbruch Hutton Architekten, 1995...1999), topeltfassaadiga Nordrhein-Westfaleni liidumaade esindushoone (Petzinka Pink Architekten, 2000/2001), Riigipäevahoone klaaskuppel (Foster ja Partnerid, 1992...1999), klaaskatusega DZ-Pank (Frank Owen Gehry, 1996...1999)
Uudiseid maailmast / Nele-Eva Steinfeld
Steinfeld, Nele-Eva
2012-01-01
Lühisõnumeid muusikamaailmast: Helena Tulve ja Jaan-Eik Tulve pälvisid Prantsuse Kunstide ja Kirjanduse ordeni. Arnold Schönbergi dokumentaalne vara kuulutati maailmapärandiks. Pärdi "Lamentate" Philip Glassi juubelikontserdil. Suri Gustav Leonhardt. Hildegard von Bingenile antakse kiriku doktori kraad. Probleemid maailma ooperiteatrites. Suri režissöör Ken Russell. Tulve ja Kozlova teosed festivalil "World Music Days 2012" Belgias. Iisraeli orkestrite tüli
2013-12-01
qualities of side-stick controlled helicopters was given the “Ian Cheeseman Best Paper Award” at the Eu - ropean Rotorcraft Forum 2012. ii As...Forum of the AHS, Phoenix, 2006 35 [22] Gardner, Anthony D., Richter, Kai, Rosemann, Henning : Simulation of Oscillat- ing Airfoils and Moving Flaps...Numerical Methods, 65th Annual Forum of the AHS, Grape- vine, TX, 2009 [26] Gardner, Anthony D., Richter, Kai, Rosemann, Henning : Numerical Investiga
2009-09-01
This implies that a kinetic energy of Ecrit = 1.5 ~ is required for impact ionization [Kai00, Ret04]. The excess energy of 0.5 ~ that remains... Ecrit because the impact ioni- zation rate increases with kinetic energy [Arn92, Kai00, Kel60, Ret04]. To consider both factors, we assume that the...but then neglect it in their theoretical treatment of breakdown [Spa81]. The first comprehensive rate equation model including multiphoton and
Põnevusõpe ehk uutmoodi konverentsid / Anne-Liis Arulo
Arulo, Anne-Liis
2005-01-01
EBS Juhtimiskoolituse Keskuse rahvusvaheliste projektide juht Baltic Development Associatoni 3. aastakonverentsi korraldamisest. Artikkel on valminud koostöös Pathway Guidance Europe asutaja ja partneri Uwe Weissflogiga
Wong, M H; Lau, W M
1985-04-01
An ecological survey was conducted on the roadside vegetation at three different sites: Tai Po, a commercial and residential area (average annual daily traffic (AADT) = 23730; and Shek O and Wu Kai Sha, recreational areas (AADT = 1590 and 20, respectively). Cynodon dactylon and Eleusine indica were the two most dominant species recorded. The Tai Po site had higher Pb contents in both soil and plant, followed by Shek O, and then Wu Kai Sha. Tillers of C. dactylon and E. indica from the three sites were subjected to a series concentrations of Pb(NO3)2. By comparing their indexes of tolerance and values of 14-day EC50 (effective concentration reducing the normal root growth by 50%), roadside populations of the two grasses collected from Tai Po and Shek O, especially the former one, were more tolerant to elevated levels of Pb compared with those collected from Wu Kai Sha.
Sosiaalinen asiakassuhdejohtaminen ja big data
Toivonen, Topi-Antti
2015-01-01
Tässä tutkielmassa käsitellään sosiaalista asiakassuhdejohtamista sekä hyötyjä, joita siihen voidaan saada big datan avulla. Sosiaalinen asiakassuhdejohtaminen on terminä uusi ja monille tuntematon. Tutkimusta motivoi aiheen vähäinen tutkimus, suomenkielisen tutkimuksen puuttuminen kokonaan sekä sosiaalisen asiakassuhdejohtamisen mahdollinen olennainen rooli yritysten toiminnassa tulevaisuudessa. Big dataa käsittelevissä tutkimuksissa keskitytään monesti sen tekniseen puoleen, eikä sovellutuk...
Space-based Solar Power: Possible Defense Applications and Opportunities for NRL Contributions
2009-10-23
the beams (potentially several thousand of them, all to a delivered accuracy of 1 m or less). To further compound the problem, if the beam pointing...diameter parabolic reflectors of hundreds of square meters, each focusing sunlight on small receivers of PV cells, with a concentration ratio (reflector...klystrons (EIKs) can operate at average power levels of 100s of W at somewhat lower efficiencies (~30% to 40% with multistage depressed collectors ). (A
Pragmaatika kui hea kunsti garant / Indrek Grigor
Grigor, Indrek, 1981-
2007-01-01
Tartu Kõrgema Kunstikooli diplomitöödest: Martti Poomi (S'Poom "Na'Miin") ja Asko Kikkuli (Iconcrash "My Sky") muusikavideotest, Kaisa Eiche teoreetilisest uurimusest "Kultuuritehase vajalikkus ja teostatavus Tartus", Carl-Christian Frey animafilmist "Pärastlõuna", Andrus Lauringsoni installatsioonist "Capaskoop", Berit Talpsepa robootilisest skulptuurist "Superheterodüünvastuvõtt", Eike Epliku installatiivsest skulptuurist "Ma saan aru, et ma ei ole orav", Anna-Stina Treumundi fotoinstallatsioonist "Vaikiv dialoog", Kalev Vapperi sotsiaalkollaazhist "Vapper Kalev lõpetab kooli"
UWE: Engaging with industry, creatively [case study
Noonan, A.
2010-01-01
Professional practice and enterprise modules along with a graduate placement scheme prepare design and media students for employability in the creative sector.\\ud \\ud Responding to professional challenges facing graduates and UWE’s Employability Agenda, the Faculty of Creative Arts created an innovative senior academic post specialising in Employability and Creative Industry Liaison in 2007. Senior lecturer Adrienne Noonan works with Communication Design and Media courses on employability, te...
Structural changes of the choroid in sarcoid- and tuberculosis-related granulomatous uveitis
Mehta, H; Sim, D A; Keane, P A; Zarranz-Ventura, J; Gallagher, K; Egan, C A; Westcott, M; Lee, R W J; Tufail, A; Pavesio, C E
2015-01-01
Aim The aim of this study is to characterise the choroidal features of patients diagnosed with sarcoid- and tuberculosis (TB)-associated granulomatous uveitis using spectral domain optical coherence tomography (OCT). Methods Twenty-seven patients (27 eyes) diagnosed with sarcoid- (13 eyes) and TB (14 eyes)-related uveitis were included in this retrospective, cross-sectional study. Over a six-month period, patients diagnosed with sarcoid and TB granulomatous uveitis were scanned using enhanced depth imaging OCT. Clinical and demographical characteristics were recorded, including the method of diagnosis, disease activity, site of inflammation (anterior or posterior), treatments, and visual acuity (VA). Manual segmentation of the choroidal layers was performed using custom image analysis software. Results The main outcome measure was OCT-derived thickness measurements of the choroid and choroidal sublayers (Haller's large vessel and Sattler's medium vessel layers) at the macula region. The ratio of Haller's large vessel to Sattler's medium vessel layer was significantly different at the total macula circle in eyes diagnosed with TB uveitis (1.47 (=140.71/95.72 μm)) compared with sarcoid uveitis (1.07 (=137.70/128.69 μm)) (P=0.001). A thinner choroid was observed in eyes with a VA ≥0.3 LogMAR (Snellen 6/12; 198.1 μm (interquartile range (IQR)=147.0–253.4 μm) compared with those with VA uveitis, and choroidal thickening may be a feature of active granulomatous uveitis. PMID:26021867
Pistulka, Gina M; Winch, Peter J; Park, Hyunjeong; Han, Hae-Ra; Kim, Miyong T
2012-06-01
Type 2 diabetes mellitus (DM) and hypertension (HTN) disproportionately affect minority populations in the United States, including Korean American immigrants (KAI). We conducted qualitative interviews with middle-aged KAI in Maryland living with DM and HTN to examine the illness experience to inform future intervention strategies. Study results show that participants utilized strategies to maintain respect and Korean identity, including an image of being healthy and in control of their behavior in the public arena. These strategies included the lack of disclosure of their illness, even to family members, and avoiding outside assistance when engaging in problem solving. Maintaining an outward image of health was a common goal that affected the self-care of KAI in this study, a finding that might prove significant in the management of other chronic illnesses affecting this population. The study findings demonstrate the importance of in-depth understanding of specific populations when treating chronic illness, and caretakers' sensitivity to each population's unique cultural issues regarding identity, image, and disclosure.
The (temporary?) queering of Japanese TV.
Miller, S D
2000-01-01
One of the primary texts of the "out" queer cinema of Japan is the television serial D s kai, first aired in 1993. Unlike Western television shows positing queer characters, D s kai presents its gay characters without apology or excuses, and as leads rather than as colorful appendages. At the same time, however, the show filters gay eroticism through the (hetero)normative mode of serial melodrama, at once pushing the boundaries of national permissiveness while normalizing and homogenizing homosexuality by rendering it within a conventional form.
Raappana, Emilia
2015-01-01
Toimeksiantajana tälle toiminnalliselle opinnäytetyölle toimii yritys X, joka on suuri Pohjoismaissa toimiva finanssialan yritys. Yrityksessä toimii eräs vasta vuosi sitten perustettu tiimi, jolla ei ole omaa perehdytysopasta lainkaan, vaan perehdytysprosessiin on otettu osia toisilta tiimeiltä. Tästä johtuen perehdytysmallista on puuttunut struktuuri eikä sen laatua ole juurikaan valvottu. Perehdytysoppaalle oli siis suuri tarve yrityksessä, joten se valikoitui opinnäytetyön aiheeksi. Yritys...
Markkinoinnin tuloksellisuuden mittaaminen Koivumäen Kartano Oy:ssä
Kielenniva, Jonna
2015-01-01
Markkinoinnin tuloksellisuutta ei vielä perusteellisesti ymmärretä eikä siitä ole juurikaan tutkittua tietoa. Kuitenkin markkinoinnin tehokkuuden merkitys on viime aikoina huomattu ja yritykset kiinnittävät siihen nykyään enemmän huomiota. Markkinoinnin tuloksellisuuden mittaaminen on vaikeaa, jonka vuoksi harvat yritykset tutkivat omaa markkinointiaan tuloksellisuuden näkökulmasta. Tämän opinnäytetyön aiheena on markkinoinnin tuloksellisuuden mittaaminen Kuopiossa sijaitsevassa ravintola...
Directory of Open Access Journals (Sweden)
Vytautas Rinkevičius
2011-07-01
Full Text Available KLITIKAI PRŪSŲ KALBOJESantraukaPrūsų kalbos III katekizmo rašyba leidžia pakankamai pagrįstai spėti, kad prūsų kalboje du kalbėjimo sraute susidūrę klitikai reguliariai sudarydavę atskirą taktinę grupę (fonologinį žodį, automatiškai kirčiuotą pirmajame skiemenyje. Reiškinys greičiausiai buvęs visiškai fonologinis ir nepriklausęs nuo semantinių ar sintaksinių grupę sudarančių žodžių ypatybių. Dėl nenuoseklios šaltinių rašybos pagrindiniu tokių taktinių grupių nustatymo kriterijumi laikytina ne tiek žodžių rašyba kartu, kiek netikėtas proklitiko kirtis. Dažniausiai tokį kirtį gauna prielinksniai konstrukcijose su vienskiemenėmis įvardžių formomis (pvz., ēnstan, tačiau lygiai taip pat gali būti paaiškintas ir jungtuko kāigi (greta kai kirčiavimas. Ne junginiuose su kitais klitikais tiek prielinksniai, tiek jungtukas kai niekada nebūna kirčiuoti. Tokie atvejai kaip prēistan klausīwingin, pērstans wāldnikans ir kt. rodo, kad klitikai sudarydavę savarankišką taktinę grupę, o ne kartu su nekirčiuotu akcentogeniniu žodžiu.
Personal lifestyle as a resource for work engagement.
Nishi, Daisuke; Suzuki, Yuriko; Nishida, Junko; Mishima, Kazuo; Yamanouchi, Yoshio
2017-01-24
Personal lifestyle, including diet, exercise, and sleep, might have an impact on work engagement, though previous studies have not focused on these relationships. The aim of this study was to examine whether dietary intake of fish, regular exercise, sufficient sleep, abstinence from alcohol, and abstinence from tobacco were positively associated with work engagement. We recruited adults aged 40-74 years who attended the health checkups with a particular focus on the metabolic syndrome in central Tokyo. In December 2015, 797 people responded to a questionnaire and 592 (74.3%) who had regular jobs were selected for this study. Work engagement was assessed on the 9-item Utrecht Work Engagement Scale (UWES-9). Bivariate and multivariate regression analyses were performed to examine the relationships between lifestyle and UWES-9. Dietary intake of fish, regular exercise, sufficient sleep, and abstinence from tobacco were significantly correlated with the total UWES-9 score, even after adjusting for age, sex, and depressive and anxiety symptoms. The results suggested a dose-response relationship between dietary fish intake and work engagement. Dietary fish intake, regular exercise, sufficient sleep, and abstinence from tobacco might be lifestyle factors that can serve as resources for work engagement. These findings could be useful in motivating employees to make lifestyle improvements and convincing employers and managers that lifestyle is important not only for health but also for productivity.
Employee Engagement within the NHS: A Cross-Sectional Study
Directory of Open Access Journals (Sweden)
Yadava Bapurao Jeve
2015-02-01
Full Text Available Background Employee engagement is the emotional commitment of the employee towards the organisation. We aimed to analyse baseline work engagement using Utrecht Work Engagement Scale (UWES at a teaching hospital. Methods We have conducted a cross-sectional study within the National Health Service (NHS Teaching Hospital in the UK. All participants were working age population from both genders directly employed by the hospital. UWES has three constituting dimensions of work engagement as vigor, dedication, and absorption. We conducted the study using UWES-9 tool. Outcome measures were mean score for each dimension of work engagement (vigor, dedication, absorption and total score compared with control score from test manual. Results We found that the score for vigor and dedication is significantly lower than comparison group (P< 0.0001 for both. The score for absorption was significantly higher than comparison group (P< 0.0001. However, total score is not significantly different. Conclusion The study shows that work engagement level is below average within the NHS employees. Vigor and dedication are significantly lower, these are characterised by energy, mental resilience, the willingness to invest one’s effort, and persistence as well as a sense of significance, enthusiasm, inspiration, pride, and challenge. The NHS employees are immersed in work. Urgent need to explore strategies to improve work engagement as it is vital for improving productivity, safety and patient experience.
Ruumieelikutest kogukonnaeelikuteni = From proto-spaces to proto-communities / Eik Hermann
Hermann, Eik
2012-01-01
Ärgitavast ruumist. Ärgitava ruumi ja ärksa kogukonna vastastiktekkimisest. Ärgitavast ruumist avaliku linnaruumi kontekstis. Linnalistest sekkumistest: sodimine, installatiivsete väikevormide loomine jm. Üllatusruumide spektrist: vasturuum, etendusruum, mänguruum
Freedom in the time of oppression in L. Gutauskas’ novels “Letters from Viešvilė” and “The Feathers”
Bernotienė, Gintarė
2011-01-01
In the novels "Laiškai iš Viešvilės" ("Letters from Viešvilė") and "Plunksnos" ("The feathers") Leonardas Gutauskas considers themes of freedom and artistic creation, which in certain political situation are closely related to the problem of individual freedom and restriction of liberty in the annexed country as well. According to the metaphor of the novel "Laiškai iš Viešvilės", in the time of oppression characters live their lives as bounded by wire mesh, and despite of that freedom in this...
TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame
Saame, Koidu
2010-01-01
Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen
Lv, Chunxiao; Li, Qing; Zhang, Xiaowen; He, Bosai; Xu, Huarong; Yin, Yidi; Liu, Ran; Liu, Jingjing; Chen, Xiaohui; Bi, Kaishun
2014-05-01
A fast, selective, and quantitative ultra-fast liquid chromatography with tandem mass spectrometry method has been developed and validated for the simultaneous quantitation of polygalaxanthone III, ginsenoside Rb1, ginsenoside Rd, ginsenoside Re, and ginsenoside Rg1 in the plasma of rat and beagle dog after oral administration of Kai-Xin-San. After addition of the internal standard, salidroside, the plasma samples were extracted by liquid-liquid extraction and separated on a Venusil MP C18 column with methanol/0.01% acetic acid water as mobile phase. The tandem mass spectrometric detection was performed in the multiple reaction monitoring with turbo ion spray source in a switching ionization mode. The method was examined, and found to be precise and accurate with the linearity range of the compounds. The intra- and interday precision and accuracy of the analytes were well within acceptance criteria (±15%). The mean extraction recoveries of analytes and internal standard were all >75.0%. The validated method has been successfully applied to comparing pharmacokinetic profiles of analytes in rat and beagle dog plasma. The results indicated that no significant differences were observed in pharmacokinetic parameters of ginsenoside Rg1, while the others had significant differences, which may due to the different mechanisms of absorption and metabolism. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Hoivia Oy:n ruokapalvelujen asiakaskunnan laajentaminen
Sipilä, Satu
2014-01-01
Tämä opinnäytetyö syntyi Hoivia Oy:n tarpeesta markkinoida omia ruokapalveluitaan talon ulkopuolisille ja samalla kehittää lounasravintola Ludvigin palveluliiketoimintaa. Keskusteluissa toimitusjohtajan kanssa päätettiin selvityksen kohderyhmäksi ottaa kokonaisia palveluyksiköitä eikä yksittäisiä henkilöitä. Markkinatutkimukseen haluttiin mukaan kehitysvammaisten asuntoloita, päivätoimintayksiköitä, yksityisiä vanhainkoteja ja palvelutaloja sekä päiväkoteja. Ludvigissa on resursseja valmistaa...
Pitkien vesilinjojen vaikutus juomaveden laatuun
Raatikainen, Jonne
2010-01-01
Juomaveden on oltava lakien ja asetusten mukaista, eikä siitä saa siis aiheutua haittaa käyttäjille. Suomessa talousveden laatua on seurattu 1960- luvulta lähtien. Nykyään yksi tärkeimmistä asetuksista on Sosiaali- ja terveysministeriön asetus talousveden laatuvaatimuksista ja valvontatutkimuksista 461/2000, joka tuli voimaan toukokuussa 2000. Lainsäädännön mukaan vesilaitoksilla on suuri vastuu toimittamastaan talousvedestä, mutta myös viranomaisvalvonnan tulee olla tehokasta terveysviranoma...
Congenital Heart Information Network
... heart defects. Important Notice The Congenital Heart Information Network website is temporarily out of service. Please join ... and Uwe Baemayr for The Congenital Heart Information Network Exempt organization under Section 501(c)3. Copyright © ...
1999-01-01
Ettekandjad: Elisabeth Arnold, Dirk van der Maelen, FranciscoTorres, JiriMashtalka, Demetrios Syllouris, Karoly Lotz, Uwe Gehlen, Michael Sahlin, Tony Gregory, Roma Dovydeniene, Janusz Lewandowski, Ekkehard Pabsch, Jelko Kacir, Jean-Jacques Subrenat, Savas Tsitouridis, Alfred E. Kellermann
Kooli seksuaalhariduse mõjust Eestis / Kai Part, Kai Haldre, Eva Palm ... [jt.
2011-01-01
Artikkel on osa UNESCO, Hollandi Radboudi ülikooli ja Tartu Ülikooli koostöös läbi viidud uurimusest, mille eesmärk oli hinnata kooli seksuaalhariduse kulusid ning mõju kuues eri elatustaseme ja geopoliitilise asendiga riigis. Käesolevas artiklis antakse ülevaade Eesti andmetest
Personalikonsultant Kai Kell : ROWE-metoodika loob paindlikkuse / Kai Kell ; interv. Tiina Saar
Kell, Kai
2008-01-01
HR lighthouse OÜ consulting vanemkonsultant tutvustab ROWE (Results only work environment) metoodikat, mis tugineb põhimõttele, et tööd saab hinnata ainult töötulemuste järgi, ning selle rakendamise eeliseid ja puudusi ettevõtetes
Bendrojo lavinimo mokyklos mokinių kiekybinis ir kokybinis mikčiojimo sunkumo įvertinimas
Januškevičiūtė, Deimantė
2011-01-01
Bakalauro darbe analizuojami išoriniai ir vidiniai mikčiojimo požymiai, mokinių požiūrio į mikčiojimą ir emocijų įvertinimo metodikos, mikčiojimo požymių įvertinimo metodikos, analizuojamas mikčiojimo sunkumo laipsnių nustatymas. Suformuluotas tyrimo tikslas, kuriuo buvo siekiama kiekybiškai ir kokybiškai įvertinti mikčiojančių mokinių užsikirtimų dažnumą, pobūdį, įvertinti lydimuosius judesius, remiantis metodiniais Mikčiojimo sunkumo metodikos (SSI) nurodymais ir atskleisti kiekybinio m...
Directory of Open Access Journals (Sweden)
Frederick W. Stander
2013-11-01
Research purpose: To (1 determine whether adapted versions of the Strengths Use and Deficit Improvement Questionnaire (SUDIQ and Utrecht Work Engagement Scale (UWES are valid and reliable, (2 determine the relationship of the SUDIQ dimensions in the nomological net, and (3 test a structural model. Motivation for the study: To gain a better understanding of the outcomes of following a balanced approach within a sport coaching context. Research design, approach and method: A cross-sectional research approach was used. An availability sample (N = 364 of teachers occupying roles as sport coaches from various schools across three provinces in South Africa was used. Structural equation modelling was used to test the factor structures and the structural model. Main findings: The results indicated a valid factor structure for the adapted SUDIQ and UWES. Relationships between the SUDIQ dimensions and job and personal resources were positive and significant. Individual strengths use was the strongest predictor of engagement. Individual deficit improvement and organisational strengths use were also significant predictors. Organisational deficit improvement did not significantly predict engagement. Practical/managerial implications: Evidence suggests the adapted SUDIQ and UWES can be utilised effectively in a sport coaching environment. Organisational strengths use is also important in managing engagement levels of sport coaches. Contribution/value-add: Valid and reliable measures were provided for use in a sport coaching environment. It substantiates the outcomes that can be gained by following a combined approach based on strength and deficit.
Uus vaatus : EKA uue õppehoone arhitektuurivõistlus / Andres Ojari
Ojari, Andres, 1970-
2014-01-01
EKA uue õppehoone arhitektuurivõistlusel konkureeris 10 tööd. Kolmanda koha pälvis Salto Arhitektide töö märgusõnaga "Akadeemia" (autorid Maarja Kask, Ralf Lõoke, Margus Tamm, Helin Kukk ja Martin McLean). Teine koht kuulus tööle märgusõnaga "Aletheia" (autorid Jaan Kuusemets, Üllar Ambos, Pille Noole, Kaisa Lasner ja Jiannis Lykouras). Konkursi võitis töö märgusõnaga "Linea" (autorid Joel Kopli, Koit Ojaliiv, Juhan Rohtla ja Eik Hermann KUU Arhitektidest
Quantum independent increment processes
Franz, Uwe
2006-01-01
This is the second of two volumes containing the revised and completed notes of lectures given at the school "Quantum Independent Increment Processes: Structure and Applications to Physics". This school was held at the Alfried-Krupp-Wissenschaftskolleg in Greifswald in March, 2003, and supported by the Volkswagen Foundation. The school gave an introduction to current research on quantum independent increment processes aimed at graduate students and non-specialists working in classical and quantum probability, operator algebras, and mathematical physics. The present second volume contains the following lectures: "Random Walks on Finite Quantum Groups" by Uwe Franz and Rolf Gohm, "Quantum Markov Processes and Applications in Physics" by Burkhard Kümmerer, Classical and Free Infinite Divisibility and Lévy Processes" by Ole E. Barndorff-Nielsen, Steen Thorbjornsen, and "Lévy Processes on Quantum Groups and Dual Groups" by Uwe Franz.
Põlvkonnaromaan saksa nooremas kirjanduses / Peeter Helme
Helme, Peeter, 1978-
2006-01-01
Ülevaade järgmistest teostest: Christian Krachti "Faserland" (1995), Florian Illiesi ""Golfi" generatsioon" (2001), Annegret Kunkeli (tegel. Sophie Dannenberg) "Revolutsiooni pleekinud süda", Uwe Tellkampi "Jäälind", Karen Duve "See ei ole armastuslaul", Andreas Maieri "Kirillov"
ORF Alignment: NC_005861 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis
Näitus seljakotist / Mariann Raisma
Raisma, Mariann, 1974-
1999-01-01
Saksa kunstniku Uwe Schloeni ja Kaire Nurga ühisnäitus "Reise" 4. maist Tartu Kunstimajas. U. Schloen eksponeerib joonistustes, tekstides, graafikas, videos ja fotodes 14 päeva kestnud reisi ja fotoinstallatsiooni oma skulptuuridest. K. Nurk eksponeerib kaht pildinelikut
ETV tähistab tantsupäeva kolme filmiga
2006-01-01
Rahvusvahelise tantsupäeva puhul 29. apr. on Eesti Televisiooni kavas kolm tantsuprogrammi - Uwe Scholzi tantsulavastus "Suur Missa", tantsufilm "Teine" (filmi režissöör René Vilbre) ja kolmas film on Inglismaal valminud Lloyd Newsoni "Elu hind"
South African Journal of Higher Education - Vol 21, No 1 (2007)
African Journals Online (AJOL)
Burnout and engagement in university students: A psychometric analysis of the MBI-SS and UWES-S · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K Mostert, J Pienaar, C Gauche, LTB Jackson, 147-162 ...
Synthèse: Revue des Sciences et de la Technologie - Vol 35 (2017)
African Journals Online (AJOL)
Geochemistry of dark coastal heavy-mineral beaches sand (Annaba, Northeast Algeria) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Asma Chemam, Soraya Hadj Zobir, Menana Daif, Uwe Altenberger, Christina Günter, 154-165 ...
Los rostros de Ana: Tres comentarios sobre Darío Morales
Directory of Open Access Journals (Sweden)
Paul Marcelo Velázquez Sabogal
2016-03-01
Full Text Available El presente escrito es una aproximación a la obra del artista colombiano Darío Morales desde la perspectiva dialéctica “vida-muerte”, alentada por el acontecimiento de lo ambiguo y sus implicaciones en la deconstrucción de una corporeidad estable regida por parámetros sociales, jurídicos y biológicos que desembocan en la caracterización de un “otro” en el cual se encuentran figuras como el anormal, el incorregible, el monstruo. Desde ellos pretendo trazar un punto de vista sobre aquellos Rostros de Ana donde se manifiestan figuras como el onanista y la vampira, para desembocar en un comentario que amplíe el espectro de sentido alrededor la obra del artista cartagenero. Palabras claves Cuerpo ambiguo, vida-muerte, sagrado-profano, onanismo. Ñawekuna kai warmi Ana Sutipa: Kimsa pariai ksi runa Dario Morales Sugllapi Kai kilkai kame ñalla regcha kai tacha runa colombiano Dario Morales Kilkakasina rimangapa “ kausai- wamui” aida chingapa kaikuna Mana allilla llugsichu tukuikunamanda icharichu llanga “sug manda” Kaipe turrerreme ¡ kauancheme man aillakaska, man allilla rurasla! Kirú. Kaipi pudenchi kauanga imasami kauacheca kai warme Ana paipa ñawekuna Kai ruraikuna sutikame onanista Chasallata vampira, Kaiwa munakume Allilla intendechengapa imasame parlaku sug iacha Cartagenero. Ima suti Rimai Simi: Cuerpo ambiguo, kaugsai, muerte, sagrado - profano, onanismo. The Faces of Ana: Three Comments on Dario Morales Abstract This paper is an approach to the work of Colombian artist Dario Morales from the perspective of the dialectic of “life and death”, encouraged by the occurrence of the ambiguous and its implications for the deconstruction of a stable corporeality governed by social, legal and biological parameters that lead to the characterization of an “other”, in which figures such as the abnormal, the incorrigible, the monster are to be found. From them, I intend to plot a point of view on those faces of Ana
Lounaslistan kehittäminen ja markkinointi : Ravintola Huviretki Kuopio
Mehtonen, Heli
2017-01-01
”Markkinointi on vastuullinen, suhteisiin ja yhteisöllisyyteen pohjautuva ajattelu- ja toimintatapa, jonka avulla luodaan myyvä, kilpailukykyinen ja eri osapuolille arvoa tuottava tarjooma vuorovaikutteisesti toimien.” Yrityksen perustehtävänä on tuottaa voittoa omistajilleen ja markkinoinnin osuus tästä on lisätä myyntivolyymiä ja mahdollistaa parempi myyntikate. On tärkeää tuoda asiakaskeskeisyys käytäntöön eikä vain ajatella olevansa asiakaskeskeinen. Lisäksi on tärkeää saada asiakkaat ost...
D : disainialfabeet / Kai Lobjakas
Lobjakas, Kai, 1975-
2006-01-01
Inglise disainerid Lucienne Day (s. 1917), Robin Day (s. 1915), Tom Dixon (s. 1959) ja ameerika disainer Henry Dreyfuss (1903-1972). Hollandi disainiajakirjast "De Stijl" ja disainirühmitusest "Droog" (asut. 1993)
Experimentadesign Amsterdamis / Kai Lobjakas
Lobjakas, Kai, 1975-
2008-01-01
18.-21. septembrini 2008 toimunud rahvusvahelise disainibiennaali Experimentadesign avanädalast. Biennaali teemaks oli "Space and Place. Design for the Urban Landscape". Näitustest "Sunday Adventure Club" (kuraator Ester van de Wiel), "Droog Event 2 : Urban Play" (kuraator Scott Burnham"), "Come to My Place"
H : disainialfabeet / Kai Lobjakas
Lobjakas, Kai, 1975-
2006-01-01
Tutvustatakse taani disainerit, arhitekti ja kriitikut Poul Henningseni (1894-1967), austria arhitekti ja disainerit Josef Hoffmanni (1870-1956), belgia arhitekti Victor Hortat (1861-1947), argentiina päritolu disainerit Alfredo Häberlit (sünd. 1964, Buenos Aires), Herman Milleri nimelist mööblitootmisettevõtet (asutatud 1923) USA-s, high-tech stiili
C : disainialfabeet / Kai Lobjakas
Lobjakas, Kai, 1975-
2006-01-01
Andmeid disainerite kohta: Archille Castiglioni (1918-2002), Antonio Citterio (s. 1950), Luigi Colani (s. 1928), Joe Colombo (1930-1971), Terence Conran (s.1931). Briti disainerite Clare Page (s. 1975) ja Harry Richardsoni (s. 1975) firmast Committee. Cranbrooki kunstiakadeemiast USA-s
Avastatud klaas / Kai Lobjakas
Lobjakas, Kai, 1975-
2006-01-01
Euroopa kõrgkoolide klaasieriala üliõpilaste tööde näitus "Discovery / Avastusretk" Kullo galeriis kuni 19. V. Rahvusvahelise ürituse korraldajaks oli EKA klaasikunsti osakond eesotsas Mare Saare ja Tiina Sarapuga. Pikemalt Ave Maseri tööst "Maandumine"
V : disainialfabeet / Kai Lobjakas
Lobjakas, Kai, 1975-
2007-01-01
Tutvustatakse Edgar Velbrit arhitektina ja tema poega Teno Velbrit mööblivabriku "Standard" kauaaegse disainerina, Victoria & Alberti Muuesumi Londonis, nimekat mööblitootjat "Vitra", kelle toodangus on palju nimekate disainerite loomingut ja VHUTEMAS'i - kõrgemat kunstikooli 1920. aastail Moskvas
M Ed Uwe Krause
2008-01-01
Uwe Krause: Atlas of Eurpean Values De Atlas of European Values is een samenwerkingsproject met bijbehorende website van de Universiteit van Tilburg en Fontys Lerarenopleiding in Tilburg, waarbij de wetenschappelijke data van de European Values Study (EVS) voor het onderwijs toegankelijk worden
Meri, munklus ja tööstusmaastik / Kaire Nurk
Nurk, Kaire, 1960-
2003-01-01
Video-tegevuskunsti sündmus "Saar 2003" 5. juulil Viinistus ja Mohnil. Osa võtsid Erik Alalooga, sakslased Uwe Schloen ja Georg Janthur, Jaan Toomik, Jaan Paavle, Silja Saarepuu, Villu Plink, Jüri Ojaver, venelanna Tatjana Goloviznina, lõuna-aafriklane Steven Cohen
Marina Abramović on kohal / Bianka Marran
Marran, Bianka
2010-01-01
Jugoslaavia kunstniku Marina Abramovići performance'itest. Pikemalt tema teosest "The Artist is Present" New Yorgi Moodsa Kunsti Muuseumis 14. märtsist 31. maini 2010. Koostööst saksa fotograafi ja performance'ikunstniku Ulay'ga (kodanikunimi Frank Uwe Laysiepen)
Synthèse: Revue des Sciences et de la Technologie
African Journals Online (AJOL)
Geochemistry of dark coastal heavy-mineral beaches sand (Annaba, Northeast Algeria) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Asma Chemam, Soraya Hadj Zobir, Menana Daif, Uwe Altenberger, Christina Günter, 154-165 ...
A Note on Ko-Type O-Ending Syllables in Old Japanese
Unger, J. Marshall
1975-01-01
Further evidence is offered to support the argument that ko-type o-ending syllables may have been secondary in nature in Old Japanese. Pre-Old Japanese indicates the */uwa/ sequence was manifested as /uwe/ and /uwu/ endings of o-ending syllable verbs. (SCC)
Theoretical studies on stability and feasibility of 0.34 THz EIK
Li, Shuang; Wang, Jianguo; Wang, Guangqiang; Wang, Dongyang
2017-05-01
The stability of the circuit and the tolerance during the manufacture process are theoretically studied in the design of 0.34 THz extended interaction klystron, which are helpful to increase the feasibility of the device. By using the small signal theory, the beam-loading conductance is studied to increase the efficiency of the beam-wave interaction. Combined with the study of start current for oscillation modes, the analysis of stability in multi-gap cavity is proposed, leading to the optimization of cavity. As a crucial factor affecting the ultimate performance of device, the inaccuracy during the fabrication process is researched. The acceptable tolerance is summarized through discussion of various geometrical dimensions' influences on cavity's characteristics. The study of power loss in the conductive wall is presented and the copper is believed to be adapted in making the device practicable with low attenuation. The physical design is simulated and verified by the particle-in-cell (PIC) method, and the results show that the output power of 142 W can be reached steadily at the frequency of 347.7 GHz, approaching the gain of 37.9 dB.
Directory of Open Access Journals (Sweden)
Manuel Fernández-Arata
2016-03-01
Full Text Available El presente estudio reporta la asociación divergente entre la deseabilidad social y las respuestas al mbi-gs y uwes, dos instrumentos que miden constructos considerados opuestos: burnout y engagement. Esta relación ha sido muy pocas veces explorada, y menos aun en sujetos hispanos. Los participantes fueron trabajadores de tiendas comerciales en la zona central de Lima Metropolitana. Se halló que la deseabilidad social comparte varianza con los puntajes de agotamiento emocional e indiferencia, pero esta relación estuvo influenciada por el instrumento de medición de la deseabilidad social. Las correlaciones parciales entre los puntajes del mbi no fueron prácticamente diferentes de sus correlaciones de orden cero. El uwes no covarió con deseabilidad social. Se concluye que la deseabilidad social tiene poca influencia sobre los puntajes orientados hacia el burnout en el mbi.
Directory of Open Access Journals (Sweden)
Manuel Fernández-Arata
2016-01-01
Full Text Available El presente estudio reporta la asociación divergente entre la deseabilidad social y las respuestas al MBI-GS y UWES, dos instrumentos que miden constructos considerados opuestos: burnout y engagement. Esta relación ha sido muy pocas veces explorada, y menos aun en sujetos hispanos. Los participantes fueron trabajadores de tiendas comerciales en la zona central de Lima Metropolitana. Se halló que la deseabilidad social comparte varianza con los puntajes de agotamiento emocional e indiferencia, pero esta relación estuvo influenciada por el instrumento de medición de la deseabilidad social. Las correlaciones parciales entre los puntajes del MBI no fueron prácticamente diferentes de sus correlaciones de orden cero. El UWES no covarió con deseabilidad social. Se concluye que la deseabilidad social tiene poca influencia sobre los puntajes orientados hacia el burnout en el MBI.
A psychometric evaluation of measures of effective well-being in an insurance company
Directory of Open Access Journals (Sweden)
W J Coetzer
2007-01-01
Full Text Available The objectives of this study were to validate two measures of affective well-being, namely the Maslach Burnout Inventory (MBI and the Utrecht Work Engagement Scale (UWES for employees in an insurance company, to assess their construct equivalence for different language groups and to determine the relationship between burnout and work engagement. A cross-sectional survey design with an availability sample (N = 613 was used. The MBI, UWES and a biographical questionnaire were administered. Structural equation modelling confirmed a three-factor model of burnout, consisting of Exhaustion, Cynicism and Professional Efficacy and a three-factor model of work engagement consisting of Vigour, Dedication and Absorption. Acceptable construct equivalence of the three-factor model of burnout and work engagement for different language groups was confirmed. A second-order factor analysis of the scales resulted in two factors, namely burnout and work engagement.
Persson, Roger; Österberg, Kai; Viborg, Njördur; Jönsson, Peter; Tenenbaum, Artur
2017-06-01
To examine the relationships of two screening instruments recently developed for assessment of exhaustion disorder (ED) with some other well-known inventories intended to assess ED-related concepts and self-reports of job demands, job control, job support, private life stressors, and personality factors. A cross-sectional population sample ( n = 1355) completed: the Karolinska Exhaustion Disorder Scale (KEDS), Self-reported Exhaustion Disorder Scale (s-ED), Shirom-Melamed Burnout Questionnaire (SMBQ), Utrecht Work Engagement Scale (UWES-9), Job Content Questionnaire (JCQ), Big Five Inventory (BFI), and items concerning family-to-work interference and stress in private life. Compared to participants without any indication of ED, participants classified as having ED on KEDS or s-ED had higher scores on all four SMBQ subscales, lower scores on the UWES-9 subscales vigor and dedication, higher JCQ job demands scores, lower JCQ job support scores, higher degrees of family-to-work interference and stress in private life, and higher BFI neuroticism and openness scores. In addition, participants classified as having ED on KEDS had lower scores on the UWES-9 absorption subscale, the JCQ job control scale, and lower BFI extraversion, agreeableness and conscientiousness scores, compared to the subgroup not classified as having ED. As expected, we observed an overall pattern of associations between the ED screening inventories KEDS and s-ED and measures of burnout, work engagement, job demands-control-support, stress in private life, family-to-work interference, and personality factors. The results suggest that instruments designed to assess burnout, work engagement, and ED share common ground, despite their conceptual differences.
An Exploratory Analysis of Work Engagement, Satisfaction, and Depression in Psychiatry Residents.
Agarwal, Gaurava; Karpouzian, Tatiana
2016-02-01
This exploratory study aims to measure work engagement levels in psychiatry residents at three psychiatry residency programs using the Utrecht Work Engagement Scale (UWES). In addition, the study investigates the relationship between total engagement and its subscales, resident satisfaction, and a depression screen. Recruitment of 53/79 residents from three psychiatry residency programs in Illinois was completed. The residents were administered a questionnaire consisting of the UWES, the Primary Care Evaluation of Mental Disorders (Prime-MD) depression screen, and a residency satisfaction scale. Statistical analysis using independent samples t test and a one-way analysis of variance was used to assess differences on engagement total score and subscales and satisfaction scale. A logistic regression was used with the engagement subscales and the satisfaction scale as predictors of belonging to the depressed or non-depressed group. Psychiatry residents scored in the high range for total engagement and all its subscales except for vigor which was in the moderate range. Residents who screened positive for depression reported lower total engagement than those who were negative on the depression screen. Vigor was the only significant predictor (p = .004) of being in the depressed group after logistic regression. Total engagement and the subscale of dedication significantly predicted overall residency satisfaction (β = .473, p = .016). Higher total UWES-15 and its subscales of vigor and dedication are correlated with a lower rate of screening positive for depression and higher residency satisfaction. This exploratory study lends support for further study of this psychological construct in medical training programs, but replication is needed.
Roelen, C. A. M.; van Hoffen, M. F. A.; Groothoff, J. W.; de Bruin, J.; Schaufeli, W. B.; van Rhenen, W.
To investigate the Maslach Burnout Inventory-General Survey (MBI-GS) and the Utrecht Work Engagement Scale (UWES) for their ability to identify non-sicklisted employees at increased risk of long-term sickness absence (LTSA). One-year prospective cohort study including 4,921 employees participating
Roelen, C. A M; van Hoffen, M. F A; Groothoff, J. W.; de Bruin, J.; Schaufeli, W. B.|info:eu-repo/dai/nl/073779563; van Rhenen, W.
2015-01-01
Objectives: To investigate the Maslach Burnout Inventory—General Survey (MBI—GS) and the Utrecht Work Engagement Scale (UWES) for their ability to identify non-sicklisted employees at increased risk of long-term sickness absence (LTSA). Methods: One-year prospective cohort study including 4,921
Roelen, C. A. M.; van Hoffen, M. F. A.; Groothoff, J. W.; de Bruin, J.; Schaufeli, W. B.; van Rhenen, W.
2015-01-01
To investigate the Maslach Burnout Inventory-General Survey (MBI-GS) and the Utrecht Work Engagement Scale (UWES) for their ability to identify non-sicklisted employees at increased risk of long-term sickness absence (LTSA). One-year prospective cohort study including 4,921 employees participating
Elav kunstiteos : sõna otseses mõttes / Kelly Kipper
Kipper, Kelly
2011-01-01
Serbia kunstniku Marina Abramovići (sünd. 1946) elust ja loomingust. Performance'itest "Rütm 10", "Rütm 5", "Rütm 0", "The Artist is Present", "The Life and Death of Marina Abramović". Koostööst saksa kunstniku Ulayga (Uwe Laysiepen)
Person-environment fit: using commensurate scales to predict student stress.
Puccio, G J; Talbot, R J; Joniak, A J
1993-11-01
The relationship between person-environment fit and stress was examined for two samples of university students (N = 55 and 79). The Kirton Adaption-Innovation Inventory (KAI) was modified to assess the students' perceptions of the adaptor-innovator style required by their course, the styles they exhibited in the course, and their ideal style preferences. To ascertain fit, the KAI total scores and subscale scores (Originality, Efficiency, and Rule/Group Conformity) were used to classify students on three dimensions: (1) perception of what style their course required, adaptive or innovative; (2) congruence between the style the course required and the style they exhibited in the course; and (3) the magnitude of the difference, if any, between the required style and the exhibited style. Points two and three are measures of fit. The dependent variable was stress. Also the students' ideal style scores, KAI total and subscales, were substituted for the exhibited scores and the classification and analyses were repeated. Analysis of the total scores revealed that a course requiring adaptive behaviours was perceived as more stressful than a course requiring innovative behaviours. Similarly, an analysis of the Rule/Group Conformity scores revealed that the greater the conformity required the greater the stress. Also the less originality demanded in the course the greater was the perceived stress. For the KAI total scores and Rule/Group Conformity scores, the two measures of fit (incongruity and magnitude of the incongruity) were not related to stress. However, analyses of the Originality and Efficiency subscales supported the importance of the P-E fit position. For both subscales, stress was associated with the magnitude of the difference between what was required in the course and what students exhibited in the course. Educational implications derived from these findings as well as recommendations for future research are discussed.
Adaptation of the Brazilian version of the Utrecht Work Engagement Scale
Souza Vasquez, A; Dos Santos, E; Paico, E; Hurtz, C; Schaufeli, W.B.|info:eu-repo/dai/nl/073779563
2015-01-01
Engagement at work is a positive mental and dispositional state characterized by Vigor, Dedication and Concentration. The aim of this study was to adapt and get evidence of validity for the Brazilian version of the utrecht work engagement scale (UWES). Participated in the study 1167 workers between
Can commercial surrogacy be equated to human trafficking?
Monstytė, Evelina
2014-01-01
Surogaciją būtų galima įvardinti viena iš seniausių prekybos žmonėmis, taip pat ir vaikais, formų. Nors dauguma žmonių mano, jog surogacija yra medicinos naujovė, iš tikro šis būdas buvo žinomas dar Biblijos laikais.Didžiausias lūžis medicinoje, po kurio surogacija tapo plačiai naudojama procedūra, įvyko 1978 m. liepos 25 dieną, kai gimė pirmasis kūdikis, kuris buvo pradėtas mėgintuvėlyje. Ši technologija suteikė galimybę nevaisingoms poroms susilaukti genetiškai su jais susijusio vaiko. Taip...
Legotalk in the Research Park. Commentary.
Webb, Nick
1997-01-01
Utilizes Uwe Poerksen's concept of "plastic words" to examine and criticize the preeminence given to research in art education. "Plastic words" refers to vague technical jargon that suggests meaning without actually providing it (e.g., development, process, goal-setting). Argues that this usage inherently corrupts and diverts any productive…
High-energy behavior of the charge-transfer cross section in the eikonal approximation
International Nuclear Information System (INIS)
Dewangan, D.P.
1982-01-01
In the now popular version of the eikonal theory of charge transfer, the eikonal wave function does not satisfy the proper boundary conditions and the charge-transfer amplitude is uncertain by an undefined phase factor. The inclusion of the internuclear potential in a consistent way, in the eikonal theory overcomes theses difficulties. However, it also changes the high-energy asymptotic form of proton-hydrogen charge-transfer cross section from sigma/sub eik/ approx.(23/48) sigma/sub BK/ by a small amount to sigma/sub G/approx.(20.109/48)sigma/sub BK/ where sigma/sub BK/ is the Brinkman-Kramers cross section
Segadus ravimite hinna ümber / Piret Sell
Sell, Piret
2005-01-01
Oma vastulauses 12. detsembri Eesti Päevalehes ilmunud Kai Kalamehe artiklile "Mitmete ravimite hind tõuseb" selgitab autor ravimite hinnatõusu ning seda, miks on originaalravimid kallimad kui koopiaravimid
Kaisi kimbutav õlavalu sundis eestlasi turniiri katkestama / Ann Hiiemaa
Hiiemaa, Ann
2007-01-01
Nädal tagasi maailmameistrivõistlustelt viienda koha rannavõrkpallurid Kristjan Kais ja Rivo Vesik olid Kaisi õlavalu tõttu sunnitud Austrias Klagenfurtis toimuva Grand Slami etapi pooleli jätma
Dugdale, Christine
1999-01-01
Describes the ResIDe Electronic Reserve at the University of the West of England (UWE), Bristol, an example of an electronic reserve that has been addressing many access problems and supporting different teaching/learning initiatives. Discusses new roles for the ResIDe electronic library, electronic information management, new librarian roles, and…
Augalų, auginamų žaliajai trąšai, agrobiologinis įvertinimas ir įtaka svogūnų derliui
Starkutė, Roma; Duchovskienė, Laisvūnė; Zalatorius, Zytautas
2006-01-01
2003–2005 m. Lietuvos sodininkystės daržininkystės institute ekologiškai daržovėms auginti skirtame bandymų lauke tirti ir įvertinti žaliajai trąšai tinkamiausi augalai ir nustatyta jų įtaka ekologiškai auginamų svogūnų derliui. Tirti augalai žaliajai trąšai: miežiai, miežiai su dobilų įsėliu, vasariniai kviečiai, žirnių ir avižų mišinys, aliejiniai ridikai. Kontrolinis variantas – juodasis pūdymas. Nustatyta, kad žaliajai trąšai auginamų augalų biomasė armenyje paliko nevienodą organinės med...
Vanemuislaste ballett astub uude kümnesse / Raimu Hanson
Hanson, Raimu, 1957-
2009-01-01
Vanemuise balleti ajaloost, 4. märtsil 1939. aastal toimunud esietendusest, tänasest teatri balletitrupist. Juubeliks ilmunud raamatust ja DVD-st "Vanemuise ballett 70", koostajad Mare Tommingas ja Kai Kangur
Pateetiline kukkumine XXI sajandisse / Mari Sobolev
Sobolev, Mari, 1968-
2000-01-01
Tartu Kunstimajas ja monumentaalgaleriis avatud Reet Varblase kureeritud näitusest "Eneseksjäämine. Väikesed rollimängud XXI sajandiks". Pikemalt Terje Ojaveri performance'ist, Kai Kaljo videost "Pateetika"
Kiviõli Seikluskeskuse teenindushoone = Kiviõli Adventure Centre service building / Eik Hermann
Hermann, Eik, 1978-
2013-01-01
Kiviõli tuhamäe jalamile erhitatud Kiviõli Seikluskeskuse teenindushoone välispindade materjaliks on valitud Con-Ten teras ja puit. Projekteerija: BF Projektibüroo. Autor: Koit Ojaliiv (Kuu Arhitektid). Sisekujundus: Kohvi OÜ (Hannes Praks, Eeva Masso) projekti ainetel. Projekt: 2007-2010. Valmis: 2013
Araabia šeik ostis tüki Tallinnas tegutsevast pangast / Mikk Salu
Salu, Mikk, 1975-
2006-01-01
SBM panga omaniku Marfin Grupi suurimaks aktsionäriks tõusis Dubai Financials, mis on autori sõnul emiiriperekonna Al Maktoumi võimalus Euroopasse sisenemisel. Marfini peajuristi Fotios Karatzenise hinnangul on huvitavad investeerimisobjektid Eestis sadamad ja kinnisvara. Vt. samas intervjuud Fotios Karatzenisega. Lisad: Teine tase; Marfin Grupp: Kreeka-Araabia pank
Ekslik on omane on sassis = Erroneous is own is messy / Eik Hermann
Hermann, Eik
2010-01-01
Miks on eksimine ja segadus kodudest rääkimisel taunitav, miks ei juleta süüvida omasusetunde lätetesse, mis sisaldab paraja annuse segamini olekut. Seesama argus, mis hoiab meid ekslemast, hoiab meid ka veavabaduse ja korras tubade ahelais, kaugel omasusest
Jan Uuspõld : "Mõnus on hommikul selge peaga ärgata!" / Eike Kingsepp
Kingsepp, Eike
2007-01-01
Näitlejast seoses peagi esilinastuva komöödiafilmiga "Jan Uuspõld läheb Tartusse", autorid Rain Tolk ja Andres Maimik : OÜ Kuukulgur Film. Lisaks sellest, kuidas näitleja filmi sattus : "Jan ja film"
Eesti ajalugu Vene-Liivimaa sõjast Põhjasõjani / Lea Kõiv
Kõiv, Lea, 1961-
2014-01-01
Arvustus: Enn Küng, Margus Laidre, Ivar Leimus, Aivar Põldvee, Anti Selart, Marten Seppel, Kai Tafenau, Ülle Tarkiainen, Enn Tarvel. Eesti ajalugu III: Vene-Liivimaa sõjast Põhjasõjani. Tartu, 2013
2000-01-01
Eesti Kultuurkapitali aastapreemia U. Lippusele, Helikunsti aastapreemiad J. Leitenile, M. Martinile, J. Reinverele, V. Sarvele, A. Volmerile, Uus Tallinna Triole, Duole Kai Ratassepp, Mati Mikali; Rahvakultuuri Sihtkapitali aastapreemia J. Rent, V. Sarv
Tiitsar, Ketli
2005-01-01
Näitus "Arhiiv. Tarbekunstimuuseumi näitused 1982-2004" Eesti Tarbekunsti- ja Disainimuuseumis kuni 15. I 2006. Näituse on koostanud Merike Alber, Kai Lobjakas, Airi Ligi, Anne Tiivel, kujundanud Ketli Tiitsar
Baltikumi meediakunst Dortmundis / Raivo Kelomees
Kelomees, Raivo, 1960-
2006-01-01
Balti kultuurifestivalist "scene: estland lettland litauen in nrw" Dortmundi Ostwall-muuseumis. Eestit esindavad oma töödega Kai Kaljo, Mark Raidpere, Jaan Toomik, Tiia Johannson, Killu Sukmit, Mari Laanemets, Raivo Kelomees
Differential expression patterns of metastasis suppressor proteins in basal cell carcinoma.
Bozdogan, Onder; Yulug, Isik G; Vargel, Ibrahim; Cavusoglu, Tarik; Karabulut, Ayse A; Karahan, Gurbet; Sayar, Nilufer
2015-08-01
Basal cell carcinomas (BCCs) are common malignant skin tumors. Despite having a significant invasion capacity, they metastasize only rarely. Our aim in this study was to detect the expression patterns of the NM23-H1, NDRG1, E-cadherin, RHOGDI2, CD82/KAI1, MKK4, and AKAP12 metastasis suppressor proteins in BCCs. A total of 96 BCC and 10 normal skin samples were included for the immunohistochemical study. Eleven frozen BCC samples were also studied by quantitative real time polymerase chain reaction (qRT-PCR) to detect the gene expression profile. NM23-H1 was strongly and diffusely expressed in all types of BCC. Significant cytoplasmic expression of NDRG1 and E-cadherin was also detected. However, AKAP12 and CD82/KAI1 expression was significantly decreased. The expressions of the other proteins were somewhere between the two extremes. Similarly, qRT-PCR analysis showed down-regulation of AKAP12 and up-regulation of NM23-H1 and NDRG1 in BCC. Morphologically aggressive BCCs showed significantly higher cytoplasmic NDRG1 expression scores and lower CD82/KAI1 scores than non-aggressive BCCs. The relatively preserved levels of NM23-H1, NDRG1, and E-cadherin proteins may have a positive effect on the non-metastasizing features of these tumors. © 2014 The International Society of Dermatology.
Auriga kaubanduskeskus Saaremaal = Auriga shopping centre, Saaremaa
2009-01-01
Saaremaal Kudjape külas Tallinna t. 88 asuva Auriga kaubanduskeskuse sisekujundusest. Sisearhitektid Liina Saabas ja Kai Laanmets. Arhitekt Eero Palm. Sisearhitektide tähtsamate ühiselt tehtud tööde loetelu
Tartu Keskkonnahariduse Keskuse Loodusmaja = Nature School of Tartu Environmental Education Centre
2015-01-01
Tartu Keskkonnahariduse Keskuse Loodusmaja Lille tänav 10, valminud 2013. Arhitektuurivõistlus 2010. Arhitektid Martin Kinks, Risto Parve, Kai Süda, Margit Valma (Karisma Arhitktid), Diana Taalfeld (NU Arhitektuur). Sisearhitekt Tõnis Kalve
Associations between VO2max and vitality in older workers: a cross-sectional study
Directory of Open Access Journals (Sweden)
van der Beek Allard J
2010-11-01
Full Text Available Abstract Background To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. Methods In 427 older workers (aged 45 + years participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. Results The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673. There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006, after adjusting for age, gender and chronic disease status. Conclusions VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale, but not with occupational health related vitality (measured with the UWES Vitality Scale. The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. Trial registration NTR1240
Associations between VO2max and vitality in older workers: a cross-sectional study.
Strijk, Jorien E; Proper, Karin I; Klaver, Linda; van der Beek, Allard J; van Mechelen, Willem
2010-11-09
To prevent early exit from work, it is important to study which factors contribute to healthy ageing. One concept that is assumed to be closely related to, and therefore may influence healthy ageing, is vitality. Vitality consists of both a mental and a physical component, and is characterised by a perceived high energy level, decreased feelings of fatigue, and feeling fit. Since VO2max gives an indication of one's aerobic fitness, which can be improved by increased levels of physical activity, and because feeling fit is one of the main characteristics of vitality, it is hypothesised that VO2max is related to vitality. Therefore, the aim of this study was to investigate the associations between VO2max and vitality. In 427 older workers (aged 45 + years) participating in the Vital@Work study, VO2max was estimated at baseline using the 2-km UKK walk test. Vitality was measured by both the UWES Vitality Scale and the RAND-36 Vitality Scale. Associations were analysed using linear regression analyses. The linear regression models, adjusted for age, showed a significant association between VO2max and vitality measured with the RAND-36 Vitality Scale (β = 0.446; 95% CI: 0.220-0.673). There was no significant association between VO2max and vitality measured with the UWES (β = -0.006; 95% CI:-0.017 - 0.006), after adjusting for age, gender and chronic disease status. VO2max was associated with a general measure of vitality (measured with the RAND-36 Vitality Scale), but not with occupational health related vitality (measured with the UWES Vitality Scale). The idea that physical exercise can be used as an effective tool for improving vitality was supported in this study. NTR1240.
DEFF Research Database (Denmark)
2009-01-01
Introduktion og redaktion af tematillæg om dagbøger og dagbogslitteratur, med bidrag af Karsten Sand Iversen, Søren Mogensen Larsen, Steen Klitgård Povlsen, Jacob Lund, Jens Blendstrup, Pablo Llambías og optryk af en samtale fra 1972 mellem Walter Höllerer, Uwe Johnson, Max Frisch, Elias Canetti og...
The Measurement of Work Engagement with a Short Questionnaire: A Cross-National Study
Schaufeli, Wilmar B.; Bakker, Arnold B.; Salanova, Marisa
2006-01-01
This article reports on the development of a short questionnaire to measure work engagement--a positive work-related state of fulfillment that is characterized by vigor, dedication, and absorption. Data were collected in 10 different countries (N = 14,521), and results indicated that the original 17-item Utrecht Work Engagement Scale (UWES) can be…
Becoming an Effective Peer Assisted Learning (PAL) Leader
West, Harry; Jenkins, Rhiannon; Hill, Jennifer
2017-01-01
This Directions paper, written by two former Peer Assisted Learning (PAL) Leaders, (West and Jenkins) and a PAL Tutor (Hill), will support any geographer considering a PAL role. It reflects their experiences of participating in a PAL scheme at the University of the West of England (UWE), Bristol, United Kingdom, and research conducted with…
President 2001 / interv. Kai Kalamees
2001-01-01
Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametisse sobivust (Savi, Tarand, Kelam, Kreitzberg, Tulviste). Vastavad: Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmo Tammerk, Mart Helme, Pavel Ivanov, Jaan Kaplinski. Diagrammid
Vormistatud ruumid 2010 / Kai Lobjakas
Lobjakas, Kai, 1975-
2011-01-01
Eesti Sisearhitektide Liidu 2010. a. preemia saanud töödest. Söögikoha interjööri preemia: kohvik Supelsaksad Pärnus (Ruth, Jaak ja Anna Huimerind), ühiskondliku interjööri preemia: ADM Interactive'i büroo Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), ajaloolise interjööri preemia: Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos), näituse- ja installatsiooni kujunduse preemia: rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson), tudengipreemia - Aet Tera
Ujuv restoran Portos / Kai Lobjakas
Lobjakas, Kai, 1975-
1999-01-01
Tegu on terasest ja kolmest küljest klaasist kuubikuga, mis asetseb ankrus olevale ujuvalusele paigutatud puitplatvormil Duoro jõel. Kaldast on restoran eraldatud puitseintega, mille ees olev metalltala toetab katust. Autor G. P. Couto.
Jõulujazz alustab heaga / Kai Ilustrumm
Ilustrumm, Kai
2004-01-01
Heategevuskontserdist "Aita alustada elu!" Kaarli kirikus 28. nov., Soome multiinstrumentalisti Sakari Kukko trio kontserdist 5. dets. Niguliste muuseum-kontserdisaalis, ameerika vokaalansambli M-Pact kontserdist 7. dets. Pärnu kontserdimajas, Raivo Tafenau-Meelis Vindi koosmusitseerimisest tšiili löökpillimängija Ricardo Padillaga 11. dets. Niguliste muuseum-kontserisaalis, Helin-Mari Arderi kontserdist "Sajab esimest lund" 15. dets. Niguliste muuseum-kontserisaalis, rootsi ansambli Bossa Electrica esinemiset 16. dets. Rock Café's, ansambli Eesti Keeled kontserdist "Vaiksel ööl" 17. dets. Tallinnas Sokos Hotell Virus
Kindluselamud Lebbekes, Belgias / Kai Lobjakas
Lobjakas, Kai, 1975-
1999-01-01
Sotsiaalehitistena tellitud Lebbeke neli uut maja näevad välja nagu hästikindlustatud eramud. 1,7 meetri kõrguste tellismüüridega suletud alade sees asuvad autovarjualune, aiakuur, terrass ja aed, mis on klaasseina abi ühenduses maja alumise korrusega. Materjalid: tellis, tumehall metall, betoon. Autor: Bob 361 Arhitektid.
R : disaini alfabeet / Kai Lobjakas
Lobjakas, Kai, 1975-
2007-01-01
Tutvustatakse Ameerika graafilise disaini euroopalikumaks muutjat Paul Rand'i, sisearhitekti Toivo Raidmetsa, rahvusvahelise taustaga disainerit Karim Rashid'i, keraamikut ja pedagoogi Leo Rohlinit ja kunsti radikaalseks uuendamiseks asutatud rühmituse (1917.a.) De Stijl üht hilisemat liiget Gerrit Rietveldi
Eesti disaini uudised / Kai Lobjakas
Lobjakas, Kai, 1975-
2006-01-01
Eesti Kunstiakadeemia üliõpilaste Kadri Kruus-Laurimaa kott-jope, Riho Tiiveli lusikas "Spoon container" ja Ülle Jehe sisustuspadjad "Roll it!" valiti Prantsusmaal toimunud rahvusvahelisel kunsti-ja disainikõrgkoolide võrgustiku CUMULUS konkursil "European Ways of Life" nominentide hulka. EKA sisearhitektuuri eriala üliõpilaste toolide hindamisest. Mari Adamsoni nimelise noore tekstiilikunstniku preemia pälvis Kadri Klampe. Eesti Ajaloomuuseumis Maarjamäe lossis avatud moenäitusest "Paula, sul on poisipea!", mille koostas Helle Avila, konsulteeris Anu Ojavee, kujundasid Krista Lepland ja Malle Jürgenson büroost Laika, Belka ja Strelka
Tulevikulinna esimene maja / Kai Lobjakas
Lobjakas, Kai, 1975-
1999-01-01
Santiago Calatrava juhtimisel valminud esimene ehitis Valencias asuvas nn. 'teaduste ja kunsti linnas'. 'Hemisfääriks' kutsutav hoone on betoonist, klaasist ja võrevormis terasest. Ka 'tarkusesilmaks' kutsutav ehitis asetseb ristkülikukujulise veekogu keskel. S. Calatravalt on tellitud 'linna' kolm peahoonet. Okeanograafilise pargi kujundab Félix Candela
2000-01-01
Londoni galeriis Milch seitsme läti, leedu ja eesti kunstniku projekt "Central Station". Kuraatorid Lisa Panting, Sally Tallant. Eestist osalevad Hanno Soans (Catarina Campinoga koostöös valminud video), Kiwa, Kai Kaljo
Work engagement in employees at professional improvement programs in health
Directory of Open Access Journals (Sweden)
Elizangela Gianini Gonsalez
2017-09-01
Full Text Available Objective: This study evaluated the levels of engagement at work in enhancement programs and professionals training in health. Method: A cross-sectional study with 82 health professionals enhancement programs and improvement of a public institution in the State of São Paulo, using the Utrech Work Engagement Scale (UWES, a self-administered questionnaire composed of seventeen self-assessment items in three dimensions: vigor, dedication and absorption. The scores were calculated according to the statistical model proposed in the Preliminary Manual UWES. Results: Engagement levels were too high on the force, high dedication and dimension in general score, and medium in size to 71.61% absorption, 58.03%, 53.75% and 51.22% of workers, respectively. The professionals present positive relationship with the work; they are responsible, motivated and dedicated to the job and to the patients. Conclusion: Reinforces the importance of studies that evaluate positive aspects of the relationship between professionals and working environment, contributing to strengthen the programs of improvement, advancing the profile of professionals into the labour market.
The future of bioenergy; Die Zukunft der Bioenergie
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-07-01
This volume contains the following five contributions: 1. The impact of the governmental biogas production on agricultural rents in Germany. An econometric study (Hendrik Garvert); 2. Biogas as price drivers on the land and rental market? An Empirical Analysis (Uwe Latacz-Lohmann); 3. Analysis of comparative advantage of bioenergy in electricity and heat production. Greenhouse gas abatement and mitigation costs in Brandenburg (Lukas Scholz); 4. Flexibility potential of biogas and biomethane CHP in the investment portfolio (Matthias Edel); 5. Legal possibilities and limitations of a reform of the system for the promotion of bioenergy (Jose Martinez). [German] Dieser Band enthaelt folgende fuenf Themenbeitraege: 1. Die Auswirkungen der staatlichen Biogasfoerderung auf landwirtschaftliche Pachtpreise in Deutschland. Eine oekonometrische Untersuchung (Hendrik Garvert); 2. Biogas als Preistreiber am Bodenmarkt und Pachtmarkt? Eine empirische Analyse (Uwe Latacz-Lohmann); 3. Analyse komparativer Kostenvorteile von Bioenergielinien in der Strom- und Waermeproduktion Treibhausgasvermeidung und Vermeidungskosten in Brandenburg (Lukas Scholz); 4. Flexibilisierungspotenzial von Biogas- und Biomethan-BHKWs im Anlagenbestand (Matthias Edel); 5. Rechtliche Moeglichkeiten und Grenzen einer Reform des Systems zur Foerderung der Bioenergie (Jose Martinez).
Pate, Adam; Smith, Jennifer; Caldwell, David; Horace, Alexis; Zagar, Michelle
2018-03-01
To develop, implement, and evaluate the effect of a faculty engagement and professional growth program targeted at junior faculty members. A faculty engagement and growth program based on adult learning theory was piloted in a clinical sciences department. Effect of the model was evaluated using a pre/post-survey evaluating faculty output and work engagement using the Utrecht Work Engagement Scale (UWES). Average number of publications/projects with cross-campus collaboration increased (0.58 versus 1.25, P = 0.03, 95%CI 0.059-1.264). Involvement in national/state organizations, number of accepted poster presentations, and grants submitted and/or funded all increased (p>0.05). Total UWES score increased (4.13 vs. 4.495 p = 0.21) with the greatest subscale increase in vigor (3.833 vs 4.347, P = 0.1). A faculty engagement and growth program targeting junior faculty members using adult learning theory as a framework may provide a novel and economic way for schools to support the development of these critical team members. Copyright © 2017 Elsevier Inc. All rights reserved.
Promoting better integration of health information systems: best practices and challenges
Michelsen, K.; Brand, H.; Achterberg, P.; Wilkinson, J.
2015-01-01
Health Evidence Network Synthesis Report [Promoting better integration of health information systems: best practices and challenges K Michelsen, H Brand, P Achterberg, J Wilkinson - 2015 ... Authors Kai Michelsen Department of International Health, Maastricht University Maastricht,
Kollaaž ja kontekst. Robert Rumase liiklusmärgid Tallinnas / Hanno Soans
Soans, Hanno, 1974-
2004-01-01
Sekkuv kunst. Poola kunstniku Robert Rumase (1966) rahvusvahelisest kunstiprojektist "Linnamanöövrid", Kai Kaljo videost "One way to see America", Krzysztof Wodicko "Kodutute projektsioonist" ja New York City Unioni väljaku ümberkorraldamisest
2011-03-15
... Wilderness; 14. Emigrant Wilderness; 15. Hoover Wilderness; 16. Yosemite National Park; 17. Ansel Adams... monitor) Ansel Adams WA, Kaiser WA, John 15.5 14.9 13.6 7.1 2200 Muir WA (KAIS monitor)......... Sequoia...
Inglased kavatsevad Ida-Virumaale investeerida / Irina Tokareva
Tokareva, Irina
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 22. okt. 2004, lk. 4. Suurbritannia saatkonna esimehe aset. William Elliott ning tööstus- ja investeeringute jaoskonna assistent Kai Tomasberg viibisid Ida-Virumaal, kus nad veendusid regiooni soodsates investeerimistingimustes
Põlvas tuli esitusele Andre Laine 29 tantsu / Mati Määrits
Määrits, Mati, 1958-
2008-01-01
Põlva Kultuuri- ja Huvikeskuses sai näha Põlvamaa Koolitantsu maakondlikku eelvooru. 52st tantsust 29 tantsu autor on Andre Laine. Kommenteerib ka Tartu Ülikooli Viljandi Kultuuriakadeemia lavakunstide osakonna tantsukunsti õppejõud Kai Valtna
Työpisteiden tuotevirtojen ja työvälineiden hallinta : 5S-menetelmän käyttöönotto
Pelttari, Timo
2014-01-01
Työn tilaajana oli M-Components Oy Hämeenlinnasta, jonka toimialana on metallialan tuotteiden kehittely, valmistus, huolto ja kauppa. Yritys halusi ottaa käyttöön tehtaalla 5S-menetelmän, eikä siitä ollut aiempaa kokemusta yrityksessä. Työn tavoitteena oli ottaa käyttöön 5S-menetelmä ensin koneistamossa, josta se sitten laajennetaan koko yritykseen. 5S:n tavoitteena on selkeyttää työpisteiden tuotevirtoja ja työkalujen hallintaa järjestämällä työpisteet uusiksi. Kaiken tämän takana on ide...
Uudistuva johtajuus ja Z-sukupolvi työelämässä
Aakkula, Eveliina
2012-01-01
Opinnäytetyössä käsitellään epäjohtamista, joka on uusi johtamisen käsite, jonka ovat luoneet Janne Tienari ja Rebekka Piekkari kirjassaan Z ja epäjohtaminen. Terminä epäjohtaminen ei ole virallinen, eikä tule välttämättä vakiintumaan johtajuuden käsitteiden joukkoon. Tämä uusi johtamisen malli liitetään vahvasti Z-sukupolven tulemiseen työmarkkinoille. Z-sukupolvea ovat 1990-luvulla syntyneet. Johtajuus on tärkeä aihe, jonka käsittelemiseen löytyy aina uusia näkökulmia, joiden toimivuutta vo...
Malmivirta, Helena
2011-01-01
Taide on ollut aina läsnä sanoina, tarinoina, kuvina, tanssina, musiikkina, lauluina ja muina keinoina tutkia ihmisen paikkaa sekä suhdetta toiseen ihmiseen ja ympärillä olevaan maailmaan. Taide on liikuttanut, täyttänyt ja tyhjentänyt mieltä. Taide käsitteenä on monimutkainen sen kerroksellisuuden ja taidekokemuksen henkilökohtaisuuden vuoksi. Taide on järjestelmä, joka voi määritellä omat sisäiset kriteerinsä eikä sillä näin määritettäessä tarvitse olla käytännön tehtävää. Taiteen kohtaamis...
Estonia ballett üle seitsme aasta taas Pärnus / Silja Joon
Joon, Silja, 1966-
2010-01-01
Rahvusooperi Estonia balleti kunstiline juht Toomas Edur Estonia balletitrupist ja 20. veebruaril toimuvast kolmest lühiballetist koosnevast balletiõhtust Pärnu kontserdimajas. Esitatakse Bohuslav Martinu "Enne öö saabumist" (koreograaf Nils Christe), Arnold Schönbergi "Pelléas ja Mélisande" (koreograaf Tiit Härm), Robert Schumanni "Teine sümfoonia" (koreograaf Uwe Scholz)
African Journals Online (AJOL)
Mostert, K. Vol 21, No 1 (2007) - Articles Burnout and engagement in university students: A psychometric analysis of the MBI-SS and UWES-S Abstract. ISSN: 1011-3487. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and ...
Bailey, Jane; Biggs, Iain
2012-01-01
This article reports on work to date by an arts practice-led research team exploring older adults' conceptions of, and connectivity with, the physical, social and cultural landscapes in which they locate themselves. The team is based at the Department of Art and Design, University of the West of England (UWE) and has conducted fieldwork,…
Towards Improving Students' Attendance and Quality of Undergraduate Tutorials: A Case Study on Law
Baderin, Mashood A.
2005-01-01
As part of continual efforts towards improving learning and teaching in the faculty, lecturers in the law faculty of the University of the West of England (UWE), Bristol debated the question of students' attendance and quality of tutorials in a recent email discussion amongst themselves. At the end of the debate the need for further research on…
Genetics Home Reference: asphyxiating thoracic dystrophy
... JL, Bacchelli C, Tuysuz B, Hill J, Rix S, Pearson CG, Kai M, Hartley J, Johnson C, Irving ... Accessibility FOIA Viewers & Players U.S. Department of Health & Human Services National Institutes of Health National Library of ...
Production and characterization of wine from mango fruit ( Mangifera ...
African Journals Online (AJOL)
Production and characterization of wine from mango fruit ( Mangifera indica ) varieties in Kenya. ... Six mature and unripe mango fruits were harvested three times from a farm in Katheka Kai Division, Machakos County ... HOW TO USE AJOL.
Finnish Kalevala and Estonian Kalevipoeg / Jaan Puhvel
Puhvel, Jaan, 1932-
2003-01-01
Tõlgitud kogumikust: The world of the Kalevala : essays in celebration of the 150 year jubilee of the publication of the Finnish national epic / ed. Kai Laitinen. Los Angeles : UCLA Centre for the Study of Folklore & Mythology, 1987
Aeberhard, Urs
2017-04-01
The photovoltaic reciprocity theory relates the electroluminescence spectrum of a solar cell under applied bias to the external photovoltaic quantum efficiency of the device as measured at short circuit conditions [1]. So far, the theory has been verified for a wide range of devices and material systems and forms the basis of a growing number of luminesecence imaging techniques used in the characterization of photovoltaic materials, cells and modules [2-5]. However, there are also some examples where the theory fails, such as in the case of amorphous silicon. In our contribution, we critically assess the assumptions made in the derivation of the theory and compare its predictions with rigorous formal relations as well as numerical computations in the framework of a comprehensive quantum-kinetic theory of photovoltaics [6] as applied to ultra-thin absorber architectures [7]. One of the main applications of the photovoltaic reciprocity relation is the determination of quasi-Fermi level splittings (QFLS) in solar cells from the measurement of luminescence. In nanostructure-based photovoltaic architectures, the determination of QFLS is challenging, but instrumental to assess the performance potential of the concepts. Here, we use our quasi-Fermi level-free theory to investigate existence and size of QFLS in quantum well and quantum dot solar cells. [1] Uwe Rau. Reciprocity relation between photovoltaic quantum efficiency and electrolumines- cent emission of solar cells. Phys. Rev. B, 76(8):085303, 2007. [2] Thomas Kirchartz and Uwe Rau. Electroluminescence analysis of high efficiency cu(in,ga)se2 solar cells. J. Appl. Phys., 102(10), 2007. [3] Thomas Kirchartz, Uwe Rau, Martin Hermle, Andreas W. Bett, Anke Helbig, and Jrgen H. Werner. Internal voltages in GaInP-GaInAs-Ge multijunction solar cells determined by electro- luminescence measurements. Appl. Phys. Lett., 92(12), 2008. [4] Thomas Kirchartz, Anke Helbig, Wilfried Reetz, Michael Reuter, Jürgen H. Werner, and
Directory of Open Access Journals (Sweden)
Vigantas KUMŠLYTIS
2012-06-01
Full Text Available Straipsnyje nagrinėjamos suvirintos ir termiškai apdorotos chromo ir molibdeno (5 % Cr – 0,5 % Mo grupės plieno vamzdžių jungtys. Taip pat pateikiami ir palyginami ilgą laiką aukštoje temperatūroje eksploatuoto ir naujo chromo ir molibdeno plieno vamzdžio struktūra ir mechaninių savybių tyrimai. Eksploatuoto metalo tyrimams buvo panaudotas 530 °C temperatūroje 100 000 valandų dirbęs plieninis vamzdis. Tyrimais siekiama nustatyti 5 % Cr – 0,5% Mo grupės plienų suvirintųjų jungčių mechaninių savybių ir terminio apdorojimo parametrų tarpusavio priklausomybes. Atlikti suvirintų bandinių struktūros radiografiniai, mechaninių savybių, lūžių analizės ir mikrostruktūrų tyrimai. Nustatyta, kad chromo ir molibdeno plienų virintinių jungčių vidiniams įtempiams mažinti turi būti taikomas tik terminis apdorojimas. Kiti įtempių mažinimo metodai šiems plienams yra nepriimtini. Nustatyta, kad 5 % Cr – 0,5 % Mo plienų virintinių jungčių terminio apdorojimo temperatūros ir laiko parametro P reikšmė neturi viršyti 20,5. Viršijus šią reikšmę vyksta struktūros degradacijos procesas, karbidai pamažu transformuojasi į M23C6 karbidus, koaguliuoja ferito grūdelių ribose, sudaro karbidų kolonijas ar jungiasi į ilgus vientisus junginius. Smulkių, dispersiškų karbidų struktūroje nelieka. Taip pat mažėja jungties metalo takumo stipris ir smūginis tąsumas.DOI: http://dx.doi.org/10.5755/j01.ms.18.2.1911
Kati Tolmoff: linn peabki oma sportlasi toetama / Maili Kangur
Kangur, Maili
2009-01-01
Tartlasest sulgpallur Kati Tolmoff sai Tartu Kultuurkapitali poolt olümpialootuse stipendiumi. Stipendiumi said ka Peeter Kümmel, Eveli Saue, Kristjan Kais, Rivo Vesik, Sirkka-Liisa Kivine, Tiidrek Nurme, Kaire Leibak, Künter Rothberg ja Maris Mägi
Postkommunistlik kultuur ja kunst - kas müürid on lõhutud ? / Katrin Käärik ; foto: Katrin Käärik
Käärik, Katrin, 1950-
1999-01-01
Stockholmi Moodsa Kunsti Muuseumis avati 16. oktoobril 1999 rahvusvaheline näitus "Pärast müüri : kunst ja kultuur postkommunistlikus Euroopas", näitusest võtavad osa Jaan Toomik, Liina Siib, Kai Kaljo ja Inessa Josing
Kiwa, pseud., 1975-
2006-01-01
New Yorgi kunstikeskuses The Kitchen avatud endiste idablokimaade videokunstnike tööde näitusest. Eestlastest eksponeeritud Kiwa, Ene-Liis Semperi, Killu Sukmiti, Mari Laanemetsa, Tiia Johannsoni ja Kai Kaljo tööd. Kuraator Hamza Walker
[Achievements and enlightenment of modern acupuncture therapy for stroke based on the neuroanatomy].
Chen, Li-Fang; Fang, Jian-Qiao; Chen, Lu-Ni; Wang, Chao
2014-04-01
Up to now, in the treatment of stroke patients by acupuncture therapy, three main representative achievements involving scalp acupuncture intervention, "Xing Nao Kai Qiao" (restoring consciousness and inducing resuscitation) acupuncture technique and nape acupuncture therapy have been got. Regarding their neurobiological mechanisms, the scalp acupuncture therapy is based on the functional localization of the cerebral cortex, "Xing Nao Kai Qiao" acupuncture therapy is closely related to nerve stem stimulation, and the nape acupuncture therapy is based on the nerve innervation of the regional neck-nape area in obtaining therapeutic effects. In fact, effects of these three acupuncture interventions are all closely associated with the modern neuroanatomy. In the treatment of post-stroke spastic paralysis, cognitive disorder and depression with acupuncture therapy, modern neuroanatomical knowledge should be one of the key theoretical basis and new therapeutic techniques should be explored and developed continuously.
Klaasikunstnikud puhuvad ja valavad klaasi taas Haapsalus / Maris Sander
Sander, Maris
2004-01-01
Haapsalu 2. klaasipäevad "Maritima" (lad. keeles mereäärne) Evald Okase majamuuseumis. Osa võtavad kunstnikud Eestist, Koreast, Jaapanist ja Kanadast. Korraldaja Kai Koppel. Kommentaar Kati Kerstna. Valminud tööd pannakse näitusele
[Eesti ajalugu III: Vene-Liivimaa sõjast Põhjasõjani] / Kalle Kroon
Kroon, Kalle, 1966-
2014-01-01
Arvustus. Enn Küng, Margus Laidre, Ivar Leimus, Aivar Põldvee, Anti Selart, Marten Sepepl, Kai Tafenau, Ülle Tarkiainen, Enn Tarvel. Eesti ajalugu III: Vene-Liivimaa sõjast Põhjasõjani. Tartu: Tartu Ülikooli Ajaloo ja Arheoloogia Instituut, 2013
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Fang Dong1 Jiang Chenning1 Zhu Ting1 Yang Jinming1. Department of Pharmaceutical Engineering, School of Chemistry and Chemical Engineering, Yancheng Teachers University, 50 Kai Fang Da Dao, Yancheng 224002, Jiangsu, P. R. China ...
Ruumikujundused eelmisel aastal / Tuuli Org
Org, Tuuli
2007-01-01
Kokkuvõtted Kuressaare linna 2006. aasta ilusamatest ruumikujundustest: Ereki kontorihoone Pihtla tee 28 (Vello Liiv), kohvik Classic Lossi 9 (Kai Laanmets, Liina Saabas), Kuressaare gümnaasium Nooruse 1 (Vello Liiv), Vinoteek Lossi 4 (Ülle Kiirend, Anne Olop)
Põhjalik koguteos Rootsi võidust / Kaarel Vanamölder
Vanamölder, Kaarel, 1981-
2015-01-01
Arvustus: Enn Küng, Margus Laidre, Ivar Leimus, Aivar Põldvee, Anti Selart, Marten Seppel, Kai Tafenau, Ülle Tarkiainen, Enn Tarvel. Eesti ajalugu III: Vene-Liivimaa sõjast Põhjasõjani. Tartu : Tartu Ülikooli Ajaloo ja arheoloogia instituut, 2013
Research Article Special Issue
African Journals Online (AJOL)
pc
2017-08-08
Aug 8, 2017 ... Tupolev — KAI Kazan, Russian Federation. Published online: .... D and is the direct and an inverse DOT matrix of the dimension. N. N × ,. I. D. D. = ..... Embedded Programmable Logic Family/ Altera Inc. Cop. 1998. [Electronic.
DEFF Research Database (Denmark)
2009-01-01
In, red.), Max Frisch havde udgivet andet bind af sine meget populære dagbøger, »Tagebuch 1966-71«, Uwe Johnsons andet bind i »Jahrestage«-romanserien var netop udkommet, og Lars Gustafsson havde i 1971 fået publiceret den stærkt selvbiografiske og dagbogsagtige roman »Herr Gustafsson själv«. Under...
Zavodõ jest, biodizelja - net / Viktor Filonenko
Filonenko, Viktor, 1949-
2008-01-01
Eestis on viimastel aastatel loodud mitu biodiislit tootvat ettevõtet, kuid Eestis puuduva nõudluse tõttu biodiislit siin ei müüda. Vt. samas: Taimsest toorainest valmistatakse kütust Paldiskis. Kommenteerivad Kai Realo, Indrek Kaju ja Sven Mark
Sõrve suvelaager aitab hoida sidet esivanemate kodumaaga / Lembit Suur
Suur, Lembit
2007-01-01
1953. aastast tegutsenud Sõrve laagril on põlisosa Austraalia eestlaskonna noorte tegevuskavas, laagri juhtkond ja Sõrve Sõprade Komitee asutasid sellel aastal noorte juhtide ergutuseks Kai Rahneli nimelise juhtimisauhinna ja see määrati Ian Carterile ja Dorothy Queale´ile
Directory of Open Access Journals (Sweden)
Boltenstern, Erich
1959-05-01
Full Text Available El nuevo edificio para el Servicio Municipal de Seguros de la ciudad de Viena se halla enclavado a orillas del Danubio, en la esquina de las dos calles principales de la capital de Austria, Schottenring y Kai.
Kuidas Harjumaal vanasti elati? / Ell-Maaja Randküla
Randküla, Ell-Maaja, 1939-2016
2006-01-01
Harjumaa muuseumi (Keila, Linnuse 9) püsinäitus "Harju elu". Sisekujundus: Krista Lepland, Malle Jürgenson, Hedi Roots, OÜ Laika, Belka & Strelka. Ehitus: OÜ Alpimer Ehitus. Kai Kaljo maalitud põrandavaip. Ill.: plaan, 22 värv. vaadet
Iz Berlina v Tampere za neskolko tshasov? / Helga Balode
Balode, Helga
2002-01-01
Rail Baltica raudtee, mis hakkab reisi- ja kaubaronge teenindama marsruudil Tallinn-Varssavi, läheb maksma miljardeid kroone. Kommenteerivad Soome transpordi- ja kommunikatsiooniministeeriumi nõunik Kai-Peter Mattson, Läti sideministeeriumi raudteeosakonnajuhataja Janis Veidmanis ja Eesti raudteeameti peadirektor Oleg Epner
Euroopa abiraha igatseb taotlejaid / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen
Videokunsti parimad stiilinäited Kumus
2010-01-01
Kumu Kunstimuuseumis avatakse 28. oktoobril 2010 rahvusvaheline videokunsti näitus "Kõik saab korda". Osalevad Marina Abramović (Serbia/USA), Eija-Liisa Ahtila (Soome), Kai Kaljo, Mike Marshall (Inglismaa), Ene-Liis Semper, Santeri Tuori (Soome), Guido van der Werve (Holland)
Maripuu, Maret, 1974-
2008-01-01
Sotsiaalministri Maret Maripuu sõnul leiab HIV-i vältimise vajalikkus üha rohkem kõlapinda kogu ühiskonnas ja poolele teele seisma jääda ei tohi. Kommenteerib Lääne-Tallinna Keskhaigla nakkuskeskuse juhataja Kai Zilmer
Minge vaadake väärtfilme / Andres Laasik, Kaarel Kressa
Laasik, Andres, 1960-2016
2008-01-01
!". PÖFFi filme - Leedu mängufilm "Kui ma olin partisan" ("Kai as buvau partizanas"), režissöör Vytautas V. Lansbergis ja Mehhiko - Hispaania mängufilm "Tsoon" ("La Zona"), režissöör Rodrigo Pla
What Does it Take to Travel Philosophically Light? A Response to Nielsen
Directory of Open Access Journals (Sweden)
Idil Boran
2008-10-01
Full Text Available In his reply to criticism raised against his reading of Rawls’s constructivist method in light of Rorty’s pragmatism, Kai Nielsen defends his position on the basis that it provides the tools for an external defence of liberalism. An external defence seeks to justify a liberal conception of justice in a way that will be acceptable not only to those who have already accepted the core substantive principles of liberal theory, but to those who reject these core principles. This paper assesses Nielsen’s proposal and shows that Rortian pragmatism is a limited way of achieving an external defence of liberal political and legal institutions. I propose to develop instead the idea of Kantian constructivism to this end. This discussion also brings to light broader questions about the idea of practical philosophy, and thus pays tribute to the works of John Rawls, Richard Rorty, and Kai Nielsen. Dans sa réplique à la critique faite de son interprétation de la méthode constructiviste de Rawls à la lumière du pragmatisme de Rorty, Kai Nielsen défend sa position en indiquant qu’elle offre des outils pour faire une défense externe du libéralisme. Une défence externe cherche à justifier une conception libérale de la justice d’une façon qui sera acceptable non seulement par ceux qui ont déjà accepté les principes importants de fond de la théorie libérale, mais par ceux qui rejettent ces principes de fond. Cet article évalue la proposition de Nielsen et démontre que le pragmatisme de Rorty est une façon limitée d’en arriver à une défense externe des institutions politiques et juridiques libérales. Je propose de développer plutôt l’idée de constructivisme kantien à cette fin. Cette discussion fait aussi ressortir des questions de plus grande envergure au sujet de l’idée de philosophie pratique et rend ainsi hommage aux oeuvres de John Rawls, Richard Rorty et Kai Nielsen.
Kirju sadam : High Tech Center, Tammasaarenkatu, Helsingi = On the waterfront : High Tech Centre
2004-01-01
Projekt koosneb viiest hoonest, millest neli asetsevad mere ääres Tammasaare tänaval ja viies Kaapeli väljakul. Projekteerija: arhitektibüroo Wartiainen, Evata Finland. Autor Kai Wartiainen. Valmis 2002. I korruse plaan, 4 välis ja 2 sisevaadet
Commutators of Integral Operators with Variable Kernels on Hardy ...
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 4. Commutators of Integral Operators with Variable Kernels on Hardy Spaces. Pu Zhang Kai Zhao. Volume 115 Issue 4 November 2005 pp 399-410 ... Keywords. Singular and fractional integrals; variable kernel; commutator; Hardy space.
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-026b is a 60-m ASCII grid of depth data collected near Nihoa multibeam bathymetry data from a SeaBeam 210 sonar aboard the R/V Kai'imikai-O-Kanaloa...
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-018b is a 60-m ASCII grid of depth data collected near St. Rogatien multibeam bathymetry data from a SeaBeam 210 sonar aboard the R/V Kai'imikai-O-Kanaloa...
Nestor, Siim, 1974-
2002-01-01
Tallinnas: 25. mai disko-suurüritusest Circulation. 24. mail klubis Wimbledon disko Sugar Daddy and Girls. 25. mail Von Krahlis erinevate muusikastiilide üritus Sopot. 24. mail Decolte's esineb trance-muusika Dj-kuningas Kai Tracid. 25. mail Diskoteek Tartu klubis Terminal.
Lankots, Epp, 1976-
2006-01-01
Eesti Maanteemuuseum Varbusel. Sise- ja ekspositsioonikujundus: Laika, Belka & Strelka OÜ. Autorid Krista Lepland, Malle Jürgenson, kaasautor Tea Tammelaan. Maalingud: Kai Kaljo. Projekteerija: OÜ Restauraatorprojekt. Arhitekt Aarne Kann. Projekt 2001-2004, valmis 2005. Ill.: asendiplaan, 6 värv. sisevaadet, välisvaade
THE DOUBLE CALL FOR JOY, “REJOICE AND BE GLAD” (MATT. 5 ...
African Journals Online (AJOL)
How can this call be applied to our present situation? 2. FUNCTION AND ... macarisms of Matthew 5:3-12 fall under this grammatical form. Characteristic of a ..... 5:13-16). The two imperatives caivrete kai;ajg allia`sqe are more than simple du-.
Creative style, personality, and artistic endeavor.
Gelade, Garry A
2002-08-01
Research has shown that creative style, as measured by the Kirton Adaption-Innovation Inventory (KAI; M. J. Kirton, 1976), is correlated with more than 30 different personality traits. In this article, the author demonstrates that many of these correlations can be understood within the framework of the Five-Factor Model of personality and shows that the predominant correlates of creative style are personality indicators in the domains of the factors Conscientiousness, Openness to Experience, and, to a lesser extent, Extraversion. These findings provide a basis for comparing the personality traits associated with creative style and occupational creativity. High scorers on the KAI (innovators) differ from both average and creative scientists but have personality characteristics similar to those of artists. This finding suggests that the artistic personality may be more common than is generally supposed and that common factors might underlie both artistic endeavor and creative style.
Sustainable monitoring of roe deer in public hunting areas in the Spanish Pyrenes
Energy Technology Data Exchange (ETDEWEB)
Herrero, J.; Torres, R. T.; Prada, C.; Garcia-Serrano, A.; Gimenez-Anaya, A.; Fernandez, O.
2013-07-01
Aim of study: Monitoring trends in animal populations is essential for the development of appropriate wildlife management strategies. Area of study: The area is situated in the southern Pyrenees (Aragon), Spain. Material and methods: To measure the abundance, population trends, sex ratio, and mortality of roe deer populations, we analyzed data from i) driven hunts for wild boar (hunting seasons 1995/96-2009/10, n = 1,417, ii) itineraries, which were used to calculate the KAI and density using DS (2003-2010, n = 310 itineraries), iii) roe deer carcass recoveries (2006-2010, n = 100), and iv) data from the deer hunting quota fulfillment (2006-2010, n = 325 hunted animals. Main results: Based on DS, in 2010, the average density of roe deer populations was 2.3 km–2 (CV 17%). Based on the KAI and the battues, the estimated average annual rate of increase was 5.8% and 4.3%, respectively. Based on the KAI and the carcass recoveries, the estimates of the population sex ratio were 0.75 (n = 641) and 0.9 (n = 100) males per female, respectively. Carcass recoveries indicated that mortality was highest in late winter and early spring. The average body masses and sizes of males and females were within the ranges reported for other Iberian and European populations. Research highlights: Monitoring should be continued in the Aragon population of roe deer, although larger sample sizes are required to increase the accuracy of estimates and assessments of the impact of management actions. (Author)
Kivinen, Osmo; Piiroinen, Tero; Saikkonen, Loretta
2016-01-01
The paper contrasts two different approaches to the educational challenges of the ubiquitous, rapidly developing information and communication technologies (ICT). The first is the constructivist "knowledge building" theory spearheaded by Carl Bereiter and Marlene Scardamalia and recently further developed by Kai Hakkarainen and Sami…
Ela ja sära - setu pitsist ekvaatorireisini / Andres Keil
Keil, Andres, 1974-
2004-01-01
Eesti Kultuurkapitali "Ela ja sära" stipendiumi laureaadid kirjanik Eeva Park, kunstnik Kai Kaljo, sporditeadlane Joe Noormets, näitleja Kersti Kreismann, pitsikunstnik Ulve Kangro, režissöör Marko Raat, disainer Tarmo Luisk ja helilooja Urmas Sisask oma loomingulistest plaanidest
2012-08-14
... Berger SE; Westcon Holdings, Inc.; Bilfinger Berger SE. 20121084 G Sony Corporation; GaiKai Inc.; Sony..., 2012 Through July 31, 2012 07/02/2012 20121012 G Pinnacle West Capital Corporation; Edison International; Pinnacle West Capital Corporation. 20121022 G Vector Capital IV International. L.P.; Technicolor...
Klaasis on pinget / Reet Varblane ; kommenteerinud Kati Kerstna, Kairi Orgusaar
Varblane, Reet, 1952-
2009-01-01
Klaasi kui (kunsti)materjali kasutamisest, mitmete erialade sümbioosist. Laura Mattioli Rossi, Rosa Barovier Mentasti ja Adriano Berengo kureeritud näitusest "Glass Stress" ("Klaasipinge") tänavusel Veneetsia biennaalil. Eesti klaasikunstist, Kai Koppeli eestvedamisel toimunud Haapsalu klaasipäevadest "Kasuta päeva"
2004-01-01
Kuraator Eve Kiiler. Osalejad loetletud. Avamisel esineb Naeruorgesster. 28. II seminaril räägib Asko Mäkela soome fotokunstist, David Bate briti fotost, Mike Marshall, Denny Robson, Outi Liusvaara, Marja Pirilä, Kai Kaljo ja Piret Räni presenteerivad oma töid
Kodu Rotterdami kaubasadamas / Ada Org
Org, Ada
2005-01-01
Vabakutselise kunstniku Sandy omapärasest kolmekorruselisest tellistest elamust aadressil kai number 2600. Enamus mööblist on korduvkasutuses, asjadele on leitud uus funktsioon, remonditööd on teinud Sandy ise. Kolmandal korrusel asuva vannitoa sisustus on uus. 13 värv. ill
Department of Defense Atlas/Data Abstract for the United States and Selected Areas. Fiscal Year 1992
1993-01-01
ZIMMERMIANN BASIL CORP JV 34,679 Operation/Ammunition Facilities 34,679 3. MORRISON KNUDSEN CORP 30,923 Facilities Operations Support Services 30,923 4...qFEMBACfl A A ABA NUERNBERG HEIDELBERG KAI-3ERSLAUTERN ASTUTTG ART Prepared Byt Washington Headquarters Servicee Directorate for Information Operations
Internet seinakontaktist on tulevikumuusika / Kai Simson
Simson, Kai
2004-01-01
Näitusel Enerex 2004 tutvustas Schneider Electric Eesti AS esmakordselt Power Line Communicationi (PLC) ühendust, millega saab Internetti edastada ja jagada elektrivõrgu kaudu. Kommenteerivad Fortum Elekter AS-i Läänemaa regiooni võrgujuht Kaupo Kuurberg, Elion Ettevõtted AS-i meediasuhete juht Ain Parmas ja Eesti Energia Televõrgu AS-i juhataja Urmas Aiaste
Märkmeid tantsuaastast 2003 / Kai Valtna
Valtna, Kai
2004-01-01
Ülevaade 2003. aasta tantsulavastustest Eesti lavadel. Pikemalt peatutakse lavastustel "Armastuse tango ehk Aegade lõpus" (lav. M. Murdmaa), "Outbound" (lav. M. Moles), "Mart on stage" (lav. M. Kangro), "Luikede järv" (lav. P. Jalakas ja S. Pepeljajev)
Maksureformist saab valitsuse kirstunael / Kai Kalamees
Kalamees, Kai
2005-01-01
2006. aasta eelarve kokkupanemine ja eelarvestrateegia kinnitamine aastateks 2006-2009 võib aprillis-mais koalitsioonipartnerid taas konfliktini viia, kuna kahe järgneva aasta vältel ei ole võimalik samaaegselt langetada tulumaksu 20 protsendini ja täita koalitsioonileppe lubadusi. Lisad: Reformi juhatuses sisepinged; Maksureform
Mis jääb kunstist lõpuks sõelale? / Tanel Veenre
Veenre, Tanel, 1977-
2011-01-01
15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest
Raun, Maie-Ann, 1938-
2007-01-01
Klaasikunstinäitus "Ringkäik" Albu mõisas, kuraatorid Virve Kiil, Kati Kerstna, Kairi Orgusaar. Eksponeeritakse Tiina Sarapu, Mare Saare, Eeva Käsperi, Kai Kiudsoo-Värvi, Pilvi Ojamaa, Merle Bukoveci, Kalli Seina, Viivi-Ann Keerdo, Liisi Junolaineni, Kristiina Uslari, Ivo Lille töid
Tartu Ülikool raamatukogus / Tiina Tammet
Tammet, Tiina, 1971-
2005-01-01
Kuni 13 II näitus "R.A.I.S.K." (Radikaalne Agiteeriv Intrigeeriv Sotsiaalne Kunst). Krutskilist ökokunsti teevad Infotankistid, Puhas Rõõm, Piret Räni, Maris Suits, Katrin Tees, Anu Vahtra, Mart Viljus, Ivika Kivi & Sulo Kallas, Taavi Suits, Kai Herkel ja Henry van Noordenburg
Uma leitura intertextual da poesia de Alberto Caeiro à luz da sabedoria zen-budista
Directory of Open Access Journals (Sweden)
Márcia Munir Miguel Feitosa
2011-10-01
Full Text Available Análise da poesia de Alberto Caeiro, heterônimo de Fernando Pessoa, à luz da filosofia zen-budista, tanto no que concerne ao culto da natureza, como no que diz respeito à questão do eu, inerente ao poeta português e à filosofia Zen. O estudo ainda inclui o levantamento das possíveis afinidades formais e estilísticas entre a poesia japonesa, representada pelos hai-kais, e a poesia sensacionalista de Caeiro.Análisis de la poesia de Alberto Caeiro, heterónimo de Fernando Pessoa a la luz de la filosofía zen-budista, tanto que concierne al culto de la naturaleza, como que dice respecto a la cuestión del yo, inherente al poeta portugués y a la filosofía zen. El estúdio aún incluye las posibles afinidades formales y estilísticas entre la poesia japonesa, representada por los hai-kais, y la poesia sensacionista de Caeiro.
Hard X-ray photoemission spectroscopy
International Nuclear Information System (INIS)
Kobayashi, Keisuke
2009-01-01
Except in the very early stage of the development of X-ray photoemission spectroscopy (XPS) by Kai Siegbahn and his coworkers, the excitation sources for XPS studies have predominantly been the Al Kα and Mg Kα emission lines. The advent of synchrotron radiation sources opened up the possibility of tuning the excitation photon energy with much higher throughputs for photoemission spectroscopy, however the excitation energy range was limited to the vacuum ultra violet and soft X-ray regions. Over the past 5-6 years, bulk-sensitive hard X-ray photoemission spectroscopy using high-brilliance high-flux X-rays from third generation synchrotron radiation facilities has been developed. This article reviews the history of HXPES covering the period from Kai Siegbahn and his coworkers' pioneering works to the present, and describes the fundamental aspects, instrumentation, applications to solid state physics, applied physics, materials science, and industrial applications of HXPES. Finally, several challenging new developments which have been conducted at SPring-8 by collaborations among several groups are introduced.
Lotze, Ulrich; Kirsch, Uwe; Ohlow, Marc-Alexander; Scholle, Thorsten; Leonhardi, Jochen; Lauer, Bernward; Oltmanns, Gerhard; Schmidt, Hendrik
2013-01-01
Ulrich Lotze,1 Uwe Kirsch,1 Marc-Alexander Ohlow,2 Thorsten Scholle,3 Jochen Leonhardi,3 Bernward Lauer,2 Gerhard Oltmanns,4 Hendrik Schmidt5,6 1Department of Internal Medicine, DRK Krankenhaus Sondershausen, Sondershausen, Germany; 2Department of Cardiology, Zentralklinik Bad Berka, Bad Berka, Germany; 3Institute of Diagnostic and Interventional Radiology, Zentralklinik Bad Berka, Germany; 4Department of Internal Medicine, DRK Krankenhaus Sömmerda; Sömmerda, Germany; 5Depar...
1987-12-01
Delta) difference between valuls 0 3 I I I i I b’osoital. rort mood. Texas, I 5. ui’.ber 1984, Contr~ct No~. A634. l53 ’~%di ficatiov, A00001. Z... td thdLl be uWe’ for peattratii’ the aoooeti aralycst at all BCOa and proo jeers. Casetet"cton cost ascalatlsO fetor %rew 1111 *gbdtootem eell ba3
Tundmatu eesti disain / Ivar Sakk
Sakk, Ivar, 1962-
2006-01-01
Eesti disainist, selle teadvustamisest, disainiajaloo puudumisest. Eesti keraamika ajaloost on kirjutanud Leo Rohlin, klaasikunsti ajaloost Maie-Ann Raun, sisearhitektuuri ajaloost Krista Kodres. Kai Lobjakas on kirjutanud ülevaate "Märkmeid eesti disainist". Saksa disaineri Serge Rompza ja ameerika disainiteoreetiku Victor Margolini arvamusest näituse "Ajast ees" kohta
2013-01-01
Kaitsevägi on otsustanud arvata teenistusest välja Eesti mereväe lipulaeva Admiral Pitka, mis tehakse varustusest tühjaks ja tagastatakse Taani kuningriigile. Miinitõrjeoperatsiooni või õppuse juhtimiseks mõeldud 74 meetri pikkune fregatt on seisnud rahapuudusel kai ääres 2008. aastast
NREL Research Pushes Perovskites Closer to Market | News | NREL
even get close-to the above-20% efficiencies dominated by silicon solar panels. NREL researcher Kai Zhu ; Perovskites have a couple of major benefits over silicon solar panels. The silicon technology requires a high as excellent semiconductors. This means perovskite panels are more flexible than rigid silicon panels
Modelling the autocovariance of the power spectrum of a solar-type oscillator
DEFF Research Database (Denmark)
Campante , T.L.; Karoff, Christoffer
2010-01-01
tool in the analysis of the more than 1000 solar-type stars expected to be observed as part of the Kepler Asteroseismic Investigation (KAI). We apply the aforementioned procedure to simulations of the Sun. Assuming different apparent magnitudes, we address the issues of how accurately and how precisely...
Patterns of Cenozoic sediment flux from western Scandinavia
DEFF Research Database (Denmark)
Gołędowski, Bartosz; Nielsen, S.B.; Clausen, O.R.
2012-01-01
deposits in the North Sea, the post-mid-Miocene Molo and Kai Formations of the Norwegian Shelf, the southern North Sea delta system and large volumes of the Late Pliocene-Holocene Naust Formation. The sediment flux from Scandinavia during the Cenozoic is in general agreement with the detrital flux...
The future existence of the believers according to 2 Thessalonians
African Journals Online (AJOL)
Test
2010-08-14
tan e[lqh/ ejndoxasqh nai ejn toi aJgivoi aujtou kai; qaumasqh nai ejn ... God and those who do not obey the gospel of our Lord Jesus'. (2 Th 1:8). ... John 3:2 and Revelation 22:4.25 It is a motif widely found in. Hebrew ...
Luuk, Tamara, 1952-
2010-01-01
Rahvusvaheline videokunsti näitus "Kõik saab korda" Kumu Kunstimuuseumis 2. jaanuarini 2011. Kuraator Maria-Kristiina Soomre, kujundaja Berit Teeäär. Osalevad Marina Abramović (Serbia/USA), Eija-Liisa Ahtila (Soome), Kai Kaljo, Mike Marshall (Inglismaa), Ene-Liis Semper, Santeri Tuori (Soome), Guido van der Werve (Holland)
Ida-Euroopa postkommunistliku kunsti näitus tulemas
1999-01-01
Stockholmi uues Moderna Museeti hoones avab kuraatorite kollektiiv 16. okt. 1999 näituse "After the Wall", mis analüüsib Berliini müüri langemise järgset kunstiolukorda ja kultuurimuutusi Ida-Euroopas. Näitusele on valitud eestlastest Inessa Josing, Kai Kaljo, Liina Siib, Jaan Toomik
Ellersieck, Mark R., Amha Asfaw, Foster L. Mayer, Gary F. Krause, Kai Sun and Gunhee Lee. 2003. Acute-to-Chronic Estimation (ACE v2.0) with Time-Concentration-Effect Models: User Manual and Software. EPA/600/R-03/107. U.S. Environmental Protection Agency, National Health and Envi...
Predictability of the individual clinical outcome of extracorporeal shock wave therapy for cellulite
Directory of Open Access Journals (Sweden)
Schlaudraff KU
2014-05-01
Full Text Available Kai-Uwe Schlaudraff,1 Maren C Kiessling,2 Nikolaus BM Császár,2 Christoph Schmitz21Concept Clinic, Geneva, Switzerland; 2Department of Anatomy II, Ludwig-Maximilians-University of Munich, Munich, GermanyBackground: Extracorporeal shock wave therapy has been successfully introduced for the treatment of cellulite in recent years. However, it is still unknown whether the individual clinical outcome of cellulite treatment with extracorporeal shock wave therapy can be predicted by the patient's individual cellulite grade at baseline, individual patient age, body mass index (BMI, weight, and/or height.Methods: Fourteen Caucasian females with cellulite were enrolled in a prospective, single-center, randomized, open-label Phase II study. The mean (± standard error of the mean cellulite grade at baseline was 2.5±0.09 and mean BMI was 22.8±1.17. All patients were treated with radial extracorporeal shock waves using the Swiss DolorClast® device (Electro Medical Systems, S.A., Nyon, Switzerland. Patients were treated unilaterally with 2 weekly treatments for 4 weeks on a randomly selected side (left or right, totaling eight treatments on the selected side. Treatment was performed at 3.5–4.0 bar, with 15,000 impulses per session applied at 15 Hz. Impulses were homogeneously distributed over the posterior thigh and buttock area (resulting in 7,500 impulses per area. Treatment success was evaluated after the last treatment and 4 weeks later by clinical examination, photographic documentation, contact thermography, and patient satisfaction questionnaires.Results: The mean cellulite grade improved from 2.5±0.09 at baseline to 1.57±0.18 after the last treatment (ie, mean δ-1 was 0.93 cellulite grades and 1.68±0.16 at follow-up (ie, mean δ-2 was 0.82 cellulite grades. Compared with baseline, no patient's condition worsened, the treatment was well tolerated, and no unwanted side effects were observed. No statistically significant (ie, P<0
Tsuno, Kanami; Kawakami, Norito; Inoue, Akiomi; Ishizaki, Masao; Tabata, Masaji; Tsuchiya, Masao; Akiyama, Miki; Kitazume, Akiko; Kuroda, Mitsuyo; Shimazu, Akihito
2009-12-01
The possible associations of intragroup and intergroup conflict at work with psychological distress and work engagement were investigated in a cross-sectional study in a manufacturing factory in Japan. A self-administered questionnaire was sent to all employees, and 255 responses were returned (a response rate of 84%). Data from 247 workers (187 males and 60 females) with no missing values were analyzed. Intragroup and intergroup conflict at work, psychological distress, and work engagement were measured by the NIOSH-GJSQ, K6, and Utrecht Work Engagement Scale (UWES-9), respectively. An ANCOVA was conducted to compare K6 and UWES-9 scores among the tertiles on intragroup conflict or intergroup conflict scores, adjusting for demographic and occupational variables as well as worksite social support, separately for males and females. Intragroup conflict was associated with greater psychological distress for males (p for trend=0.009). Intergroup conflict was marginally significantly associated with psychological distress for both males and females (p for trend=0.050 and 0.051, respectively). Contrary to expectation, intergroup conflict was significantly associated with greater work engagement for females (p for trend=0.024). For males, intragroup and intergroup conflict at work may increase psychological distress; for females, intergroup conflict may increase both psychological distress and work engagement.
Naeru vääristamine : mäng, mänglevus, nali / Eik Hermann
Hermann, Eik
2006-01-01
Naerust kui tegutsemisjõu allikast, õhustiku-naljadest ja masin-naljadest, punkt-naljadest ja anonüümsetest naljadest, nalja seotusest ebaõnnestumise ja mänglevusega, mänglevuse seotusest põgenemisega, Spinoza naeru käsitlusest, kahest Delueze'i kirjeldatud viisist, kuidas lugeda raamatuid
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
CHEN AI-HUA1 MENG SU-CI2 ZHOU KAI1 WANG CONG-CONG1 ZHAO WEI2 WANG AI-JIAN2 QIAN JUN2. School of Chemistry & Chemical Engineering, Yancheng Institute of Technology, Yancheng 224051, People's Republic of China; School of Chemistry and Chemical Engineering, Jiangsu University, Zhenjiang ...
2015-12-28
element simulations of polycrystalline Tita - nium alloys. Jour. Mech. Phys. Solids, 59(10):2157–2176, 2011. 5. S. Ghosh and M. Anahid. Homogenized...2013) 111 – 124. [72] P. Shade, Private communication. [73] H. Ogi, S. Kai, H. Ledbetter, R. Tarumi, M. Hirao, K. Takashima, Tita - niums high-temperature
Mäss põhjusega : kortermaja Silodamil Amsterdamis / Klaske Havik
Havik, Klaske, 1975-
2002-01-01
Büroo MVRDV suurim elamuprojekt. Arhitektid Winy Maas, Jacob van Rijs, Nathalie de Vries, kaasa töötasid Frans de Witte, Willem Timmer, Eline Strijkers, Bernd Felsinger, Duzan Koepel. Viis võistlustöö kaasautorit. Hoone paikneb kai tipus, on ehitatud vette postide peale. Ill.: 7 plaani, 11 vaadet
Larik, J.E.
2015-01-01
Double case note on the scope of the EU's Common Commercial Policy and the future of "mixed agreements" based on the two ECJ Grand Chamber Judgements Case C-414/11, Daiichi Sankyo Co. Ltd and Sanofi-Aventis Deutschland GmbH v. DEMO Anonimos Viomichaniki kai Emporiki Etairia Farmakon, Judgment of the
Igavese armastuse sõdalane : mitte just klassika, aga ajaloo verstapost küll / Ilmar Raag
Raag, Ilmar, 1968-
2006-01-01
Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi, Eesti ühistöö) : stsenarist Iiro Küttner, režissöör Antti-Jussi Annila, võitluskunstide koreograaf Yu Yan Kai, osades - Tommi Eronen, Zhang Jingchu, Markku Peltola, Elle Kull
Fassaadikunstist ja teesklusest / Margit Tõnson
Tõnson, Margit, 1978-
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola
Novõi utshebnõi god budjet Godom dizaina / Ksenia Repson
Repson, Ksenia
2006-01-01
Eesti Kunstiakadeemia disainihariduse 40. aastapäeva tähistava Disainiaasta üritusi: rahvusvaheline disainikonverents Connecting, näitus "40 aastat disaini" Tarbekunsti- ja Disainimuuseumis, disainikonkurss, rändnäitused, seminarid, Tallinna disainikaart (koostab Kai Lobjakas, joonistavad Indrek Sirkel ja Mikk Heinsoo). Projekti "Disainiaasta" juht on Ruth Helene Melioranski
Co-expression of the C-terminal domain of Yersinia enterocolitica ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 40; Issue 1. Co-expression of the C-terminal domain of Yersinia enterocolitica invasin enhances the efficacy of classical swine-fever-vectored vaccine based on human adenovirus. Helin Li Pengbo Ning Zhi Lin Wulong Liang Kai Kang Lei He Yanming Zhang. Articles Volume ...
Resurrecting past futures / Thomas Cubbin
Cubbin, Thomas, 1987-
2011-01-01
Näitused "Modernisation. Baltic Art, Design and Architecrure in the 1960s-1970s" (kuraatorid Lolita Jablonskienė, Kai Lobjakas, Iliana Veinberga) ja "Our Metamorphic Futures: Design, technical aesthetics and experimental architecture in the Soviet Union 1960-1980" (kuraatorid Andres Kurg, Mari Laanemets) Vilniuse Rahvusgaleriis 9.12.2011-12.02.2012
Uus Tartu Loodusmaja = The new Tartu Nature Building / Tiit Sild
Sild, Tiit, 1977-
2010-01-01
Tartu Loodusmaja avalikust arhitektuurivõistlusest, kvalifitseerimistingimustest, energiatõhususest ja žürii tööst. 1. preemia sai töö "Känd", autorid Diana Taalfeld, Kai Süda, Margit Valma, Martin Kinks (Urmas Lõokese AB / Karisma Arhitektid). Nimetatud 2. ja 3. koha saanud tööd, autorid
Minimally invasive aesthetic procedures in young adults
Wollina, Uwe; Goldman, Alberto
2011-01-01
Uwe Wollina1, Alberto Goldman21Department of Dermatology and Allergology, Academic Teaching Hospital Dresden-Friedrichstadt, Dresden, Germany; 2Clinica Goldman, Porto Alegre, Rio Grande du Sul, BrazilAbstract: Age is a significant factor in modifying specific needs when it comes to medical aesthetic procedures. In this review we will focus on young adults in their third decade of life and review minimally invasive aesthetic procedures other than cosmetics and cosmeceuticals. Correction of asy...
Condyloma-like squamous cell carcinoma of the vulva: report of two midline cases
Verma, Shyam B; Wollina, Uwe
2012-01-01
Shyam B Verma,1 Uwe Wollina21Nirvana Clinic, Vadodara, Gujarat, India; 2Department of Dermatology and Allergology, Academic Teaching Hospital Dresden-Friedrichstadt, Dresden, GermanyAbstract: Vulvar cancer is uncommon and may be confused with genital condylomata. We report two cases of middle-aged women presenting with exophytic vulvar tumors of the midline for which diagnosis of a vulvar squamous cell carcinoma was confirmed by histopathology. Risk factors, staging, and treatment options are...
Burning feet in polycythemia vera – peripheral sensorimotor axonal neuropathy with erythromelalgia
Directory of Open Access Journals (Sweden)
Wollina U
2015-02-01
Full Text Available Uwe Wollina Department of Dermatology and Allergology, Academic Teaching Hospital Dresden-Friedrichstadt, Dresden, Germany Abstract: Polycythemia vera is a rare myeloproliferative disease. Cutaneous symptoms are uncommon. We report about a 72-year-old female patient with JAK2V617F-positive polycythemia who developed peripheral sensorimotor axonal neuropathy and erythromelalgia. Possible causes and treatment are discussed. Keywords: bone marrow diseases, myeloproliferative diseases, JAK2 mutations, burning sensations, peripheral neuropathy
High school students' work engagement in practical teaching
Milanović-Dobrota Biljana Z.; Radić-Šestić Marina N.
2017-01-01
The current interest in introducing the dual education system into Serbian secondary education has drawn our attention to the question of students' self-perception in the process of practical teaching. The idea that underpins this paper is the supposition that students are affectively engaged with the work activities they perform. The Utrecht Work Engagement Scale (UWES) (Schaufeli et al., 2002) has been used for assessing students' work engagement in practical teaching. A study was conducted...
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
Li-Long Liu, Kai Xu, Lu-Mei Kang, Shu-Ping Jiang, Qing-Hua Wang, Lei Zhang, Shao-Gui Wan, Hong-Ping Chen, 113-121 ... Cytological effects of pulsed electromagnetic fields and static magnetic fields induced by a therapeutic device on in vivo exposed rats · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Collaborative Research: Neutrinos and Nucleosynthesis in Hot and Dense Matter
Energy Technology Data Exchange (ETDEWEB)
Alford, Mark [Washington Univ., St. Louis, MO (United States)
2015-05-31
The Topical Collaboration funded one of Prof. Alford's graduate students, Jun (Sophia) Han, by providing 75% of her support. The work reported here was wholly or partly supported by the Topical Collaboration. Additional support, e.g. for postdoc Kai Schwenzer, came from Nuclear Theory grant #DE-FG02-05ER41375.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Co-expression of the C-terminal domain of Yersinia enterocolitica invasin enhances the efficacy of classical swine-fever-vectored vaccine based on human adenovirus · Helin Li Pengbo Ning Zhi Lin Wulong Liang Kai Kang Lei He Yanming Zhang · More Details Abstract Fulltext PDF. The use of adenovirus vector-based ...
Twee aardbewings of een? Die assosiasie van literêre motiewe in ...
African Journals Online (AJOL)
Net soos in die Matteus-evangeiie self, is hier geen duidelike aanduiding van 'n on- derlinge verband tussen die aardbewing en die ander verskynsels wat vermeld word nie. Sintaktiese merkers ontbreek, want die passasie bevat bloot vier frases wat asindeties op mekaar volg, plus een frase wat met 'n neweskikkende Kai ...
Anonimiteit en pseudonimiteit van Bybelse geskrifte
African Journals Online (AJOL)
(ou gar de) deur Teopompus geskryf was nie. Hy ontmasker ook die fiktiewe aard van die aanklagte en beswaddering (tas diabolas kai tas loidorias, hais kegreutai tines). 'n Ander voorbeeld van geidentifiseerde vervalsings is die traktate wat die neo-Pitagoreërs aan hulle leermeester toegeskryf het, eeue na sy dood (kyk ...
Üllatav seiklusfantaasia Soomest / Alar Niineväli
Niineväli, Alar
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Elle Kull. Lisa "Soome film sai Hiinas hea lepingu
The interpretation and translation of galatians 5:12 | Tolmie | Acta ...
African Journals Online (AJOL)
As is evident from commentaries on Galatians and from various English translations, scholars do not agree on the meaning, rhetorical labelling and translation of the wish expressed by Paul in Galatians 5:12 ( [Ofelon kai; ajpokovyontai oiJ ajnastatou` nte” uJma`”). In this article various interpretations of this verse are ...
African Journals Online (AJOL)
Items 51 - 100 of 1309 ... Li-Long Liu, Kai Xu, Lu-Mei Kang, Shu-Ping Jiang, Qing-Hua Wang, ... CR Sewani-Rusike, JE Iputo, EJ Ndebia, M Gondwe, DR Kamadyaapa ... K-M Man, W-C Chen, H-M Wang, H-Y Chen, J-L Shen, L-D Chen, F-J Tsai, ...
Reformierakond naudib ülisuurt toetust / Agnes Kuus
Kuus, Agnes
2007-01-01
Ilmunud ka: Postimees : na russkom jazõke, 15. mai 2007, lk. 3. Uuringufirma TSN Emor korraldatud küsitluse kohaselt oli Reformierakonna toetus pärast pronkssõduri sündmusi 46%. Diagramm: Toetus parlamendierakondadele. Kommenteerivad: Kadri Must, Marek Strandberg, Jaanus Marrandi, Margus Tsahkna, Eiki Nestor. Vt. samas: Kai Kalamees. Võimupartnerid usuvad endasse
Georgi söögituba Kotli majas / Helju Koger
Koger, Helju, 1943-
2006-01-01
Georg Lurichi järgi nime saanud söögitoast arhitekt Alar Kotli vanaisale kuulunud hoones Väike-Maarjas. Enne renoveerimist koliti hoone teise kohta. Söögitoa kujunduse tegi Kai Tort, mööbli valmistasid kohalikud puusepad, plekist lambid - Ilmar Aasumets. Omanik Avo Part. 7 värv. ill
Big and small women facing small culture / Reet Varblane
Varblane, Reet, 1952-
1999-01-01
Feministlik kunst Eestis alates 1994. aastast. Näitustest EST. FEM, Kood-eks, Private Views. Videod. Fotoinstallatsioonid. Tuntumad kunstnikud: Mare Tralla, Ene-Liis Semper, Mari Laanemets, Eve Kiiler, Tiina Tammetalu, Kai Kaljo, Ly Lestberg, Liina Siib jt. Kunstnike rühmitused: F.F.F.F. Teemad: ema, väike naine, keha. 6 illustratsiooni
Publikum svinger den retoriske taktstok
DEFF Research Database (Denmark)
Hansen, Jette Barnholdt
2012-01-01
Artiklen handler om revyvisen "Man binder os på mund og hånd" af Poul Henningensen med musik af Kai Normann Andersen, som oprindeligt var en del af den kulturradikale revykomedie Dyveke fra 1940, der bla. advokerede for seksuel frigørelse. Visen levede dog hurtigt sit eget liv uden for revyteatret...
Seroprevalence of Infections with Dengue, Rift Valley Fever and Chikungunya Viruses in Kenya, 2007.
Directory of Open Access Journals (Sweden)
Caroline Ochieng
Full Text Available Arthropod-borne viruses are a major constituent of emerging infectious diseases worldwide, but limited data are available on the prevalence, distribution, and risk factors for transmission in Kenya and East Africa. In this study, we used 1,091 HIV-negative blood specimens from the 2007 Kenya AIDS Indicator Survey (KAIS 2007 to test for the presence of IgG antibodies to dengue virus (DENV, chikungunya virus (CHIKV and Rift Valley fever virus (RVFV.The KAIS 2007 was a national population-based survey conducted by the Government of Kenya to provide comprehensive information needed to address the HIV/AIDS epidemic. Antibody testing for arboviruses was performed on stored blood specimens from KAIS 2007 through a two-step sandwich IgG ELISA using either commercially available kits or CDC-developed assays. Out of the 1,091 samples tested, 210 (19.2% were positive for IgG antibodies against at least one of the three arboviruses. DENV was the most common of the three viruses tested (12.5% positive, followed by RVFV and CHIKV (4.5% and 0.97%, respectively. For DENV and RVFV, the participant's province of residence was significantly associated (P≤.01 with seropositivity. Seroprevalence of DENV and RVFV increased with age, while there was no correlation between province of residence/age and seropositivity for CHIKV. Females had twelve times higher odds of exposure to CHIK as opposed to DENV and RVFV where both males and females had the same odds of exposure. Lack of education was significantly associated with a higher odds of previous infection with either DENV or RVFV (p <0.01. These data show that a number of people are at risk of arbovirus infections depending on their geographic location in Kenya and transmission of these pathogens is greater than previously appreciated. This poses a public health risk, especially for DENV.
Waters, John K.
2007-01-01
This article reports the potential of online role-playing games to be a powerful tool for English as a second language (ESL) learning. When Professor Edd Schneider and game designer Kai Zheng suggested to attendees gathered in San Francisco last spring for the annual Game Developers Conference that massively multiplayer online role-playing games,…
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. Lei He. Articles written in Journal of Biosciences. Volume 39 Issue 1 March 2014 pp 63-74 Articles. Screening of cellular proteins that interact with the classical swine fever virus non-structural protein 5A by yeast two-hybrid analysis · Chengcheng Zhang Lei He Kai Kang Heng Chen ...
Käsitöö teeb asjad paremaks / Karin Paulus
Paulus, Karin, 1975-
2007-01-01
Eesti ja inglise kunstnike ühisnäitusest "Minu maailm : uus subjektiivsus kaasaegses disainis" Eesti Tarbekunsti- ja Disainimuuseumis. Kuraatorid Emily Campell, Andree Cook, Kai Lobjakas. Eksponeeritakse Annike Laigo, Krista Leesi, Ülle Jehe, Kärt Ojavee töid. Inglismaad esindavad 7 kunstnikku, lähemalt Danny Browni ja Alison Willoughby töödest
Eesti goes St. Etienne / Anna Roomet
Roomet, Anna
2006-01-01
Näitus Eesti Kunstiakadeemia tootedisaini osakonna magistrantide viimase kahe aasta projektide paremikust esindas Eestit disainibiennaalil St. Etiennis Prantsusmaal. Näituse panid üles Pent Talvet ja Pavel Sidorenko, näitusel osalejad: Anna-Maria Einla, Kätlin Kangur, Triin Kuusler, Andri Laidre, Veiko Liis, Liina-Kai Raivet, P. Sidorenko, P. Talvet, Ingela Viks, Triin Voss
Br; S; Jossen S; Holsboer-Trachsler E; Pühse U; Gerber M
2015-01-01
Serge Brand,1,2,* Stefanie Jossen,2,* Edith Holsboer-Trachsler,1 Uwe Pühse,2 Markus Gerber21Psychiatric Clinics of the University of Basel, Center for Affective, Stress and Sleep Disorders (ZASS), 2Department of Sport, Exercise and Health, Sport Science Section, University of Basel, Basel, Switzerland*These authors contributed equally to this work and share the first authorshipBackground: Prevalence rates of autism spectrum disorder (ASD) have increased dramatically in the last two decad...
ENGAGEMENT AND BURNOUT AMONG NURSING AND PSYCHOLOGY STUDENTS IN SLOVAKIA
Zuzana Škodová; Ľubica Bánovčinová; Petra Lajčiaková
2017-01-01
Aim: The aim of the study was to examine the differences in engagement and burnout syndrome in students of nursing/midwifery and psychology in Slovakia. Design: A cross-sectional design was used. Methods: 171 university students on a baccalaureate program participated in the research (90.9% females; age 20.6 ± 1.3; 80 psychology students, 91 nursing/midwifery students). The School Burnout Inventory (SBI) and Utrecht Work Engagement Scale (UWES) were employed as measurement methods. Results: A...
Someone to talk to: Using automated characters to support simulated learning activities
Falconer, L.; Frutos-Perez, M.
2011-01-01
The University of the West of England (UWE) has a large number of students who will pursue subsequent careers in a wide range of professional fields such as engineering, law, business, nursing, teaching, psychology, criminology and design. An important part of that education is the ability to relate theory to practice (Barrett 2011), and developments in technology over the past years have now created opportunities to enable students to experience simulations of events and situations that are ...
Brand, Serge; Jossen,Stefanie; Holsboer-Trachsler,Edith; Pühse,Uwe; Gerber,Markus
2015-01-01
Serge Brand,1,2,* Stefanie Jossen,2,* Edith Holsboer-Trachsler,1 Uwe Pühse,2 Markus Gerber21Psychiatric Clinics of the University of Basel, Center for Affective, Stress and Sleep Disorders (ZASS), 2Department of Sport, Exercise and Health, Sport Science Section, University of Basel, Basel, Switzerland*These authors contributed equally to this work and share the first authorshipBackground: Prevalence rates of autism spectrum disorder (ASD) have increased dramatically in the last two d...
Im, Subin; Min, Soonhong
2013-04-01
Exploratory factor analyses of the Kirton Adaption-Innovation Inventory (KAI), which serves to measure individual cognitive styles, generally indicate three factors: sufficiency of originality, efficiency, and rule/group conformity. In contrast, a 2005 study by Im and Hu using confirmatory factor analysis supported a four-factor structure, dividing the sufficiency of originality dimension into two subdimensions, idea generation and preference for change. This study extends Im and Hu's (2005) study of a derived version of the KAI by providing additional evidence of the four-factor structure. Specifically, the authors test the robustness of the parameter estimates to the violation of normality assumptions in the sample using bootstrap methods. A bias-corrected confidence interval bootstrapping procedure conducted among a sample of 356 participants--members of the Arkansas Household Research Panel, with middle SES and average age of 55.6 yr. (SD = 13.9)--showed that the four-factor model with two subdimensions of sufficiency of originality fits the data significantly better than the three-factor model in non-normality conditions.
Readout of the UFFO Slewing Mirror Telescope to detect UV/optical photons from Gamma-Ray Bursts
DEFF Research Database (Denmark)
Kim, J. E.; Lim, H.; Nam, J. W.
2013-01-01
plane detector of Intensified Charge-Coupled Device (ICCD). The ICCD is sensitive to UV/optical photons of 200–650 nm in wavelength by using a UV-enhanced S20 photocathode and amplifies photoelectrons at a gain of 104–106 in double Micro-Channel Plates. These photons are read out by a Kodak KAI-0340...
Homme kell 18 avatakse Villa Manini kaasaja kunsti keskuses...
2004-01-01
Uue Euroopa foto- ja videokunstinäitus "Instant Europe", kus on väljas kümne hiljaaegu Euroopa Liitu astunud riigi - Küpros, Eesti, Läti, Leedu, Malta, Poola, Tšehhi, Slovakkia, Sloveenia, Ungari - kunstnike tööd. Kuraatorid Francesco Bonami ja Sarah Cosulich Canarutto. Eestit esindavad Jaan Toomik, Kai Kaljo, Ene-Liis Semper ja Liina Siib
Szymenderski, Peggy; Yagudina, Liliya; Burenkova, Olga
2015-01-01
In this paper we consider the question of how quality assurance can have a real, positive impact on the quality of teaching and learning at universities, considering the realities of different systems--the system of control and the system of quality culture--in using the example of two universities: the KNITU-KAI in Russia and the TU Dresden in…
Kofi Annan tahab kõnelusi Kosovo lõppstaatuse üle / Krister Paris
Paris, Krister, 1977-
2005-01-01
Kuni pole selge, milline staatus Kosovot tulevikus ootab, ei ole välisettevõtted huvitatud pikaajaliste investeeringute tegemisest selles piirkonnas. ÜRO eriesindaja Kai Eide raporti kohaselt on Kosovo teinud märkimisväärseid edusamme, kõnelused Kosovo tulevase staatuse üle võiksid alata juba sel aastal. Lisa: Läbirääkijate kolm tingimust
Lin-Na and Yong-Xiu Afr J Tradit Complement Altern Med. (2014) 11 ...
African Journals Online (AJOL)
cadewumi
Evaluation of anti-athletic fatigue activity of Schizandra chinensis aqueous extracts in mice. Afr J Pharm Pharmacol 3: 593-597. 4. Cao, Y., Hu, Y., Liu, P., Zhao, H.X., Zhou, X.J., and Wei, Y.M. (2012). Effects of a Chinese traditional formula Kai Xin San (KXS) on chronic fatigue syndrome mice induced by forced wheel running ...
Eksistentsi krõbisev videolint / Janar Ala
Ala, Janar, 1979-
2010-01-01
Videokunsti näitus "Kõik saab korda" Kumu Kunstimuuseumis 2. jaanuarini 2011, kuraator Maria-Kristiina Soomre. Osalevad järgmised kunstnikud: Marina Abramović, Eija-Liisa Ahtila, Kai Kaljo, Mike Marshall, Ene-Liis Semper, Santeri Tuori, Guido van der Werve. Pikemalt serbia kunstniku Marina Abramović'i ja soome kunstniku Eija-Liisa Ahtila töödest
Markus 16:1-8 in die konteks van 'n konstniksie van die Markaanse ...
African Journals Online (AJOL)
Aangesien ons in die geval van Markus nie oor 'n voorhande bron ter ... geringgeskat word wanneer ons ons die Markaanse gemeentekonteks probeer voorstel nie. Linnemann suggests ... that there must be some control exercised over ..... ëaxai náuxa)v ëaxaxoq Kai návxioi' 8i0kovo(; (Mark 9: 35), dit wil sê as mens.
Nog steeds geslote eredienste? Deel2
African Journals Online (AJOL)
gronde berus nie. Verwysende na Johannes 17:21 sê hy dat die kerk altyd die een- heid moet soek en bewaar omdat ons almal lede van dieselfde liggaam is. ...... Munchen: Kai ser. Oosthuizen, A J G [1960] 1978b. Ons kerk, in Van Wyk 1978:31-34. Pannenberg, W 1958. Christlicher Glaube und menschliche Freiheit.
Lv, Caixia; Wang, Quanhong
2012-01-01
Event-related brain potentials (ERPs) were recorded during a Chinese character decision task to examine whether N400 amplitude is modulated by stimulus font. Results revealed large negative-going ERPs in an N400 time window of 300-500 ms to stimuli presented in degraded Xing Kai Ti (XKT) font compared with more intact Song Ti (ST) font regardless…
1999-01-01
25. nov.-st Rotermanni soolalaos rahvusvaheline meediakunsti festival 'Interstanding 3' 'Beyond the Edge ئ Ülalpool piire'. Kuraator Ando Keskküla. Loetletud näitusel osalejad. Eestit esindavad Kai Kaljo, Kiwa, Marko Laimre, Mare Tralla. 26. ja 27. XI Rotermanni soolalaos toimuval konverentsil esinejad, ettekanded. Konverentsi kureerib Eric Kluitenberg Hollandist. Korraldajad: Eesti Kunstiakadeemia, Kaasaegse Kunsti Eesti Keskus.
Uued professorid ja audoktorid
2009-01-01
TÜ nõukogu valis rahvusvahelise õiguse professoriks Lauri Mälksoo, peremeditsiini professorik Ruth Kalda, spordipsühholoogia professoriks Lennart Raudsepa; audoktoriteks nimetati EELK peapiiskop Andres Taul, Groningeni ülikooli prof. Cornelius Theodor Hasselblatt, Tampere ülikooli emeriitprof. Kai Krohn, Hollandi Erasmuse Ülikooli prof. Frank G. Grosveld, Suurbritannia Sussexi ülikooli prof. George Nicholas von Tunzelmann
Rapsist diislikütus : kallis ja tõrjutud / Heiki Raudla
Raudla, Heiki, 1975-
2008-01-01
Paldiski Lõunasadamas avatud Biodiesel Paldiski AS tehas loodab tulevikus täisvõimsuse juures toota 100 000 tonni biodiislikütust aastas, praegu eksporditakse kogu toodang peamiselt Lääne-Euroopasse ja Skandinaaviasse. Eesti tarbijale biodiislikütuse tootmist takistab peamiselt tooraine kõrge hind ning vähene nõudlus. Küsimusele vastavad Kai Realo ja Indrek Kaju
Kohtusüsteemi reguleerimise probleeme / Kai Kullerkupp
Kullerkupp, Kai, 1975-
1997-01-01
Kohtute pädevuse piiritlemisest, "õigusemõistmisest" kohtunikuks mitteolevate ametnike poolt, kohtute haldusest, kohtunike õiguslikust seisundist ja teenistusjärelevalvest ning kohtutesisesest tööjaotusest
Kaup kai kõrvalt maailma / Kadri Paas
Paas, Kadri, 1982-
2008-01-01
Ilmunud ka: Delovõje Vedomosti 23. juuli lk. 16. Tallinna Sadam investeerib Muuga ja Paldiski lõunasadama tööstusparkide arendamisse paarsada miljoni krooni. Lisa: Number; Panus pidevasse kaubavoogu; Üle 100 hektari tööstusparki
Ines Karu tantsis end raamatusse / Kais Allkivi
Allkivi, Kais
2008-01-01
USAs ilmus raamat kõhutantsust "Kõhutants tähistamas püha naiselikkust" ("Belly Dance Celebrating the Sacred Feminine"). Raamatu autor on Martha Elena Burns. Eestlannadest on raamatus Ines Karu ja tema trupikaaslane Janne Mõistus. Lisaks fakte Ines Karust "Pühendunud tantsule"
Res Publica soolo rikkus tavasid / Kai Kalamees
Kalamees, Kai
2005-01-01
Riigikogu aseesimeheks valiti Res Publica liige Taavi Veskimägi, nüüd on Riigikogu juhatuses kaks ühe partei liiget. Riigikogu aseesimeheks tagasi valitud Toomas Vareki hinnangul näitab see samm nii Res Publica kogenematust kui ka Eesti poliitilise kultuuri kehva taset
Kai kurie Antano Baranausko verstos Biblijos (pseudoarchaizmai
Directory of Open Access Journals (Sweden)
Birutė Kabašinskaitė
2011-12-01
Full Text Available (PSEUDOARCHAISMEN IN ANTANAS BARANAUSKAS’ BIBELÜBERSETZUNGZusammenfassungIn seiner Bibelübersetzung (1901–1902; im weiteren BaB genannt verwendet Antanas Baranauskas aus stilistischen Gründen nicht nur die gängigen Archaismen der alten Texte, sondern auch künstliche morphologische Formen, welche den früheren Sprachzustand wiedergeben sollten, wie er nach den alten Texten, den Mundarten und den Erkenntnissen der historisch-vergleichenden Sprachwissenschaft sowie den Hypothesen des Autors rekonstruiert werden kann.Die in BaB vorkommenden durch das Fehlen der Partikel te- sowie die Endungen -ie, -y, -ai charakterisierten Formen des Kupitivs (geidžiamoji nuosaka sind in Anlehnung an ähnliche Formen des Kupitivs und Imperativs der Mundarten und alten Texte gebildet.Auf die Partikel te- hat Baranauskas wahrscheinlich deswegen verzichtet, weil er das ursprüngliche Paradigma des alten Optativs (der bei ihm als geistaikis bezeichnet wird wiederherstellen wollte.Die dreifachen Endungen der Kupitivformen hat der Autor nicht streng mit irgendwelchen konkreten Präsensstämmen verbunden, obwohl die Mundarten und insbesondere die alten Texte ein konsequenteres System aufweisen.Vom Gebrauch in den heutigen Mundarten und alten Texte unterscheidet sich die Vorgehensweise in BaB durch die häufige Verwendung der Formen mit -ai. Hier bekommen eine solche Endung nicht nur die ā-, sondern auch die ina- und sta-Stämme sowie die auf alten Nasalvokal ų + -va- auslautenden Infixpräsentien. Vorbild für die Formen auf -ai waren wahrscheinlich die in verschiedenen (besonders žemaitischen Mundarten vorkommenden Formen der 3. Person Indikativ Präsens auf -ai mit vorausgestellter Partikel, die in der Funktion des Kupitivs gebraucht werden können. Zur Bevorzugung der Formen auf -ai konnte die Angabe in Schleichers Grammatik veranlaßt haben, daß -ai der ursprüngliche (baltoslavische? Ausgang des Optativs gewesen sei.Ungewöhnlich und höchstwahrscheinlich künstlich sind in BaB die reflexiven Kupitivformen. Bei ihnen findet sich hier der Ausgang -ys(i (ob dieser auch bei ā-Stämmen Verwendung fand, ist schwer zu beurteilen – es waren keine entsprechenden Beispiele auffindbar. Möglicherweise ist dieser Ausgang verallgemeinert auf Grund von Beispielen wie te álkinis (neben te álkinies DP. ähnlich verhält es sich im Falle des Kupitivs der athematischen Verben. Wohl nach dem Muster altlitauischer Beispiele wie te saugti KN wird einigen athematischen Präsentien die Endung -y (gleichgesetzt mit dem Kupitivausgang der i-Stämme? zugewiesen; aber bei den Formen der 3. Person Präsens auf -st (<-sti wird das übliche -ie oder -ai verwendet, wohl weil sie mit den Formen der sta-Stämme in Verbindung gebracht wurden.Veranlaßt durch das Streben nach künstlicher Wiederherstellung des alten Kupitivparadigmas, kommt in BaB auch die eine oder andere unkorrekte, „analogische“ Form vor, die vom Infinitivstamm aus (twinie, Apsiwilkie oder mit Wechsel der Flexionsklasse (sutwirty; -i statt -ėja gebildet ist.Vorbild für auffällige Formen des Partizip Präsens auf -ti-nt- waren die von einem Teil des Žemaitischen verwendeten umgebildeten Paradigmen athematischer Verben; dort haben die Partizipien öfters einen Stamm auf -ta-nt- (aber neben miegtąs auch miegtįs. In Analogie zum Ausgang der 3. Person Präsens des i-Stämme verallgemeinert der Autor -ti-nt-: nach stovi (Kupitiv stovy – stovįs wurde eiti (eity – eitįs geschaffen.Bei einigen Formen des Dativ Singular der Substantiva verwendet BaB im Anschluß an Daukša und vielleicht nach den Nachbardialekten von Anykščiai die Endung -i der alten i- und Konsonantenstämme. Nach dem Vorbild Daukšas, Sirvydas’ und anderer alten Texte wird in einigen Fällen die pronominale Dativform mi gebraucht.Die Verwendung von -ys als Endung des Nominativ Singular des bestimmten Adjektivs zeigt wahrscheinlich, daß der Autor seinen früheren Plan aufgreift, die Endung mit dem älteren (und auch für einen Teil der Mundarten charakteristischen Ausgang -ys der ia-Stämme zu verbinden. Wie den Briefen zu entnehmen ist, entschloß er sich etwa Mitte 1882, die Nominativ-Singularendung der bestimmten Adjektiva und Partizipien (ebenso die des Superlativs der Adjektiva zum Ausgang -ias der a-Stämme in Beziehung zu setzen, welcher nach seiner Ansicht nur zu -is kontrahiert werden konnte. Beim übersetzen der Bibel kehrte er zum Teil wieder zu seiner in der ersten Hälfte des Jahres 1882 praktizierten Verfahrensweise zurück und verwendete bei den bestimmten Adjektiven die Endung -ys.
Legendaarsed toolid Eesti Rahva Muuseumis / Kai Lobjakas
Lobjakas, Kai, 1975-
2005-01-01
Tartu Kõrgema Kunstikooli mööbliosakonna loodud ja ennistatud mööbli näitus "Mööbel. Uksed. Pööning. Vanad tehnikad ja uus elu" Eesti Rahva Muuseumi näitusemajas. Näha saab Kölni messil auhinnatud Priit Verlini kujundatud istet "Allegro", esemeid Leonhard Vene ajaloolise mööbli kogust, Viini mööblikujundaja Koloman Moseri "dr Z-le" loodud ja Tartu ekspertide poolt restaureeritud tooli
Barbieri, Dechristian França; Nogueira, Helen Cristina; Bergamin, Letícia Januário; Oliveira, Ana Beatriz
2012-01-01
Work-related musculoskeletal disorders (WRMD) are the result of the combination of different risk factors. They are very common among computer workers, mainly when neck and upper limbs are considered. Forty-two office workers from a public university participated in this study. They were divided into two groups: Symptomatic Subjects (SS, n=20) and Asymptomatic Subjects (AS, n=22), according to the Nordic Musculoskeletal Questionnaire (NMQ). Psychosocial indicators were assessed using the Job Content Questionnaire (JCQ) and Utrecht Work Engagement Scale (UWES). Workplaces were evaluated according to the Ergonomic Workplace Analysis (EWA), proposed by the Finnish Institute of Occupational Health. The NMQ showed higher weekly prevalence of complaints on neck, shoulders and wrist/hands (p=0.00) among SS. The annual prevalence of symptoms on wrist/hands was also higher among SS (p=0.02). The JCQ did not show any difference between groups (p>0.05). Higher proportion of servers with 'high level' of engagement, dedication and absorption, according to UWES, was identified among SS (p<0.01). EWA showed worse scores for 'Work Site', 'Job Content' and 'Repetitiveness of the Work' among SS (p<0.05). Servers are exposed to physical and psychosocial risk factors that can contribute to the development of WRMD. Work conditions need to be change in order to improve musculoskeletal health.
Job demands, job resources, and work engagement of Japanese employees: a prospective cohort study.
Inoue, Akiomi; Kawakami, Norito; Tsuno, Kanami; Shimazu, Akihito; Tomioka, Kimiko; Nakanishi, Mayuko
2013-05-01
Research on the prospective association of job demands and job resources with work engagement is still limited in Asian countries, such as Japan. The purpose of the present study was to investigate the prospective association of job demands (i.e., psychological demands and extrinsic effort) and job resources (i.e., decision latitude, supervisor support, co-worker support, and extrinsic reward), based on the job demands-control (JD-C) [or demand-control-support (DCS)] model and the effort-reward imbalance (ERI) model, with work engagement among Japanese employees. The participants included 423 males and 672 females from five branches of a manufacturing company in Japan. Self-administered questionnaires, including the Job Content Questionnaire (JCQ), the Effort-Reward Imbalance Questionnaire (ERIQ), the nine-item Utrecht Work Engagement Scale (UWES-9), and demographic characteristics, were administered at baseline (August 2009). At one-year follow-up (August 2010), the UWES-9 was used again to assess work engagement. Hierarchical multiple regression analyses were conducted. After adjusting for demographic characteristics and work engagement at baseline, higher psychological demands and decision latitude were positively and significantly associated with greater work engagement at follow-up (β = 0.054, p = 0.020 for psychological demands and β = 0.061, p = 0.020 for decision latitude). Having higher psychological demands and decision latitude may enhance work engagement among Japanese employees.
Januario, Leticia B; Batistao, Mariana V; Coury, Helenice Jcg; Oliveira, Ana Beatriz; Sato, Tatiana O
2014-01-01
The aim of this study was to evaluate musculoskeletal and psychosocial perception and compare these conditions regarding the type of job (white or blue-collar) and the type of management model (private or public). Forty-seven public white-collar (PuWC), 84 private white-collar (PrWC) and 83 blue-collar workers (PrBC) were evaluated. Job Content Questionnaire (JCQ) and Utrecht Work Engagement Scale (UWES) were applied to evaluate psychosocial factors. Nordic Musculoskeletal Questionnaire (NMQ) was used to assess musculoskeletal symptoms. Pressure Pain Threshold (PPT) was measured to evaluate sensory responses. According to JCQ, all groups were classified as active profile. There was a significant association between work engagement and workers' categories (p workers had the highest scores for all the UWES domains, while PrBC had the lowest ones. PPT showed that PrBC workers had an increased sensitivity for left deltoid (p workers had an increased sensitivity for both epicondyles than PuWC (right p 0.05). This study showed differences in psychosocial risk factors and musculoskeletal symptoms in workers engaged in different types of jobs and work organization. Personal and work-related characteristics, psychosocial factors and PPT responses were different across workers' group. Despite all, there was no significant difference in reported symptoms across the groups, possibly indicating that the physical load is similar among the sectors.
Spectral analysis of underwater explosions in the Dead Sea
Gitterman, Y.; Ben-Avraham, Z.; Ginzburg, A.
1998-08-01
The present study utilizes the Israel Seismic Network (ISN) as a spatially distributed multichannel system for the discrimination of low-magnitude events (ML UWEs) and 16 earthquakes in the magnitude range ML = 1.6-2.8, within distances of 10-150 km, recorded by the ISN, were selected for the analysis. The analysis is based on a smoothed (0.5 Hz window) Fourier spectrum of the whole signal (defined by the signal-to-noise criterion), without picking separate wave phases. It was found that the classical discriminant of the seismic energy ratio between the relatively low-frequency (1-6 Hz) and high-frequency (6-11 Hz) bands, averaged over an ISN subnetwork, showed an overlap between UWEs and earthquakes and cannot itself provide reliable identification. We developed and tested a new multistation discriminant based on the low- frequency spectral modulation (LFSM) method. In our case the LFSM is associated with the bubbling effect in underwater explosions. The method demonstrates a distinct azimuth-invariant coherency of spectral shapes in the low-frequency range (1-12 Hz) of short-period seismometer systems. The coherency of the modulated spectra for different ISN stations was measured by semblance statistics commonly used in seismic prospecting for phase correlation in the time domain. The modified statistics provided an almost complete separation between earthquakes and underwater explosions.
Resiliencia y engagement en el sector hotelero en la ciudad de Mar del Plata
Redondo, Ana Isabel; Arraigada, Mariana Cecilia
2015-01-01
Desde el marco de la psicología de la salud ocupacional positiva, nos proponemos realizar un estudio descriptivo sobre las variables resiliencia y engagement en el sector hotelero de la ciudad de Mar del Plata. Para tal fin, se utilizaran dos instrumentos con formato de cuestionario auto-administrado, a saber: RSA (Escala de Resiliencia en Adultos) y UWES (Utrech Work Engagement Scale) que miden dichas variables a aplicar en una muestra compuesta por 80 personas, todas ellas empleados de dos ...
Adaptation and Validation of the Brazilian Version of the Utrecht Work Engagement Scale
Vazquez, Ana Claudia Souza; Magnan, Emília dos Santos; Pacico, Juliana Cerentini; Hutz, Claudio Simon; Schaufeli, Wilmar B.
2015-01-01
Engagement at work is a positive mental and dispositional state characterized by Vigor, Dedication and Concentration. The aim of this study was to adapt and get evidence of validity for the Brazilian version of the utrecht work engagement scale (UWES). Participated in the study 1167 workers between 18 and 70 years (M = 36.8, SD = 10.3) in the Brazilian regions. Studies to establish content and construct validity with the 17- item and the 9- item scales were performed. Exploratory and confirma...
Green Capital: Student Capital student-led evaluation
Runkle, Q.; Haines, T.; Piper, K.; Leach, S.
2016-01-01
To assess and evaluate the impact of the Green Capital: Student Capital project, the partnership (the University of the West of England, the University of Bristol, the Students’ Union at UWE, and Bristol Students’ Union) worked with NUS to train a team of students from both universities to lead an evaluation process. There were two key aims for the evaluation: \\ud \\ud • To verify the quantitative outputs of the Green Capital: Student Capital project; \\ud • And to make a qualitative assessment...
Silva Peralta, Yamila Fernanda; Carena Colón, Marianela Yanel; Canuto Juárez, Mario
2015-01-01
Se presentan los resultados de una investigación exploratoria-descriptiva cuyo objetivo fue conocer los niveles de engagement y burnout en un grupo de voluntarios universitarios que participan de proyectos de extensión y voluntariado en la Universidad Nacional de Mar del Plata (UNMdP) (N=31). Se administró una entrevista semi-estructurada y los instrumentos MBI (Maslach Burnout Inventory) y UWES (Utrecht Work Engagement Scale) con la finalidad de evaluar niveles de burnout y engagement respec...
Carmen Caballero Domínguez; Orlando González Gutiérrez; Jorge Palacio Sañudo
2015-01-01
Objetivo: Analizar las relaciones entre burnout y engagement con ansiedad, depresión y rendimiento académico en estudiantes universitarios de programas de salud. Materiales y métodos: El diseño fue observacional, correlacional, multivariado; la muestra, aleatoria y estratificada, de 802 estudiantes de programas de salud de universidades de Barranquilla. Instrumentos: MBISS, UWES-S, STAI e Inventario de Depresión de Beck. Resultados: El análisis de las correspondencias múltiples entre las vari...
Uudised : Ilmub eesti kammermuusika album. RAM ja Jaan-Eik Tulve. TÜ naiskoor 55 / Joosep Sang
Sang, Joosep
2000-01-01
ER poolt välja antud eesti kammermuusika albumist "Significatio", mille esitlus toimub 17. märtsil Assauwe tornis. 11. märtsil Pärnus ja 15. märtsil Viljandis toimunud RAMi kontsertidest, juhatas J.-E. Tulve. 4. märtsil alustas TÜ naiskoor oma 55. sünnipäevale pühendatud kontserdiseeriat. Ilmus ka naiskoori esimene CD-plaat "Tähemõrsja", millel V. Tormise naiskoorimuusika
Baltimaade klaasikunstil on arenguruumi, vajaka jääb võimalustest / Mare Saare
Saare, Mare, 1955-
2008-01-01
Rahvusvaheline klaasinäitus "Vitrum Balticum IV" ("Balti klaas IV") Kaunases kuni 7. XII. Esindatud on Eesti (Kai Kiudsoo-Värv, Eeva Käsper, Ivo Lill, Kairi Orgusaar, Mare Saare, Maret Sarapu, Tiina Sarapu), Läti, Leedu ja Soome klaasikunstnikud. 14. XI rahvusvaheline seminar Läänemeremaade klaasikunsti arengukäigust 21. sajandil kunstiakadeemias. Näituse ja seminari kuraator kunstiteadlane Raimonda Kogelyte-Simanatiene
Ida-Euroopa kunsti meganäitus Stockholmis
1999-01-01
Stockholmi Moodsa Kunsti Muuseumis 16. X 1999-16. I 2000 Kesk- ja Ida-Euroopa kunsti näitus 'After the Wall'. Kuraatorid David Elliott, Bojana Pejic, Iris Müller-Westermann. Eestist osalevad Inessa Josing, Kai Kaljo, Liina Siib, Jaan Toomik. Näituse kataloogis on Jaan Kaplinski ja Heie Treieri artiklid, kataloogile tegid koostööd Johannes Saar, Raoul Kurvitz
Ida-Euroopa kunstnikud koostöövalmis
2002-01-01
21. II-31. III Tallinna Kunstihoones Viinis ja Budapestis tegutseva galeristi ja kuraatori Hans Knolli koostatud näitus "An artist who does not speak English is not an artist". Osalevad Lucehezar Boyadijev (Sofia), Aleksandr Brener, Barbara Schurz (Moskva, Viin), Rza El-Hassan (Budapest), Kai Kaljo, Roman Ondák (Bratislava), Mladen Stilinovic (Zagreb), Milica Tomic (Belgrad). Avamisel K. Kaljo performance
"Jade Warrior" kupatab Soome sampo Hiina / Kätlin Kaldmaa
Kaldmaa, Kätlin, 1970-
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola. Lisatud Ave Randviiru, Elle Kulli ja Antti-Jussi Annila "Esimesed muljed"
Sturzenegger, Susi; Johnsson, Kai; Riezman, Howard
2011-01-01
Funded by the Swiss National Science Foundation to promote cutting edge research as well as the advancement of young researchers and women, technology transfer, outreach and education, the NCCR (Swiss National Centre of Competence in Research) Chemical Biology is co-led by Howard Riezman, University of Geneva and Kai Johnsson, École Polytechnique Fédérale de Lausanne (EPFL).
Evaluation of flipped teaching
Henderson, K.; Hobbs, C.; Last, K.
2017-01-01
We report on our evaluation of flipping the classroom for two modules: a compulsory first year calculus module and an optional second year coding theory module taken by Mathe-matics students at the University of the West of England, Bristol (UWE). Flipped teaching is a change to the traditional lecture model used in universities for hundreds of years. In the traditional model the lecturer is in charge of the class and largely dictates the content and pace at which this is delivered. The idea ...
Freitas, Lori Ane Vargas de; Charão-Brito, Lucas
2017-01-01
Profissionais engajados demonstram maior entusiasmo, iniciativa e recursos internos para lidar com as exigências do trabalho. Diante disso, este estudo tem o objetivo de identificar e descrever o engajamento no trabalho em profissionais multidisciplinares de uma secretaria de saúde em um município da Região Sul. Para tanto, esta pesquisa está pautada em um estudo descritivo e quantitativo a partir da utilização do instrumento de coleta de dados Utrecht Work Engagement Scale (UWES). Os dados o...
Product marketing for eco-power; Produktemarketing fuer Oekostrom
Energy Technology Data Exchange (ETDEWEB)
Huber, D. [Verband Schweizerischer Elektrizitaetswerke, Zuerich (Switzerland)
1998-10-30
The company NaturEnergie (natural energy), a subsidiary of the Energieversorger Kraftwerk Laufenburg AG (KWL) is located in Grenzach-Whylen (Germany) near Basel (Switzerland) has been selling power generated from sun and water since the 1st of October 1998. The company employes a cleverly designed, emotional marketing strategy in order to position the brand ``NaturEnergie`` as a label for ``green power`` on the market. Bulletin VSE talked to Dr. Kai-Hendrik Schlusche (40), co-founder and member of the board of NaturEnergie AG about marketing and pricing of ``green`` power and about relations with Switzerland.(orig.) [Deutsch] Im grenznahen Grenzach-Whylen bei Basel verkauft die Firma NaturEnergie, eine Tochtergesellschaft der Energieversorger Kraftwerk Laufenburg AG (KWL) und Kraftuebertragungswerke Rheinfelden AG (KWR), seit 1. Oktober 1998 Oekostrom aus Sonne und Wasser. Mit Hilfe einer ausgekluegelten emotionellen Marketingstrategie will das junge Unternehmen die Marke `NaturEnergie` als Label fuer `gruenen Strom` im Markt positionieren. Bulletin VSE sprach mit Dr. Kai-Hendrik Schlusche (40), seit Mai 1998 Gruendungsvorstand der NaturEnergie AG, ueber Marketing, Preisgestaltung von `gruenem Strom` und die Beziehungen zur Schweiz. (orig.)
Lipids as organizers of cell membranes.
Kornmann, Benoît; Roux, Aurélien
2012-08-01
The 105th Boehringer Ingelheim Fonds International Titisee Conference 'Lipids as Organizers of Cell Membranes' took place in March 2012, in Germany. Kai Simons and Gisou Van der Goot gathered cell biologists and biophysicists to discuss the interplay between lipids and proteins in biological membranes, with an emphasis on how technological advances could help fill the gap in our understanding of the lipid part of the membrane.
Australian Defence Force Requirements for a Group-feeding Ration Pack
2010-04-01
Kai Si Ming 2 x 500g Chicken, pasta & veg 2 x 500g Frankfurters 2 x 185g Chicken curry 2 x 500g Sausages & spaghetti 2 x 500g Spaghetti & meatballs 2...Tomato & Onions Spaghetti & Meatballs Sweet Corn None Some All Very Bad Bad Neutral Good Very Good Q.12. go to Q.12. Q.7. On average, how many hours per
Aksara Incung Kerinci Sebagai Sumber Ide Penciptaan Seni Kriya
Mubarat, Husni
2015-01-01
Aksara Incung Kerinci merupakan naskah kuno yang dipakai oleh suku Kerinci pada dahulunya sebagai wahana untuk menulis sastra, hukum adat, dan mantera- mantera yang ditulis pada kulit kayu, tanduk kerbau, bambu dan daun lontar. Aksara Incung digunakan sebagai sumber penciptaan karya. Penciptaan karya ini melalui tiga tahap, yaitu eksplorasi, perancangan, dan perwujudan melalui pencarian bentuk seni kriya yang baru, kreatif, dan inovatif, dengan tidak meninggalkan kaidah-kai...
Sotsiaalselt pime ja poliitiliselt impotentne teater / Alvar Loog
Loog, Alvar
2006-01-01
Poliitilisest ja sotsiaalsest teatrist Eestis 2005. aasta lavastuste põhjal : Pip Upponi "Adolf" Tartu Püssirohukeldris, lavastaja Ervin Õunapuu; Merle Karusoo "Misjonärid" Rakvere Teatris; Alistair Beatoni "Õnnetunne" Ugalas, lavastaja Jaak Allik; Toomas Kalli " Viimane sent" Vana Baskini Teatris, lavastaja Eino Baskin; George Orwelli "Loomade farm" Tallinna Linnateatris, lavastaja Mart Koldits; Kai Henseli "Klammi sõda" VAT Teatris, lavastaja Aare Toikka
Poeetilise utoopia meister Aino Bach
2003-01-01
28. III-11. V Adamson-Ericu muuseumis graafik Aino Bachi loomingu ülevaatenäitus. Võrdluseks on eksponeeritud Eduard Wiiralti ja Kaarel Liimandi tööd. Näha võib Mark Soosaare filmi A. Bachist "Liblikapüüdja" (1978). Kuraator Anne Lõugas, kujundaja Virge Jõekalda. Kai Tuviku juhendamisel muuseumitunnid "Kuidas joonistada inimest?". 1. IV seminaril "Naiskunstnik ja tema aeg. Aino Bach" esinejad, ettekanded
Hijrih, Fatchul; Prasetyo, Taufan Harry
2015-01-01
Sebagai Perusahaan jasa tranportasi darat yaitu kereta api, PT. Kereta Api Indonesia perlu memperhatikan aspek pelayanan terhadap pelanggan dengan memperhatikan fitur-fitur Customer Relation Management dalam membuat dalam membuat aplikasi-aplikasi yang berhubungan langsung dengan pelanggan, salah satunya m-ticketing. Kemunculan m-ticketing KAI saat ini digunakan sebagai alat penjualan tiket saja. Hal ini dapat terlihat dari menu atau fitur-fitur yang disematkan kedalam aplikasi tersebut. Adan...
Lego clocks: building a clock from parts.
Brunner, Michael; Simons, Mirre J P; Merrow, Martha
2008-06-01
A new finding opens up speculation that the molecular mechanism of circadian clocks in Synechococcus elongatus is composed of multiple oscillator systems (Kitayama and colleagues, this issue, pp. 1513-1521), as has been described in many eukaryotic clock model systems. However, an alternative intepretation is that the pacemaker mechanism-as previously suggested-lies primarily in the rate of ATP hydrolysis by the clock protein KaiC.
Tuhkatriinust printsessiks / Heie Treier
Treier, Heie, 1963-
1999-01-01
Ida- ja Kesk-Euroopa 1990ndate kunsti näitus 'Pärast müüri' ('After the Wall') Stockholmis Moderna Museetis. Kureerinud David Elliott, Bojana Pejic, Iris Müller-Westermann. Seminarist. Eesti kunstnike Jaan Toomiku, Kai Kaljo, Liina Siibi, Inessa Josingu esinemisest. Kommenteerivad Moskva kuraator J. Bakstein, rootsi kunstikriitik C. Chambert, makedoonia kuraator S. Milevska, ajakirja NU toimetaja J.-P. Nilsson, New Yorgi kunstikriitik K. Levin
Nishi, Daisuke; Kawashima, Yuzuru; Noguchi, Hiroko; Usuki, Masato; Yamashita, Akihiro; Koido, Yuichi; Matsuoka, Yutaka J
2016-07-22
Although attention has been paid to post-traumatic stress disorder (PTSD) among health care professionals after disasters, the impact of traumatic events on their work has not been elucidated. The aim of this study was to examine whether disaster-related distress, resilience, and post-traumatic growth (PTG) affect work engagement among health care professionals who had been deployed to the areas affected by the Great East Japan Earthquake that occurred on March 11, 2011. We recruited disaster medical assistance team members who were engaged in rescue activities after the earthquake. The short version of the Resilience Scale (RS-14) and Peritraumatic Distress Inventory (PDI) were administered one month after the earthquake, and the short form of Posttraumatic Growth Inventory (SF-PTGI) and Utrecht Work Engagement Scale (UWES) were administered four years after the earthquake. Work engagement is composed of vigor, dedication, and absorption. Regression analyses were used to examine the relationship of UWES with RS-14, PDI, and SF-PTGI. We obtained baseline data of 254 participants in April 2011, and 191 (75.2%) completed the follow-up assessment between December 2014 and March 2015. The results showed that RS-14 predicted vigor, dedication, and absorption; in addition, SF-PTGI was positively related with these three parameters (pwork engagement among health care professionals after disasters. These findings could be useful for establishing a support system after rescue activities during a large-scale disaster and for managing work-related stress among health care professionals.
Is cancer survivorship associated with reduced work engagement? A NOCWO Study.
Berg Gudbergsson, Saevar; Fosså, Sophie D; Dahl, Alv A
2008-09-01
This study explores work engagement in employed tumor-free cancer survivors (CSs) compared to matched controls from the general population (NORM). The sample consisted of 446 CSs tumor-free after primary treatment [226 females with breast cancer and 220 males (166 testicular cancer and 54 prostate cancer)] diagnosed 2-6 years prior to the study. All had returned to work and had favourable prognosis. NORM sample consisted of 588 employed controls (319 females, 269 males). All CSs and NORM filled in a mailed questionnaire covering demography, morbidity, and work-related issues including work engagement which was self-rated by the Utrecht Work Engagement Scale (UWES). No differences in work engagement were observed between the CSs and NORM measured by the UWES total scale score or by the Dedication and Absorption domain scores. The Vigor domains score was statistically lower among CSs (p = .03), but the effect size was only 0.19. The CSs reported significantly poorer work ability, poorer health status, greater numbers of disease symptoms, more anxiety, and reduced physical quality of life, and scored significantly higher on both neuroticism and extraversion. CONCLUSIONS/IMPLICATIONS FOR CSS: In spite of poorer health CSs who had returned to work after their treatment for breast, prostate, and testicular cancer showed similar work engagement as individuals without cancer. In such CSs employers have no reason to expect reduced work engagement. Future research should preferably have a prospective and comparative design.
Engagement no Trabalho em Residentes Médicos de Pediatria
Teixeira, Priscila Regina; Lourenção, Luciano Garcia; Gazetta, Cláudia Eli; Gonsalez, Elizangela Gianini; Rotta, Daniela Salvagni; Pinto, Maria Helena; Peres, Lilian; Beretta, Denise
2017-01-01
RESUMO Objetivos Avaliar os índices de engagement no trabalho em residentes médicos de Pediatria. Métodos Amostra composta por 36 profissionais matriculados no programa de residência médica em Pediatria da Faculdade de Medicina de São José do Rio Preto no ano de 2013. Os dados foram coletados de setembro de 2013 a fevereiro de 2014, utilizando-se a Utrecht Work Engagement Scale (Uwes) – Escala Utrecht de Engajamento no Trabalho –, composta por 17 itens de autoavaliação com três dimensões,...
Cinthya Flores Jiménez; Manuel Fernández Arata; Arturo Juárez García; César Merino Soto; Marisut Guimet Castro
2015-01-01
RESUMEN El entusiasmo por el trabajo (work engagement) es un constructo que integra sentimientos de Vigor, Dedicación y Absorción (Schaufeli, Salanova, González-Romá y Bakker, 2002). El presente estudio tiene por objetivo investigar la validez factorial de la Utrecht Work Engagement Scale (UWES) en las versiones de 15 y 9 ítems en una muestra de 145 profesores de la ciudad de Lima, Perú. Se utilizaron análisis exploratorios y análisis factoriales confirmatorios. Los resultados mostraron que l...
DEFF Research Database (Denmark)
Channuie, Phongpichit; Jark Joergensen, Jakob; Sannino, Francesco
2011-01-01
We investigate models in which the inflaton emerges as a composite field of a four dimensional, strongly interacting and nonsupersymmetric gauge theory featuring purely fermionic matter. We show that it is possible to obtain successful inflation via non-minimal coupling to gravity, and that the u......We investigate models in which the inflaton emerges as a composite field of a four dimensional, strongly interacting and nonsupersymmetric gauge theory featuring purely fermionic matter. We show that it is possible to obtain successful inflation via non-minimal coupling to gravity...
Disaini abil edukaks / Bo Englund ; interv. Kai Lobjakas
Englund, Bo
2005-01-01
Euroopa Disainiühenduste büroost (Bureau of European Design Association - BEDA), rahvuslikust disainipoliitikast, Rootsi-Eesti disainikonverentsist "Innovatsioon läbi disaini - disaini oma tulevik" Viinistu Kunstimuuseumis. Kommentaar Karin Pauluselt
Hansapanga kunstisaal tutvustab Läti kunsti / Kai Vahe
Vahe, Kai
2000-01-01
2000. a. dets. lõpuni oli kunstisaalis avatud läti 5 kunstniku näitus "Distants" - Aija Zarina, Ieva Iltnere, Sarmite Malina, Anita Zabilevska ja Kristaps Gelzis. Väljendavad suhet ümbritsevasse iroonia kaudu
Turule tuleb veel üks arvutipood / Kai Simson
Simson, Kai
2004-01-01
2004. a. detsembri alguses alustas tegevust jaekaubanduskett Enter IT-Market, mille eesmärk on pakkuda kõigis Eesti maakonnakeskustes kodukasutajatele suurimat valikut arvuti- ja digikaupu ühest kohast
Kultuuriruum ja Natalie Mei prostitutsiooniteemalised joonistused / Kai Stahl
Stahl, Kai
2011-01-01
Analüüsitakse feministliku lugemise ja Juri Lotmani kultuurisemiootika abil kultuuri ja "mittekultuuri" vahelist piiriala, keskendudes viisidele, kuidas Natalie Mei erines oma joonistustega kunsti üldpildist - rikkudes traditsionaalset pildikoodi, ironiseerib Mei selle teema domineerivat käsitlust ja pildilist kuvamist, luues naiskunstnikuna uue vaatenurga
E-tervishoiust on abi kõigile / Kai Ilustrumm
Ilustrumm, Kai
2004-01-01
Vt. ka Linnaleht : Pärnu : Tehnika, Linnaleht : Tartu : Tehnika 5. nov., lk. 10. Ida-Tallinna Keskhaigla on haaratud Taani, Norra, Rootsi, Eesti ja Leedu tervishoiualasesse koostööprojekti Baltic eHealth ehk Balti e-tervishoid. Ida-Tallinna Keskhaiglasse rajatakse rahvusvaheline radioloogiakeskus
Noore õpetaja stardiraha tekitab kultuurikomisjonis vaidlusi / Kai Kalamees
Kalamees, Kai
2007-01-01
24. oktoobril esimese lugemise läbinud eelnõu, mis tagab 2008. aasta 1. septembrist esimest korda koolis tööd alustavatele õpetajatele stardiraha, jõuab uuesti riigikogu ette detsembris. Tallinna Ülikoolis kolmandal kursusel klassiõpetajaks õppiv Helen Tuga seob oma tuleviku õpetajatööga ka ilma riigi antava 200 000 kroonita
Eelarveheitlus sai eile riigikogus vihase avastardi / Kai Kalamees
Kalamees, Kai
2004-01-01
Ilmunud ka: Infopress, 1. okt. 2004, nr. 40, lk. 24. Peaminister Juhan Partsi kõnest Riigikogus 2005. aasta riigieelarve eelnõu üle andes. Riigikogu liikmete hinnanguid eelarve kohta. Diagrammid: Eelarve jõudis riigikokku. Lisa: Riigi tulud tuleval aastal. Kommenteerivad Eiki Nestor, Ain Seppik, Mart Laar
Kaheksas ehtenäitus sel hooajal / Kai Lobjakas
Lobjakas, Kai, 1975-
1999-01-01
18. VI-8. VIII Tarbekunstimuuseumis rahvusvaheline ehtekunstinäitus "Meele Avaldus/Mind Seduction". Osalema on kutsutud 30 noort ehtekunstnikku seitsmest Euroopa riigist. Kuraator ja kujundaja Ketli Tiitsar. Eestit esindavad rühmituse F.F.F.F. liikmed, Mari ja Adolfas Shaulys
Lovgoi kai; e[rga : Thucydides and His Speeches
Directory of Open Access Journals (Sweden)
Gregor Pobežin
2006-12-01
Full Text Available The paper deals with some problems posed by the study of speeches in Thucydides' History of the Peloponnesian War, especially those that result from seeking the so-called historical truth. The historical value of the speeches, which show the unmistakable influence of forensic oratory, has been subject to various interpretations. The efforts seem to be epitomised by the search for an adequate explanation of the so-called “methodological” chapter 1.22, especially the sentence 1.22.1, which has been identified as the most crucial for a proper understanding of Thucydides' use of speeches: wJ~ dÆ a]n ejdovkoun moi e{kastoi peri; tw`n ajei; parovntwn ta; devonta mavlistÆ eijpei`n, ejcomevnw/ o{ti ejgguvtata th`~ xumpavsh~ gnwvmh~ tw`n ajlhqw`~ lecqevntwn, ou{tw~ ei[rhtai . It seems absolutely imperative that this sentence be understood as an authorial manifesto, a statement of the use and arrangement of speeches in the work. To deny the author even the minimum of historical ambition in the speeches included, thus reducing the entire account to a work of largely fictional value, seems highly inadequate. The paper therefore contends that, while there is no actual proof that the speeches available to the reader were recorded in their spoken form (in fact, judging from the term th`~ xumpavsh~ gnwvmh~ , their length may well have been adapted to the needs of a historical narrative, there is similarly no ground for denying their basic historical substance.
Riigikogu laiendab eripensioni saavate ametiisikute ringi / Kai Kalamees
Kalamees, Kai
2007-01-01
Tolliseaduse muutmise eelnõust, millega loetakse alates 1. jaanuarist 2008 eripensioni saajate hulka ka tolliametnikud, kes teenisid 1990-1994 majandus- või riigipiiril ja kellel on 31. detsembriks täitunud teenistusstaazhi 20 aastat
Koolipingist ärisse / Kai Väärtnõu
Väärtnõu, Kai
2004-01-01
Õpilasfirmade Neli Poega ja R@t tegevusest ja saavutustest Euroopa õpilasfirmade võistlustel. Õpilasfirmade tegevust koordineeriva Junior Achievement'i arengufondi tegevdirektor Epp Lauk ja nõukogu esimees Rein Loik kinnitavad, et ettevõtjad ja riik on hakanud ettevõtlusharidust hindama. Kommenteerib Karoli Hindriks
Millises suunas arened, Pärnu linn? / Maie Kais
Kais, Maie, 1950-
2003-01-01
Uue üldplaneeringu kehtestamisest septembris 2001 kuni käesoleva ajani kehtestatud detailplaneeringutest. Korruselamu kerkimisest kesklinna väikeelamute keskkonda, ranna-alast, nelja korruselamu ehitamisest Rannahotelli vahetusse naabrusesse, hotelli ehitamisest Rannakohviku ja -hotelli vahelisele pargialale, liikluskorraldusest rannas ja ranna lähialadel, Seedri t. villade piiretest jm.
Storrie-Lombardi, M. C.; Sattler, B.; Muller, J.-P.; Fisk, M.; Cousins, C.; Dartnell, L.
2009-04-01
. Rev. Sci. Ins., 72(12): 4452-4459. 2. Nealson, K.H., Tsapin, A., and Storrie-Lombardi, M. 2002. Searching for life in the universe: unconventional methods for an unconventional problem. International Microbio., 5: 223-230. 3. Storrie-Lombardi, M.C., Muller, J.-P., Fisk, M.R., Griffiths, A.D., and Coates, A.J. 2008a. Potential for non-destructive astrochemistry using the ExoMars PanCam. Geophys. Res. Lett., 35: L12201, doi 10.1029/2008GL034296. 4. Storrie-Lombardi, M.C., Muller, J.-P., Fisk, M.R., Griffiths, A.D., and Coates, A.J. 2008b. Epifluorescence surveys of extreme environments using PanCam imaging systems: Antarctica and the Mars regolith. Instruments, Methods, and Missions for Astrobiology XI (R.B. Hoover, G.V. Levin, & A.Y. Rozanov, Eds.) Proc. SPIE, 7097 (25): 1-10. 5. Storrie-Lombardi, M.C. 2005. Post-Bayesian strategies to optimize astrobiology instrument suites: lessons from Antarctica and the Pilbara. Astrobiology and Planetary Missions (R. B. Hoover, G. V. Levin and A. Y. Rozanov, Eds.), Proc. SPIE, 5906: 288-301. 6. Psenner, R. and Sattler, B. 1998. Life at the freezing point. Science, 280: 2073-2074. 7. Sattler, B., Puxbaum, H., and Psenner, R. 2001. Bacterial growth in supercooled cloud droplets. Geophys. Res. Ltrs., 28(2): 239-242. 8. Sattler, B., Waldhuber, S., Fischer, H., Semmler, H., Sipiera, P., and Psenner, R. 2004. Microbial activity and phylogeny in ice cores retrieved from Lake Paula, a newly detected freshwater lake in Antarctica. Instruments, Methods, and Missions for Astrobiology VIII (R. B. Hoover, G. V. Levin and A. Y. Rozanov, Eds.) Proc. SPIE, 5555: 170-179. 9. Muller, J.-P., Storrie-Lombardi, M.C., Fisk, M.R., Coates, A., Griffiths, A., Rees, K., Walton, D., Theobald, C., Brockley-Blatt, C., and Rousseau, A. 2009. WALI - Wide Angle Laser Imaging enhancement to ExoMars PanCam: a system for organics and life detection in European Geosciences Union General Assembly 2009. Vienna, Austria.
Koostöös Eesti Instituudiga korraldas...
2004-01-01
Katariina Gild korraldas Prantsusmaal kaks näitust: 4.-16. XI Tours'i eeslinnas Saint-Cyr-sur-Loire'i Charles X paviljonis ning 19.-30. XI Loches'i linnas. Näituse kujundasid Kaire Tali ja Krista Laos, eksponeeritud olid Kai Koppeli, Viivi-Ann Keerdo, Ülle Rajasalu, Virve Kermi, Kaire Tali, Pille Kivihalli, Jane Rannametsa, Anni Kreemi, Ene Parsi, Liivia Leshkini, Ülle Kõutsi ja Krista Laose tööd.
Levitikus as agtergrond van Markus 5:25–34, geïnterpreteer in terme ...
African Journals Online (AJOL)
2 Feb 2011 ... is nie onrein nie, want dit is normaal dat daar mis sal wees daar waar koeie beweeg; dit is dus in plek. Wanneer hierdie ... mis voor in die huis, 'n plek voor waar dit nie hoort nie en dan is dit onrein. Onreinheid verwys ..... die shalom kan ervaar wat haar so lank ontneem was. kai. i;sqi u`gih.j avpo. th/j ma ...
Chaining for Flexible and High-Performance Key-Value Systems
2012-09-01
27] Fay Chang, Jeffrey Dean, Sanjay Ghemawat, Wilson C. Hsieh , Deborah A. Wallach, Mike Burrows, Tushar Chandra, Andrew Fikes, and Robert E. Gruber...70, 93 and 99.] 106 [40] Fred Douglis, Frans Kaashoek, Brian Marsh, Ramon Caceres, Kai Li, and Joshua Tauber. Storage alternatives for mobile...1994. [Cited on page 92.] [109] Haifeng Yu and Amin Vahdat. Design and evaluation of a continuous consistency model for replicated services. In
Different Styles for Different Needs – The Effect of Cognitive Styles on Idea Generation
Lomberg, Carina; Kollmann, Tobias; Stockmann, Christoph
2017-01-01
Researchers are engaged in finding the precursors for innovation. Drawing on Kirton's Adaption-Innovation (KAI) Inventory, we explicitly test Kirton's central premise that cognitive styles differentiate between preferences for producing ideas in a certain way. We argue that the generation of either a magnitude or original ideas is governed by different underlying cognitive styles. In a study with 191 individuals, we find that the cognitive style originality associates with ideational fluency ...
2011-06-10
Subamrine, Medium) LCDR Lieutenant Commander LT Lieutenant NM Nautical Mile RADM Rear Admiral ST Sen- Taka (Submarine, High Speed) STo Sen-Toku...Special Submarine) STS Sen- Taka -Sho (Submarine, High Speed(Victory)) USS United States Ship VADM Vice Admiral 1 CHAPTER 1 INTRODUCTION On...Kirai-Sen meaning Mine-Layer, KT for Kai-Toku-Chu meaning Medium, Special Submarine, ST for Sen- Taka meaning Submarine, High speed, STo for Sen Toku
Inspiratsiooni lätetel Amsterdamis : kuhu püüelda ja millest hoiduda... / Eve Koha
Koha, Eve
2002-01-01
Ülemaailmse klaasikunsti ühingu Glass Art Society 32. aastakonverentsist Amsterdamis 30. V-2. VI. Eestist osalesid Viivi-Ann Keerdo, Eve Koha, Kai Koppel, Eeva Käsper-Lennuk, Ivo Lill ja Tiina Sarapu. Näitusel "Young and Hot, European Emerging Artists" esindasid Eestit E. Käsper-Lennuk ja T. Sarapu. Elutööpreemiad ameeriklasele Fritz Dreisbachile (sünd. 1941) ja taanlasele Finn Lynggaardile (sünd. 1939)
Conference on storage in the service of energy transition
International Nuclear Information System (INIS)
Leuthold, Matthias; Marchal, David; Sitte, Ralf; Kairies, Kai-Philipp; Guerrier, Pierre; Netzel, Niklas; Radvanyi, Etienne; Lenck, Thorsten
2016-01-01
The French-German office for Renewable energies (OFAEnR) organised a conference on energy storage supporting the energy transition in France and in Germany. In the framework of this French-German exchange of experience, about 140 participants met together to debate about the answer of future storage technologies to the electric power system needs and to the optimum integration of renewable energies at different levels of the power transmission and distribution grid. This document brings together the available presentations (slides) made during this event: 1 - Storage Technologies, Status and Perspectives (Matthias Leuthold); 2 - Which electricity storage needs for 2030, 2050 in France? (David Marchal); 3 - Storage in context of the German 'Energiewende' (Ralf Sitte); 4 - Battery Storage for residential PV Systems: Grid relieving effects (Kai-Philipp Kairies); 5 - Battery Storage for residential PV Systems: Technologies and Market Trends (Kai-Philipp Kairies); 6 - Pumped hydro-stations to ensure a decentralized and flexible storage to integrate the best way RES in the electric system (Pierre Guerrier); 7 - RRKW Feldheim - Primary Frequency Control in a wind feed-in grid (Niklas Netzel); 8 - Smoothing an intermittent generation: interest of generation forecast and storage global management (Etienne Radvanyi); 9 - Power-to-gas after 2030 - A cost-benefit analysis (Thorsten Lenck)
Lichen Secondary Metabolite, Physciosporin, Inhibits Lung Cancer Cell Motility
Yang, Yi; Park, So-Yeon; Nguyen, Thanh Thi; Yu, Young Hyun; Nguyen, Tru Van; Sun, Eun Gene; Udeni, Jayalal; Jeong, Min-Hye; Pereira, Iris; Moon, Cheol; Ha, Hyung-Ho; Kim, Kyung Keun; Hur, Jae-Seoun; Kim, Hangun
2015-01-01
Lichens produce various unique chemicals that can be used for pharmaceutical purposes. To screen for novel lichen secondary metabolites showing inhibitory activity against lung cancer cell motility, we tested acetone extracts of 13 lichen samples collected in Chile. Physciosporin, isolated from Pseudocyphellaria coriacea (Hook f. & Taylor) D.J. Galloway & P. James, was identified as an effective compound and showed significant inhibitory activity in migration and invasion assays against human lung cancer cells. Physciosporin treatment reduced both protein and mRNA levels of N-cadherin with concomitant decreases in the levels of epithelial-mesenchymal transition markers such as snail and twist. Physciosporin also suppressed KITENIN (KAI1 C-terminal interacting tetraspanin)-mediated AP-1 activity in both the absence and presence of epidermal growth factor stimulation. Quantitative real-time PCR analysis showed that the expression of the metastasis suppressor gene, KAI1, was increased while that of the metastasis enhancer gene, KITENIN, was dramatically decreased by physciosporin. Particularly, the activity of 3’-untranslated region of KITENIN was decreased by physciosporin. Moreover, Cdc42 and Rac1 activities were decreased by physciosporin. These results demonstrated that the lichen secondary metabolite, physciosporin, inhibits lung cancer cell motility through novel mechanisms of action. PMID:26371759
Directory of Open Access Journals (Sweden)
Дагне Бержайте
2006-01-01
Full Text Available Intymiąją N. Nekrasovo ir F. Tiutčevo lyriką suartina dialogiškas eilėraščių pobūdis ir kai kurių rusų meilės lyrikos tradicinių motyvų raida (pvz., Puškino „išgyvenimų prisiminimų“ tema. Šie motyvai ir vaizdiniai (pavyduliavimas, kančios, lemtis, laiškai, liepsna neretai įgyja skirtingą plėtotę poetų meilės eilėraščiuose. Straipsnyje pagrindiniu nagrinėjimo objektu yra N. Nekrasovo „Degantys laiškai“ ir F. Tiutčevo „Ji sedėjo ant grindų…“. Šių dviejų tekstų analogija nagrinėjama temos ir vaizdinių lygmenyje. Išanalizuotos personažų (lyrinio subjekto ir herojės lyrinio vyksmo panašybės ir skirtybės. Autorė daro išvadą, kad Nekrasovo meilės lyrika, nepaisant romantinių motyvų pastovumo, artima XIX a. antros pusės rusų psichologinei prozai su jai būdinga griaunančios meilės jėgos tema.
Chung, Saehyang P
2011-01-01
This paper examines several pioneering genre paintings by the important scholar painter Yun Duseo (1668-1715), with its focus on their artistic sources which have not yet been explored so far. Painted on ramie, 'Women Picking Potherbs' is one of the most intriguing examples among Yun Duseo's oeuvre, which encompasses a broad variety of themes, including genre imagery, landscapes, portraits, dragons, and horses. Even among Yun Duseo's genre paintings, 'Women Picking Potherbs' is extraordinary, as recent scholarship regards it as the earliest independent representation of lower-class women in the history of Korean art. In particular, Yun Duseo painted two women who were working ourdoors to gather spring potherbs. In a conservative Confucian society, it was extraordinary women who were working outdoors. Hence, Yun Duseo occupies a highly important place in Korean painting. Furthermore, even though Yun Duseo came from the upper-class, he often painted images of lower class people working. It is possible that Yun Duseo was familiar with the book titled "Tian gong kai wu" (Exploitation of the Works of Nature) which was published in the 17th century. By identifying the probable body of his artistic sources in the book known as "Tian gong kai wu," it will be possible to assess the innovations and limitations found in 'Women Picking Potherbs'.
ENGAGEMENT AND BURNOUT AMONG NURSING AND PSYCHOLOGY STUDENTS IN SLOVAKIA
Directory of Open Access Journals (Sweden)
Zuzana Škodová
2017-05-01
Full Text Available Aim: The aim of the study was to examine the differences in engagement and burnout syndrome in students of nursing/midwifery and psychology in Slovakia. Design: A cross-sectional design was used. Methods: 171 university students on a baccalaureate program participated in the research (90.9% females; age 20.6 ± 1.3; 80 psychology students, 91 nursing/midwifery students. The School Burnout Inventory (SBI and Utrecht Work Engagement Scale (UWES were employed as measurement methods. Results: A significant negative association between levels of burnout and engagement (R = 0.42; p < 0.01 was found. A linear regression model showed a significant effect of engagement on burnout (β = -0.34; 95% CI: -0.50; -0.19. However, the total explained variance was only 19.4%. Students of psychology scored higher in engagement compared to nursing and midwifery students (t = 6.89; p < 0.001. Conversely, midwifery and nursing students had higher levels of burnout compared to the group of psychology students (t = -4.55; p < 0,001. Conclusion: Nursing is considered to be a high risk profession in terms of development of burnout, which was demonstrated in this study by the higher burnout, and lower engagement levels in nursing and midwifery students. Higher attention to coping mechanisms for stress and burnout symptoms among students of healthcare professions is required in the school curriculum, especially in nursing programs. Keywords: burnout syndrome, engagement, students of nursing, midwifery, students of psychology, School Burnout Inventory (SBI, Utrecht Work Engagement Scale (UWES.
Biogas upgrading to biomethane. Proceedings; Biogasaufbereitung zu Biomethan. Tagungsband
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-12-05
Within the 6th Hanauer Dialogue 'Biogas upgrading to biomethane' at 21st February, 2008, the following lectures were held: (a) Processing of biogas - an introduction (Michael Beil); (b) The climate protecting targets of the Federal Republic of Germany: Which role will play the upgrading of biogas, and which legal boundary conditions are created by the Federal Government? (Uwe Holzhammer); (c) Future strategy: CH{sub 4} grids (Juergen Schmid); (d) Biogas upgrading and biomethane utilization in Sweden (Anneli Petersson); (e) Biogas upgrading and utilization of bio methane in Switzerland (Arthur Wellinger); (f) Biogas upgrading by means of pressure swing adsorption (Alfons Schulte-Schulze Berndt); (g) Biogas upgrading by means of pressurized water washing (Ulf Richter); (h) Biogas upgrading for feeding in public grids. The case of biogas plant Bruck a.d. Leitha (Michael Harasek); (i) Biogas upgrading by means of chemical absorption according to the LP Cooab process (Jerome van Beek); (j) Practical experiences in unpressurized amine washing MT bio methane (Karsten Wuensche); (k) Biogas upgrading by means of organic physical washing with HAASE biogas amplifiers (Roland Kahn); (l) Upgrading using cryogenic technology; the GPP registered -system (Jeroen de Pater); (m) Micro Gas Distribution Systems: Alternatives to biogas upgrading and grid injection (Michael Beil, Bernd Krautkremer); (n) Feeding of exchange gas. The case of project Straelen and Kerpen (Frank Schaefer); (o) Feeding of biogas from the view of grid operators (Norbert Nordmeyer); BIOGASMAX: Biogas as Vehicle Fuel - Market Expansion to 2020 Air Quality (Michael Beil, Uwe Hoffstede); (p) Study: Feeding of biogas into the natural gas distribution system (Fachagentur Nachwachsende Rohstoffe).
On aeg mängida! / Ell-Maaja Randküla
Randküla, Ell-Maaja, 1939-2016
2005-01-01
Tartu Mänguasjamuuseumi (Tartu, Lutsu t. 8) sisekujundus. Autorid: Tea Tammelaan, Krista Lepland, Malle Jürgenson, OÜ Laika, Belka & Strelka. Maalitud põrandavaip: Kai Kaljo. Maalitud pitslinad: Tuuli Puhvel. Ehitaja: AS Facio Ehitus. Eesti Sisearhitektide Liidu 2004. a. aastapreemiate konkursil pälvis ajaloolise interjööri preemia. T. Tammelaanest, K. Leplandist ja M. Jürgensonist, OÜ Laika, Belka & Strelka tähtsamad tööd. Ill.: plaan, 23 värv. vaadet
Wennan Liu
2013-01-01
Chiang Kai-shek launched the New Life Movement in Nanchang in February 1934 to revive traditional morality by reforming people’s daily behavior. In response to civil leader Wang Jingwei’s challenge, Chiang agreed to deploy moral suasion to urge the Chinese people to observe the New Life directives, but he still integrated the movement into government routine and relied on government agents, especially policemen, to implement it. Contemporary politicians and commentators understood this moveme...
Into the Eye of the Commander: Military Advisory During Conflict
2011-03-16
Northeast 3 Asia. First, China continued to struggle through a bloody civil war between Chiang Kai- shek‘s Nationalists and Mao Tse -tung‘s Communist...Indochina into Cambodia and Laos and further sub-divided Vietnam along the 17th Parallel into a communist north and a democratic 9 south. The...insurgencies in Laos and South Vietnam had begun to take an ominous turn. Fearing both nuclear and conventional parity with the Soviet Union
Schulze, Kathrin
2011-01-01
Um Tumorsuppressorgene beim Ovarialkarzinom zu identifizieren wurde eine Kartierung von LOH-Intervallen der Region 11p15.5 - 11p11.2 mittels 11 Mikrosatellitenmarkern an 47 Ovarialtumorproben vorgenommen. Im Bereich des ST5- und AFM255/KAI1-Locus konnten potentielle Intervalle abgegrenzt werden. Das Fanconi Anämie Gen FANCF wurde für Untersuchungen zum Expressions- und Methylierungsstatus ausgewählt, da dessen Abschaltung mit einem besseren Ansprechen auf Cisplatin bei Ovarialkarzinompatienti...
Gas Warfare in World War I. The 3rd. Division at Chateau Thierry, July 1918
1959-07-01
I hvt ’.o 1, 17 Jun (Vb, i p. 35 - 36’. 1Jnf.-D>in -i. 10. 1andý’er:Divu i -@Una 5O~fg opv ~lGe vns me., 44 %~ Aw sw1 .~.g P.. 9.s KAi,, .I P LAM... indoors (where delay in masking or escaping to the open was almost certain to rqsult in casualties]. Shell fire and a general sense of insecurity
MONTAGE: A Methodology for Designing Composable End-to-End Secure Distributed Systems
2012-08-01
and verification, from PSOS [NF03] to the recent seL4 [KEH+09]. While they make considerable progress toward high-assurance OS, these works are not...of the specification itself. Examples include the seL4 microkernel work by Klein et al. [KEH+09], which presents the experience of formally proving...David Cock, Philip Derrin, Dhammika Elkaduwe, Kai Engelhardt, Rafal Kolanski, Michael Norrish, Thomas Sewell, Harvey Tuch, and Simon Winwood. sel4
Enkele gedagtes oor Matteus se gebruikmaking van die Ou ...
African Journals Online (AJOL)
Testament immers geensins op 'n eenvormige manier nie. Om hierdie ... kai en ekei héds tës teleutës Hërodou hína plërdthë tó rhêthén hupd kurtou diá ... evangelis 'n duidelike verband tussen Herodes en Farao se kinder- moorde trek, val die duidelike toespeling op Eksodus 4:19-20 in vers. 20 nie te ontken nie. Daar is 'n ...
Lietuvos Respublikos savivaldybių komunikacija socialiniame tinkle „Facebook“
Blinstrubas, Mantas
2014-01-01
Bakalauro baigiamajame darbe nagrinėjama Lietuvos Respublikos savivaldybių komunikacija Lietuvoje ir pasaulyje populiariausiame socialiniame tinkle „Facebook“. Savivaldybė šio tyrimo rėmuose traktuojama kaip teritoriškai determinuota bendruomenė ir kaip vietos valdžios organas. Ataskaitoje pristatomo tyrimo problema išreiškiama klausimais „Kokia yra viešojo administravimo institucijų komunikacijos socialiniuose tinkluose specifika? Kokia yra Lietuvos Respublikos savivaldybių komunikacijos soc...
27. ja 28. IX toimus Narvas VII Eesti muuseumide näituste festival ja seminar
2004-01-01
I koha pälvis ERMi ja Adamson-Ericu muuseumi koostööprojekt "Viinapuuväät. Maasikakiri II" (kontseptsiooni ja haridusprogrammi autorid Vaike Reemann, Ülle Kruus, Kersti Koll ja Kai Tuvik, kujundaja Denes Farkas, monteerija Vahur Puik), II - Tartu Kunstimuuseumi näitus "Muuseum muuseumis" (kontseptsiooni autorid ja teostajad Ahti Seppet, Hannes Varblane), III - Viljandi muuseumi näitus "Rõõmud lumel ja jääl" (idee autor Herki Helves)
Network Intrusion Dataset Assessment
2013-03-01
International Conference on Computational Intelligence and Natural Computing, volume 2, pages 413–416, June 2009. • Rung Ching Chen, Kai -Fan Cheng, and...Chia-Fen Hsieh . “Using rough set and support vector machine for network intrusion detection.” International Journal of Network Security & Its...intrusion detection using FP tree rules.” Journal Of Advanced Networking and Applications, 1(1):30–39, 2009. • Ming-Yang Su, Gwo-Jong Yu , and Chun-Yuen
Innovative behavior in nurse executives.
Adams, C E
1994-05-01
This study addresses the problem-solving styles of hospital nurse executives and explores the relationship between problem-solving style and leader effectiveness. The Kirton Adaption-Innovation Inventory (KAI) and the Leader Effectiveness and Adaptability Description-Self (LEAD-S) were the instruments used to survey nurse executives from 66 medium-sized urban California hospitals. The majority of respondents used innovative approaches, but no correlation was found between problem-solving style and leader effectiveness.
Contract W911NF-09-1-0384 (Purdue University)
2012-10-27
spin system, Physical Review A , (02 2010): 22324. doi: 10.1103/PhysRevA.81.022324 08/31/2011 8.00 Sabre Kais, Anmer Daskin . Group leaders... a collection of information if it does not display a currently valid OMB control number. PLEASE DO NOT RETURN YOUR FORM TO THE ABOVE ADDRESS. a ...billions ) and developed new quantum algorithms to solve complex chemistry problems such as global optimization and excited states of molecules. ( a ) Papers
Epner, Pille
2013-01-01
Arhitektuurikonkursist, võidutööst "Fiat Lux" (arhitektid Risto Parve, Kai Süda, Martin Kinks, Margit Valma, arhitektuuriteadlane Mait Väljas, Karisma Arhitektid), 2. koha pälvinud tööst "Õhuke Koht" (Pille Noole, Üllar Ambos, Kaisa Lasner, Kerttu Karjust, Jiannis Lykouras, Arhitektuurinurk), 3. koha pälvinud tööst "Tee" (Villem Tomiste, Stuudio Tallinn). Loetletud ostupreemia ja kolm tunnustuse pälvinud võistlustööd
Corruption in Conflict: Lessons from the U.S. Experience in Afghanistan
2016-09-01
United States Toll- free : 866-329-8893 DSN: 312-664-0378 All voicemail is in English and answered during business hours. By fax: 703-601-4065 By email...efforts: Chiang Kai-shek’s counterinsurgency against Mao Zedong in China, the British counterinsurgency in Malaysia , and the U.S.-trained South...accept abuse of power, corruption, or marginalization.”232 Similar messages were appearing across the U.S. government. In his 2009 speech on the Af
International Nuclear Information System (INIS)
Roebers, H.
1994-01-01
Specific Japanese innovative improvements in natural gas distribution systems and natural gas appliances are outlined, based on the KAI-ZEN philosophy. Attention is paid to the design of flexible gas pipes, gas plug-in sockets, and safety systems, and the compact design of gas appliances. Much of the innovations focus on details. Briefly, the NEXT 21 project is described, which project anticipates the silent wishes of the Japanese people with regard to lifestyle
Directory of Open Access Journals (Sweden)
Gonçal Mayos
2017-11-01
Full Text Available Reseña de: Saul fia (El hijo de Saúl, Año 2015, Duración 107 min., País Hungría, Director László Nemes, Guión László Nemes, Clara Royer, Música László Melis, Fotografía Mátyás Erdély; Reparto: Géza Röhrig, Levente Molnár, Urs Rechn, Sándor Zsótér, Todd Charmont, Björn Freiberg, Uwe Lauer, Attila Fritz, Kamil Dobrowolski, Christian Harting; Productora Laokoon Filmgroup.
Vikergallup : Eesti kirjandus 2006
2007-01-01
19 arvustaja vastus küsimusele, milline oli 2006. aasta parim uudisraamat ja debüütteos. Ära nimetati Hasso Krulli luulekogu "Talv", Jan Kausi romaan "Tema", Madis Kõivu "Näidendid I", Jaan Pehki luulekogu "Tuigu kui tuled", Tarmo Tedre romaan "Onanistid", Kristiina Ehini romaan "Pillipuhujanaine ja pommipanijanaine", Marko Kompuse luulekogu "Vallaliste jõgede tõkkejooksja", Mathura luulekogu "Kohalolu", Rein Põdra romaan "Eike", Indrek Ryytle luulekogu "Inglid rokijaamas", Triin Soometsa "Väljas" ja Ervin Õunapuu romaan "Meie igapäevane jää". Debüütteostest mainiti Kaupo Meieli luulekogu "Polügrafisti käsiraamat", Anti Saare romaani "Kuidas sa ära läksid ja mina maha jäin", Andra Teede luulekogu "Takso Tallinna taevas", Maarja Kangro luulekogu "Kurat õrnal lumel", Andrus Elbingu luulekogu "Siin Beebilõust, tere!", Tiina Ilvese juturaamat "Augustihambad", Indrek Koffi luulekogu "Vana laul", Eliina Kortsu luulekogu "Lööklaused murravad metsi", Carolina Pihelga luulekogu "Sõrmemuster" ja Paavo Piigi luulekogu "Kummuli linnad"
Sild, Tiit, 1977-
2006-01-01
Arhitektuurivõistluse eesmärgist, premeeritud töödest. Tulemused: I preemia - Tiina Skolimowski, Kai Süda, Risto Parve, töö "Figuur", II - Karli Luik, Ralf Lõoke, Maarja Kask (AB Salto), töö "Saarestik", III - Jaak-Adam Looveer, Toomas Paaver, Lauri Saar, Indrek Järve, Tõnu Laanemäe (AB Paik Arhitektid), töö "Mult", ergutuspreemia - Ott Kadarik, Villem Tomiste, Mihkel Tüür, Kaiko Kivi, Krista Saluveer (AB Kosmos), töö "Sammal"
Implicitly Defined Neural Networks for Sequence Labeling
2017-07-31
ularity has soared for the Long Short - Term Memory (LSTM) (Hochreiter and Schmidhuber, 1997) and vari- ants such as Gated Recurrent Unit (GRU) (Cho et...610. Sepp Hochreiter and Jürgen Schmidhuber. 1997. Long short - term memory . Neural computation 9(8):1735– 1780. Zhiheng Huang, Wei Xu, and Kai Yu. 2015...network are coupled together, in order to improve perfor- mance on complex, long -range dependencies in either direction of a sequence. We contrast our
Fatria, Erian
2017-01-01
Needless to say that environmental deterioration is brought about by the people intervention toward a nature. It has been assumed that people personality and intelligent influence the ecosystem. That is why the objective of this study is to find out relationship between knowledge about issues (KAI) and Locus of Control (LOC) with citizenship behavior (CB). In order meet with this objective, a survey method has been applied by involving 110 students as sample. There are three instruments, meas...
1994-05-01
on Economic Development, which will convene in Rio de Janeiro in June of 1992, will be the next major forum at which this issue may surface for...1985. Coastal oceanography of Japan Islands. Tokai University Shuppan-kai, viii+8+353 pp. (in Japanese). Otsuki, T. 1990. Jinko lagoon . Umetate to...for acclima- tion. It also took 100 days for the test to get the expected water quality with performing de -nitrogen treatment by reducing airflow of
Harms, Christoph; Helms,; Taschner,; Stratos,; Ignatius,; Gerber,Thomas; Lenz,; Rammelt,; Vollmar,Brigitte; Mittlmeier,Thomas
2012-01-01
Christoph Harms,1 Kai Helms,1 Tibor Taschner,1 Ioannis Stratos,1 Anita Ignatius,5 Thomas Gerber,2 Solvig Lenz,3 Stefan Rammelt,6 Brigitte Vollmar,4 Thomas Mittlmeier11Department of Trauma and Reconstructive Surgery, 2Department for Materials Research and Nanostructures, Institute for Physics, 3Department of Oral and Maxillofacial Plastic Surgery, 4Institute for Experimental Surgery, University of Rostock, Rostock, 5Institute of Orthopaedic Research and Biomechanics, University of Ulm, Ulm, 6C...
Algorithms for Large-Scale Astronomical Problems
2013-08-01
Magana, Ross O’Connell, Xiaoying Xu, and Feng Yu . They are very nice and provided a lot of useful information. During these years I have worked with...Sicun Gao, Fan Guo, Yunchuan Kong, Ni Lao, Lei Li, Nan Li, Jialiu Lin, Yuefeng Lin, Xi Liu, Ning Lu, Min Luo, Kai Ren, Chao Shen, Long Qin, Huimin... Hsieh , Deborah A. Wallach, Mike Burrows, Tushar Chandra, Andrew Fikes, and Robert E. Gruber. Bigtable: A distributed storage system for structured data
Jätkusuutlikkusest tervisesektoris / Tiit Siinmaa
Siinmaa, Tiit
2005-01-01
Ülevaade 24. novembril 2005. a. Tallinnas Salme kultuurikeskuses toimunud tervisefoorumi "Eesti tervisesüsteemi arengud ja väljakutsed" kolmanda sessiooni ettekannetest. Esinesid Maailma Tervishoiuorganisatsiooni Euroopa regionaalse kontori tervisesüsteemide finantseerimise regionaalnõunik Joseph Kutzin, Singapuri ülikooli tervisepoliitika ja -juhtimise professor Kai Hong Phua, rahandusministeeriumi finantspoliitika asekantsler Veiko Tali, sotsiaalministeeriumi terviseala asekantsler Ivi Normet, Tervise Arengu Instituudi arenduskeskuse juhataja kt Aljona Kurbatova ja Euroopa Rahvatervise Assotsiatsiooni juhtkomitee liige dr Anu Kasmel. Lisatud statistilised tabelid ja diagrammid