WorldWideScience

Sample records for kahn ra clinical

  1. The eurozone after Strauss-Kahn

    Institute of Scientific and Technical Information of China (English)

    Martin Wolf

    2011-01-01

    @@ The sight of Dominique Strauss-Kahn, managing director of the International Monetary Fund and prospective candidate for the French presidency,doing the “perp walk” was stupefying.If the charges are true, this capable man is a lunatic.But, unless the case collapses, the event will cast a long shadow.

  2. MRI comes of age in RA clinical trials

    DEFF Research Database (Denmark)

    Peterfy, Charles; Østergaard, Mikkel; Conaghan, Philip G

    2013-01-01

    The success of modern rheumatoid arthritis (RA) therapies and treatment strategies has led to extended placebo phases being unethical in RA randomised controlled trials (RCTs). Modern trials therefore increasingly involve active comparator designs, and this together with some technical issues has...

  3. Kahn / Kubrick. Simetrías compositivas

    Directory of Open Access Journals (Sweden)

    Angel L. Camacho Pina

    2014-01-01

    Full Text Available Partes clave de la historia del cine o de la arquitectura, tanto en la obra de Stanley Kubrick como en la de Louis Kahn están fuertemente ligadas a ciertos conceptos comunes; entre ellos, y por encima del resto, la idea de orden formal, no independiente a su vez del ideal de perfección. Dejando en un segundo plano las significativas analogías biográficas, en el presente trabajo se abordan las posibles convergencias entre aspectos formales de ambos autores: la composición arquitectónica de Kahn y la puesta en escena practicada por Kubrick. Los dos además, desarrollaron su trabajo de forma particularmente intensa con un control total de su obra y ejercieron su profesión desde la perspectiva casi exclusiva de la obra de arte.

  4. Corner Office: ProQuest's Marty Kahn

    Science.gov (United States)

    Fialkoff, Francine; Oder, Norman

    2009-01-01

    In a scant three years at ProQuest, Marty Kahn, CEO, has moved a company coming out of a financial morass back onto solid ground. He came on board after the purchase of ProQuest Information and Learning by the (mostly) privately owned Cambridge Information Group in late 2006 and the merger of ProQuest and CSA to form ProQuest CSA. (It's now just…

  5. Corner Office: ProQuest's Marty Kahn

    Science.gov (United States)

    Fialkoff, Francine; Oder, Norman

    2009-01-01

    In a scant three years at ProQuest, Marty Kahn, CEO, has moved a company coming out of a financial morass back onto solid ground. He came on board after the purchase of ProQuest Information and Learning by the (mostly) privately owned Cambridge Information Group in late 2006 and the merger of ProQuest and CSA to form ProQuest CSA. (It's now just…

  6. The Kodaikanal Experience: Chapter II. Kahn-Montessori Interview

    Science.gov (United States)

    NAMTA Journal, 2013

    2013-01-01

    This article provides an interview transcript between David Kahn and Mario Montessori (1898-1982), son of Dr. Maria Montessori. Mario Montessori dedicated his life to the preservation, dissemination and application of Montessori's works. Herein Kahn asks Montessori about his time living in the hills of Kodaikanal, India. Montessori touches upon…

  7. Long-term clinical investigation of patients with ankylosing spondylitis treated with /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, E. (Universitatsklinik Friedrichsheim, Frankfurt, West Germany); Ruckbeil, C.; Wick, R.R.

    1983-01-01

    Between 1952 and 1980 about 250 patients with ankylosing spondylitis were treated with /sup 224/Ra at the Orthopaedic University Hospital of Frankfurt/M. In 1970, 119 of them were examined and X-rayed as was another group of 40 patients in 1980. The results of those examined could be compared with a group of 40 patients treated without /sup 224/Ra. Patients with /sup 224/Ra demonstrated a long-lasting period of subjective improvement after the treatment, with reduced consumption of antirheumatoid and analgesic drugs, on the average. Blood examinations show inflammatory activities. Nevertheless, the ankylosing spondylitis proceeded. In the final stages of the disease, neither the clinical aspects nor the X-rays showed any specific changes. We observed no case of malignant bone tumor. Of the 169 examined patients, 22 had a total of 32 children after the treatment with /sup 224/Ra. Among these was a set of twins with cerebral palsy and diabetes insipidus renalis. In conclusion, /sup 224/Ra in ankylosing spondylitis is a recommended treatment without higher risk compared to the common therapy with drugs.

  8. QUEST-RA: quantitative clinical assessment of patients with rheumatoid arthritis seen in standard rheumatology care in 15 countries

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Kautiainen, Hannu; Toloza, Sergio

    2007-01-01

    OBJECTIVE: To conduct a cross-sectional review of non-selected consecutive outpatients with rheumatoid arthritis (RA) as part of standard clinical care in 15 countries for an overview of the characteristics of patients with RA. METHODS: The review included current disease activity using data from...

  9. QUEST-RA: quantitative clinical assessment of patients with rheumatoid arthritis seen in standard rheumatology care in 15 countries

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Kautiainen, Hannu; Toloza, Sergio

    2007-01-01

    ) within and between countries was graphically analysed. A median regression model was applied to analyse differences in disease activity between countries. RESULTS: Between January 2005 and October 2006, the QUEST-RA (Quantitative Patient Questionnaires in Standard Monitoring of Patients with Rheumatoid...... of clinical status and treatments of patients with RA in standard clinical care in 2005-6 including countries that are infrequently involved in clinical research projects....

  10. The clinical significance of the anti-RA33 level in patients with rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Mehmet Türkmen

    2016-12-01

    Full Text Available Objective: The early diagnosis of Rheumatoid Arthritis (RA is of due significance for the prevention of possible damage to the joint tissue by means of treatment. Laboratory tests are very important for monitoring RA activity and for the evaluation of the patients’ response to the treatment. Rheumatoid factor, so far the most commonly used test for the cases with suspected RA, is not a specific parameter despite its sensitivity to RA. The measurement of other autoantibodies might be helpful to the diagnosis particularly for the cases with low RF titer or with suspected diagnosis. The measurement of anti-RA33 autoantibodies is one of the tests used in the diagnosis of the RA cases. The present study was conducted to compare anti-RA33 levels of healthy individuals with long-term RA cases and to evaluate the value of anti-RA33 test for the RA diagnosis. Method: Total 40 patients (28 female and 12 male identified with RA at least for the last five years according to the classification criteria of American College of Rheumatology (ACR reviewed in 1987 and 40 healthy controls included in the present study. Results: AntiRA-33 level was determined as 12.47±4.97 U/mL for the patients with RA and as 1.96±1.82 U/mL for the healthy controls, and there is no statistically significant difference between the groups. Conclusions: As a result AntiRA-33 level was evaluated in RA patients and no difference was found compared to control group.

  11. Factors affecting {sup 223}Ra therapy: clinical experience after 532 cycles from a single institution

    Energy Technology Data Exchange (ETDEWEB)

    Etchebehere, Elba C. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States); Campinas State University (Unicamp), Department of Nuclear Medicine, Campinas (Brazil); Milton, Denai R. [The University of Texas MD Anderson Cancer Center, Department of Biostatistics, Houston, TX (United States); Araujo, John C. [The University of Texas MD Anderson Cancer Center, Department of Genitourinary Medical Oncology, Houston, TX (United States); Swanston, Nancy M.; Macapinlac, Homer A.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States)

    2016-01-15

    The aim of this study was to identify baseline features that predict outcome in {sup 223}Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with {sup 223}Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first {sup 223}Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after {sup 223}Ra we evaluated: the total number of radium cycles (Ra{sub Tot}), the PSA doubling time (PSA{sub DT}), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the {sup 223} Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSA{sub DT} (HR = 8.22; p < 0.001). Ra{sub Tot}, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). Ra{sub Tot}, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only Ra{sub Tot} and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, Ra{sub Tot} (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and {sup 223}Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  12. The performance of matrices in daily clinical practice to predict rapid radiologic progression in patients with early RA.

    Science.gov (United States)

    De Cock, D; Vanderschueren, G; Meyfroidt, S; Joly, J; Van der Elst, K; Westhovens, R; Verschueren, P

    2014-04-01

    To compare in daily clinical practice the reliability of matrices that forecast rapid radiologic progression (RRP) at year one, at year two, and over 2 years in patients with early rheumatoid arthritis (RA). Overall, 74 early RA patients with X-rays of hands and feet at baseline, year one, and year two were included. Initial DMARD combination therapy with steroids (ICTS) or DMARD monotherapy (IMT) was initiated according to patients' RA severity, based on rheumatologist opinion. The images were scored via the modified Sharp/van der Heijde (SvH) method. A total Sharp score progression of equal or higher than five per year was considered RRP. Six matrices were tested: ASPIRE CRP/ESR matrices, the BEST matrix, two SWEFOT matrices, and the ESPOIR matrix. Patients were placed in each of them yielding a RRP probability. The performance was tested by Area Under the Curve analysis reflecting the predictive value. Four patients developed RRP in year one, five in year two, and four over 2 years. With regard to face validity, the predicted probability did not correspond to the risk in reality: the one ICTS patient who developed RRP over 2 years was always found in the lowest RRP categories of all matrices. The ASPIRE CRP matrix yielded at least a moderate predicting value for the three time points. The other matrices showed moderate to no predicting value. The performance of all matrices was disappointing and it is impossible to fully rely on the existing matrices in daily clinical practice. © 2013 Published by Elsevier Inc.

  13. Scintigraphic, radiological and clinical results after /sup 224/Ra therapy in patients with Bechterew's disease

    Energy Technology Data Exchange (ETDEWEB)

    Redecker, S.; Crone-Muenzebrock, W.; Weh, L.; Montz, R. (Hamburg Univ. (Germany, F.R.))

    1982-04-01

    53 patients with ancylosing spondylitis (clinical stages II and III) were treated with 1 MBq Ra 224 over a period of ten weeks. In 44 patients the orthopaedic findings were improved, in 9 patients they remained unchanged. An iridocyclitis developed in 3 patients, in 1 case an uveitis could be observed 33 patients were reexamined clinically, radiologically including total body scan and by laboratory means after an average period of 7.1 years. The stiftness of the spine was slightly improved compared with the pre-therapeutical status. Radiologically the spine findings were unchanged in 7 patients, progradient in 16, and clearly deteriorated in 8 cases. Scintiscanning of the skeleton of 21 patients showed a normal activity in 6 patients, 8 patients had a slight increase of the activity, mainly in the sacroiliac region 7 patients revealed a highly increased activity in the sacro-iliac region and lumbovertebral spine. Differential blood count and electrophoresis were unchanged before and after therapy. In 60% of the cases the erythrocyte sedimentation rate was diminished compared with pretherapy findings, in 40% the rate was unchanged or increased. Subjectively 10% of the patients reported no pain symptoms, 50% felt better, 30% were unchanged and 10% felt more poorly than before.

  14. Autoantibodies to citrullinated proteins in rheumatoid arthritis: clinical performance and biochemical aspects of an RA-specific marker.

    NARCIS (Netherlands)

    Nijenhuis, S.; Zendman, A.J.W.; Vossenaar, E.R.; Pruijn, G.J.M.; Venrooij, W.J.W. van

    2004-01-01

    Rheumatoid arthritis (RA) is a common, systemic autoimmune disease of which the exact etiology is not known. In the past 10 years, substantial progress has been made in the identification of the antigens specifically recognized by the autoantibodies of RA patients. A central factor in this respect i

  15. The prevalence of clinical remission in RA patients theated with anti-TNF: results from the Dutch Rheumatoid Arthritis Monitoring (DREAM) registry

    NARCIS (Netherlands)

    Punder, de Yvonne M.R.; Fransen, Jaap; Kievit, Wietske; Houtman, Pieternella M.; Visser, Henk; Laar, van de Mart A.F.J.; Riel, van Piet L.C.M.

    2012-01-01

    Objectives. To evaluate the prevalence of clinical remission and minimal disease activity according to the ACR/European League Against Rheumatism (EULAR) remission, DAS-28 <2.6 and minimal disease activity (MDA) criteria, and to compare the extent of residual disease activity with disability in RA p

  16. Ottawa Panel Evidence-Based Clinical Practice Guidelines for Patient Education in the Management of Rheumatoid Arthritis (RA)

    Science.gov (United States)

    Brosseau, Lucie; Wells, George A.; Tugwell, Peter; Egan, Mary; Dubouloz, Claire-Jehanne; Welch, Vivian A.; Trafford, Laura; Sredic, Danjiel; Pohran, Kathryn; Smoljanic, Jovana; Vukosavljevic, Ivan; De Angelis, Gino; Loew, Laurianne; McEwan, Jessica; Bell, Mary; Finestone, Hillel M.; Lineker, Sydney; King, Judy; Jelly, Wilma; Casimiro, Lynn; Haines-Wangda, Angela; Russell-Doreleyers, Marion; Laferriere, Lucie; Lambert, Kim

    2012-01-01

    Background and purpose: The objective of this article is to create guidelines for education interventions in the management of patients ([greater than] 18 years old) with rheumatoid arthritis (RA). Methods: The Ottawa Methods Group identified and synthesized evidence from comparative controlled trials using Cochrane Collaboration methods. The…

  17. Ottawa Panel Evidence-Based Clinical Practice Guidelines for Patient Education in the Management of Rheumatoid Arthritis (RA)

    Science.gov (United States)

    Brosseau, Lucie; Wells, George A.; Tugwell, Peter; Egan, Mary; Dubouloz, Claire-Jehanne; Welch, Vivian A.; Trafford, Laura; Sredic, Danjiel; Pohran, Kathryn; Smoljanic, Jovana; Vukosavljevic, Ivan; De Angelis, Gino; Loew, Laurianne; McEwan, Jessica; Bell, Mary; Finestone, Hillel M.; Lineker, Sydney; King, Judy; Jelly, Wilma; Casimiro, Lynn; Haines-Wangda, Angela; Russell-Doreleyers, Marion; Laferriere, Lucie; Lambert, Kim

    2012-01-01

    Background and purpose: The objective of this article is to create guidelines for education interventions in the management of patients ([greater than] 18 years old) with rheumatoid arthritis (RA). Methods: The Ottawa Methods Group identified and synthesized evidence from comparative controlled trials using Cochrane Collaboration methods. The…

  18. Louis I. Kahn, el paisaje telúrico y las maquetas de arcilla

    OpenAIRE

    Jové Sandoval, José María

    2016-01-01

    Kahn siempre mantuvo una especial conexión con el paisaje reconociéndose desde muy temprano en sus dibujos y pinturas, especialmente en sus bocetos de viaje. Él forjó una idea de un paisaje telúrico, formado por el moldeado del suelo en conjunción con la arquitectura; para trabajarlo y transmitirlo encontraría un instrumento muy eficaz: las maquetas de arcilla. Estos peculiares modelos surgieron a partir del año 1961, cuando se produjo la colaboración con el escultor Isamu Noguchi en...

  19. Chôra

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    , for whom "il y a khôra" (there is chôra), Sallis keeps the definite article (the chôra) as an index of certain differentiation in chôra. This article takes as a point of departure Sallis' thesis regarding the manifestation of the chôra, grounded in the manner in which the chôra is apprehended, that is...

  20. Differences in the symptomatic phase preceding ACPA-positive and ACPA-negative RA: a longitudinal study in arthralgia during progression to clinical arthritis.

    Science.gov (United States)

    Burgers, Leonie E; van Steenbergen, Hanna W; Ten Brinck, Robin M; Huizinga, Tom Wj; van der Helm-van Mil, Annette Hm

    2017-10-01

    Although anticitrullinated protein antibody (ACPA)-positive and ACPA-negative rheumatoid arthritis (RA) have different aetiopathology, the clinical presentation at the time of diagnosis is similar. This study evaluated whether there are phenotypic differences in the symptomatic pre-RA phase. Patients with arthralgia included in the Leiden clinically suspect arthralgia cohort who developed arthritis during follow-up were studied (n=67). Symptoms at symptom onset, symptoms and signs at presentation with arthralgia and time to arthritis development were compared between ACPA-positive and ACPA-negative patients. In ACPA-negative patients (n=37), the location of initial symptoms less often included the lower extremities (22% vs 50%, p=0.014). At presentation with arthralgia, ACPA-positive patients had a longer symptom duration (median 22 vs 14 weeks, p=0.005), less tender joints (mean 5 vs 9, p=0.007) and less difficulty making a fist (11% vs 43%, p=0.004). However, after presentation with arthralgia, ACPA-positive patients developed arthritis more quickly (median 6 vs 18 weeks, p=0.015). A partial least squares regression analysis showed clustering of ACPA-positive and ACPA-negative patients based on the above-mentioned clinical variables. This study is the first showing that ACPA-positive and ACPA-negative patients have clinical differences in the symptomatic phase preceding clinical arthritis. This contributes to the notion that ACPA-positive and ACPA-negative RA develop differently. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  1. KAHN METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  2. Fordism in the hospital: Albert Kahn and the design of Old Main, 1917-25.

    Science.gov (United States)

    Ahuja, Nitin K

    2012-07-01

    The 1917-25 planning and construction at the University of Michigan of a new University Hospital, later dubbed Old Main, offers a noteworthy case study of the formal convergence of hospital and factory in early twentieth-century America. Designed by Albert Kahn, the architect responsible for Ford Motor Company's archetypal automobile plants, and located in Ann Arbor, Michigan, less than forty miles from Detroit's burgeoning factory landscape, Old Main was well positioned to reflect the values of industry in both appearance and operation. The building's outer surface represents a striking departure from the historicism that characterized several other hospitals of this period, while plans for the building's novel diagnostic unit demonstrate unique operational parallels to the assembly line model of production. Ultimately, Old Main's industrial design similarities cast it as a precociously modernist hospital, relating streamlined form to function more explicitly than many of its contemporary institutions.

  3. La arquitectura como objeto técnico. La arquitectura industrial de Albert Kahn

    Directory of Open Access Journals (Sweden)

    Luis Guillermo Pancorbo Crespo

    2014-10-01

    Full Text Available La adopción del paradigma mecanicista por parte de la ciencia impulsó la revolución tecnológica e industrial, dando origen a la era de la máquina y a una nueva categoría de lo material; los objetos técnicos. El predominio generalizado del paradigma mecánico en arquitectura a partir del siglo XX, adoptando la técnica como rectora de la actividad arquitectónica, y utilizando premisas racionales y científicas en el proceso de proyecto, supuso el nacimiento de la arquitectura moderna. En esta génesis tuvo un papel destacado la obra industrial de Albert Kahn, que transporta a la arquitectura el tipo de proyecto utilizado por los ingenieros para la creación de los objetos técnicos. Esta investigación trata de pormenorizar y poner en valor esta influencia, que creemos de vital importancia y que en cambio ha tenido escasa fortuna crítica. La actual sustitución del paradigma mecánico en arquitectura, consagrado por el Movimiento Moderno, por un nuevo paradigma que podríamos denominar termodinámico, forzada por los nuevos modelos de sostenibilidad y ahorro energético, vuelve a poner en primera línea ciertas obras industriales de Albert Kahn, en las que la gestión de las condiciones ambientales juega un papel prioritario en la génesis del proyecto.

  4. RA-ILD 与临床和实验室指标相关性研究%Clinical and laboratory correlation study of rheumatoid arthritis combined with interstitial lung disease

    Institute of Scientific and Technical Information of China (English)

    张路路; 武丽君

    2016-01-01

    目的:收集类风湿关节炎合并肺间质病变(RA-ILD)患者的相关临床指标、实验室指标和肺部影像学表现等临床资料,分析这些因素与 RA-ILD 的发生和发展的关系,为 RA-ILD 的诊疗提供一定的临床依据。方法回顾性收集2014年1月-2015年1月在新疆维吾尔自治区人民医院风湿免疫科住院的 RA 患者,一般资料、临床表现、实验室指标和影像学检查。结果①204例 RA 患者中44例发生 ILD,占21.6%。6例胸闷、气短;6例有咳嗽、咳痰;6例听诊有 Velcro 音。比较发现 RA-ILD 组咳嗽咳痰、胸闷气短、Velcro 音的发生率高于单纯 RA 组(P 0.05)。④ RA-ILD 组抗 CCP 抗体滴度显著大于单纯 RA组(P 0.05)。结论 RA-ILD 患者年龄大、平均病程长,大部分临床表现不明显,需及时完善 HRCT,早期诊断和治疗。高抗 CCP 抗体滴度、ANA 阳性可能与 RA-ILD 的发生相关。%Objective To analyze the relationship between these factors and occurrence and development of RA-ILD by collecting the relevant clinical and laboratory data of rheumatoid arthritis with interstitial lung disease (RA-ILD)patients. Methods The clinical data of hospitalized patients with RA from January 2014 to January 2015 were retrospectively analyzed,including its population information,clinical manifestation,laboratory and imaging ex-amination. Results (1)44 cases occurred with RA-ILD in 204 patients,accounting for 21. 6% . There were 6 ca-ses of chest tightness and shortness of breath,6 cases of cough and sputum,and 6 cases with Velcro rales. Compared the RA-ILD group,the incidence of Velcro sound was higher than patients without ILD(P 0. 05).(4)The level of anti-CCP was significantly higher in the RA-ILD group than in the RA group(P 0. 05). Conclusion RA patients with ILD are more common with elderly age and longer average duration,but most of the clinical symptoms is not obvious. HRCT can provide a useful tool for

  5. Cardiovascular risk factor management in patients with RA compared to matched non-RA patients

    NARCIS (Netherlands)

    E. Alemao (Evo); H. Cawston (Helene); F. Bourhis (Francois); M.J. Al (Maiwenn); M.P.M.H. Rutten-van Mölken (Maureen); K. Liao (Katherine); D.H. Solomon (Daniel)

    2015-01-01

    markdownabstractObjective. RA is associated with a 50-60% increase in risk of cardiovascular (CV) death. This study aimed to compare management of CV risk factors in RA and matched non-RA patients. Methods. A retrospective cohort study was conducted using UK clinical practice data. Patients presen

  6. Treatment of rheumatoid arthritis (RA) in India-how and by whom: results from a speciality clinic-use of low-dose methotrexate (MTX) was inexplicably suboptimal.

    Science.gov (United States)

    Malaviya, Anand N; Gogia, S B

    2016-09-01

    This study was conducted in order to study (a) seropositive RA patients for their prior caregivers, diagnosis makers, drugs and doses taken and (b) the disease status at the first visit and the last visit, from the standpoint of whether they received optimum or suboptimum DMARD treatment. Prospectively entered data were extracted from a rheumatology-specific electronic health record for demography, diagnostic delay, prior caregivers, diagnosis makers, intake of DMARDs and glucocorticoids and disease activity state at first presentation and at the last visit using structured query language. Among 316 patients, prior caregivers were orthopaedicians (73.4 %), alternative systems of medicine practitioners (62 %), internists (38 %), rheumatologists (35.8 %), general practitioners (17 %) and others (12 %). The diagnosis of RA was made by rheumatologists (55.6 %), orthopaedicians (21 %), internists (12.6 %), physiotherapists (3.5 %), homeopaths (2.8 %), general practitioner (2.1 %), neurologists (1.4 %) and Ayurvedic physicians (0.7 %). The mean and the median diagnostic delay among 142 patients where information was available were 18 and 8.5 months, respectively (SD +23.2). Thirty-two percent of the patients had early disease, 48 % established disease and 20 % late disease at presentation. Sixty-six percent of the patients had taken DMARDs-methotrexate (56 %), hydroxychloroquine (46.2 %), leflunomide (18.7 %) and sulfasalazine (20.6 %)-and often in combinations. Different preparations, doses and schedules of glucocorticoids were taken orally or parentally by 51 %. Only one (0.3 %) patient had taken biological DMARDs prior to visiting this clinic. High or moderate disease activity was present in 84 % at the first clinic visit that fell to 14 % at the last clinic visit. The majority of patients with RA were treated by orthopaedicians and practitioners of alternative systems of medicine with only a third by rheumatologists. In 80 % of patients, the

  7. Kas tõesti võib Strauss-Kahn puhta nahaga pääseda? / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    IMF-i endine juht ja võimalik Prantsuse presidendikandidaat Dominique Strauss-Kahn, keda süüdistatakse vägistamiskatses, on nüüdseks koduarestist vabastatud. DNA-proov on selgelt kinnitanud seksuaalset läbikäimist Strauss-Kahni ja hotelli toateenija vahel, kuid ei kinnita veel, kas tegemist oli vabatahtliku või pealesurutuga

  8. REVIEW OF CLINICAL OBSERVATIONAL STUDIES CONDUCTED ON 1812 PATIENTS OF AMLAPITTA AT I.P.G.T. & R.A., JAMNAGAR

    Directory of Open Access Journals (Sweden)

    Ghosh Kuntal

    2011-05-01

    Full Text Available Ayurveda is as old as human civilization based on two ideologies i.e. maintaining health of the healthy persons and curing the disease of diseased one. According to Ayurvedic point of view mandagni (reduced digestive power is the mother of all diseases including Amlapitta. On Amlapitta more than 153 research works in PG/PhD level have been reported so far from various research institutions across India. Among these, 36 research works (PG-32/ PhD-4 were carried out at Institute for Post Graduate Training & Research in Ayurveda (I.P.G.T. & R.A.. Out of 36 research works 7 were from dept. of Kayachikitsa, 4 were from Dravyaguna department, 10 were from Basic Principles, 2 were from Rogavigyana Vikritivigyana & 13 were done from dept. of Rasashastra & Bhaisajyakalpana. Research works include 24 clinical studies and 12 experimental cum clinical studies. 21 single drug formulations ( Sunthi, Bhringaraj, Patola, Shatavari, Amalaki, Guduchi etc. & 20 compound drug formulations ( Sutashekhara rasa, Sunthi Khanda, Puga Khanda etc. were studied. Maximum drugs used in these research works possess kapha-pitta shamaka, grahi, kledahara, dipana, pachana & medhya properties with Madhura, Tikta & Kasaya predominant rasa, Shita virya (potency which very easily counteract the etiopathogenesis of Amlapitta.

  9. "Redefining RA": The RA Tool Kit

    Science.gov (United States)

    Wyatt, Neal

    2008-01-01

    No one likes being two steps behind, and the fastest way to fall off the pace is by not keeping up with major titles and hot authors. Fortunately, there are numerous resources, both prepublication and postpublication, that can help. It is best when readers' advisory (RA) librarians know what is coming out months ahead of time--in order to think…

  10. Chôra

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    , as in a dream. Sallis' interpretation opens up the possibility for a new reading of the dialogue, and offers a tool to examine phenomena occurred in the aftermath of the Platonic cosmogony. One of the most fascinating episodes of the afterlife of the Platonic chôra is the Byzantine chôra, presented...

  11. Cardiovascular risk factor management in patients with RA compared to matched non-RA patients

    Science.gov (United States)

    Cawston, Helene; Bourhis, Francois; Al, Maiwenn; Rutten-van Mölken, Maureen P. M. H.; Liao, Katherine P.; Solomon, Daniel H.

    2016-01-01

    Objective. RA is associated with a 50–60% increase in risk of cardiovascular (CV) death. This study aimed to compare management of CV risk factors in RA and matched non-RA patients. Methods. A retrospective cohort study was conducted using UK clinical practice data. Patients presenting with an incident RA diagnosis were matched 1:4 to non-RA patients based on a propensity score for RA, entry year, CV risk category and treatment received at index date (date of RA diagnosis). Patients tested and treated for CV risk factors as well as those attaining CV risk factor management goals were evaluated in both groups. Results. Between 1987 and 2010, 24 859 RA patients were identified and matched to 87 304 non-RA patients. At index date, groups had similar baseline characteristics. Annual blood pressure, lipids and diabetes-related testing were similar in both groups, although CRP and ESR were higher in RA patients at diagnosis and decreased over time. RA patients prescribed antihypertensives increased from 38.2% at diagnosis to 45.7% at 5 years, from 14.0 to 20.6% for lipid-lowering treatments and from 5.1 to 6.4% for antidiabetics. Similar treatment percentages were observed in non-RA patients, although slightly lower for antihypertensives. Modest (2%) but significantly lower attainment of lipid and diabetes goals at 1 year was observed in RA patients. Conclusion. There were no differences between groups in the frequency of testing and treatment of CV risk factors. Higher CV risk in RA patients seems unlikely to be driven by differences in traditional CV risk factor management. PMID:26705329

  12. Toward a clinical application of ex situ boron neutron capture therapy for lung tumors at the RA-3 reactor in Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Farías, R. O.; Trivillin, V. A.; Portu, A. M.; Schwint, A. E.; González, S. J., E-mail: srgonzal@cnea.gov.ar [Comisión Nacional de Energía Atómica (CNEA), San Martín 1650, Argentina and Consejo Nacional de Investigaciones Científicas y Técnicas (CONICET), Buenos Aires 1033 (Argentina); Garabalino, M. A.; Monti Hughes, A.; Pozzi, E. C. C.; Thorp, S. I.; Curotto, P.; Miller, M. E.; Santa Cruz, G. A.; Saint Martin, G. [Comisión Nacional de Energía Atómica (CNEA), San Martín 1650 (Argentina); Ferraris, S.; Santa María, J.; Rovati, O.; Lange, F. [CIDME, Universidad Maimónides, Buenos Aires 1405 (Argentina); Bortolussi, S. [Istituto Nazionale di Fisica Nucleare, Sezione di Pavia 27100 (Italy); Altieri, S. [Istituto Nazionale di Fisica Nucleare, Sezione di Pavia 27100, Italy and Dipartimento di Fisica, Università di Pavia, Pavia 27100 (Italy)

    2015-07-15

    Purpose: Many types of lung tumors have a very poor prognosis due to their spread in the whole organ volume. The fact that boron neutron capture therapy (BNCT) would allow for selective targeting of all the nodules regardless of their position, prompted a preclinical feasibility study of ex situ BNCT at the thermal neutron facility of RA-3 reactor in the province of Buenos Aires, Argentina. (L)-4p-dihydroxy-borylphenylalanine fructose complex (BPA-F) biodistribution studies in an adult sheep model and computational dosimetry for a human explanted lung were performed to evaluate the feasibility and the therapeutic potential of ex situ BNCT. Methods: Two kinds of boron biodistribution studies were carried out in the healthy sheep: a set of pharmacokinetic studies without lung excision, and a set that consisted of evaluation of boron concentration in the explanted and perfused lung. In order to assess the feasibility of the clinical application of ex situ BNCT at RA-3, a case of multiple lung metastases was analyzed. A detailed computational representation of the geometry of the lung was built based on a real collapsed human lung. Dosimetric calculations and dose limiting considerations were based on the experimental results from the adult sheep, and on the most suitable information published in the literature. In addition, a workable treatment plan was considered to assess the clinical application in a realistic scenario. Results: Concentration-time profiles for the normal sheep showed that the boron kinetics in blood, lung, and skin would adequately represent the boron behavior and absolute uptake expected in human tissues. Results strongly suggest that the distribution of the boron compound is spatially homogeneous in the lung. A constant lung-to-blood ratio of 1.3 ± 0.1 was observed from 80 min after the end of BPA-F infusion. The fact that this ratio remains constant during time would allow the blood boron concentration to be used as a surrogate and indirect

  13. Toward a clinical application of ex situ boron neutron capture therapy for lung tumors at the RA-3 reactor in Argentina.

    Science.gov (United States)

    Farías, R O; Garabalino, M A; Ferraris, S; Santa María, J; Rovati, O; Lange, F; Trivillin, V A; Monti Hughes, A; Pozzi, E C C; Thorp, S I; Curotto, P; Miller, M E; Santa Cruz, G A; Bortolussi, S; Altieri, S; Portu, A M; Saint Martin, G; Schwint, A E; González, S J

    2015-07-01

    Many types of lung tumors have a very poor prognosis due to their spread in the whole organ volume. The fact that boron neutron capture therapy (BNCT) would allow for selective targeting of all the nodules regardless of their position, prompted a preclinical feasibility study of ex situ BNCT at the thermal neutron facility of RA-3 reactor in the province of Buenos Aires, Argentina. (l)-4p-dihydroxy-borylphenylalanine fructose complex (BPA-F) biodistribution studies in an adult sheep model and computational dosimetry for a human explanted lung were performed to evaluate the feasibility and the therapeutic potential of ex situ BNCT. Two kinds of boron biodistribution studies were carried out in the healthy sheep: a set of pharmacokinetic studies without lung excision, and a set that consisted of evaluation of boron concentration in the explanted and perfused lung. In order to assess the feasibility of the clinical application of ex situ BNCT at RA-3, a case of multiple lung metastases was analyzed. A detailed computational representation of the geometry of the lung was built based on a real collapsed human lung. Dosimetric calculations and dose limiting considerations were based on the experimental results from the adult sheep, and on the most suitable information published in the literature. In addition, a workable treatment plan was considered to assess the clinical application in a realistic scenario. Concentration-time profiles for the normal sheep showed that the boron kinetics in blood, lung, and skin would adequately represent the boron behavior and absolute uptake expected in human tissues. Results strongly suggest that the distribution of the boron compound is spatially homogeneous in the lung. A constant lung-to-blood ratio of 1.3 ± 0.1 was observed from 80 min after the end of BPA-F infusion. The fact that this ratio remains constant during time would allow the blood boron concentration to be used as a surrogate and indirect quantification of the

  14. Poetics of assembly Albert Kahn and D.W. Griffith in the birth of the Machine Age

    Directory of Open Access Journals (Sweden)

    Luis Pancorbo Crespo

    2016-05-01

    Full Text Available Abstract This research seeks to establish a double parallel between cinema and modern architecture, focusing on a moment of refounding of both  disciplines, the early twentieth century. We will be based on two seminal characters: DW Griffith and Albert Kahn. We will explore a temporal and geographical parallelism in their main evolutionary lines, which run through a similar way in the beginning, from the U.S to the U.S.S.R, to return again to the place of origin. This trip was triggered by the arrival to the USSR of  the first copies of the film "Intolerance" in 1918 and the arrival of Albert  Kahn in 1928 for the realization of numerous industrial projects during the First Five-Year Plan. Furthermore, we will explore a more conceptual  parallelism, studying the use of the notion of assembly in both disciplines  during that period, using again the work of our two main characters as the basis for research, but also leaning on other essential actors for that issue, like are Eisenstein and Miliutin.

  15. Safety and effectiveness of adalimumab in a clinical setting that reflects Canadian standard of care for the treatment of rheumatoid arthritis (RA: Results from the CanACT study

    Directory of Open Access Journals (Sweden)

    Haraoui Boulos

    2011-11-01

    Full Text Available Abstract Background This multicenter, open-label, prospective, single cohort study evaluated the effectiveness and safety of adalimumab in a clinical setting reflecting the Canadian standard of care for the treatment of patients with rheumatoid arthritis (RA. Methods Patients ≥ 18 years of age with a history of active RA ≥ 3 months and fulfilling Canadian requirements for biological therapy received adalimumab 40 mg subcutaneously every other week for 12 weeks. Pre-study DMARD treatment regimens, corticosteroids, or NSAIDs were allowed throughout the study. The primary effectiveness outcome measure was the mean change in 28-joint disease activity score (DAS28 from baseline to Week 12. Secondary measures included the proportion of patients achieving joint remission (DAS28 Results A total of 879 patients (mean disease duration > 12 years were enrolled; 772 (87.9% completed the 12-week period. Adalimumab treatment was associated with rapid and sustained improvements in the signs and symptoms of RA. Significant improvements in mean DAS28 score were observed as early as Week 4. After 12 weeks of adalimumab treatment, 15.3% and 28.9% of patients achieved clinical remission and low-disease activity, respectively. Similarly, significant improvements in ACR core components were observed as early as Week 4, with continued improvements occurring through 12 weeks. Patients naïve to BDMARD therapy demonstrated numerically greater clinical responses when compared with patients who had experienced prior BDMARD therapy, although both subgroups were associated with significant improvements from baseline. The rates and types of adverse events, as well as the results of laboratory measures, demonstrated that adalimumab was generally safe and well-tolerated. Conclusions This study demonstrated that, under conditions reflective of the normal clinical practice in Canada, adalimumab is an effective and safe treatment for patients with RA. Trial registration NCT

  16. The presence of anti-citrullinated protein antibodies (ACPA) and rheumatoid factor on patients with rheumatoid arthritis (RA) does not interfere with the chance of clinical remission in a follow-up of 3 years.

    Science.gov (United States)

    da Mota, Licia Maria Henrique; Dos Santos Neto, Leopoldo Luiz; de Carvalho, Jozélio Freire; Pereira, Ivânio Alves; Burlingame, Rufus; Ménard, Henri A; Laurindo, Ieda Maria Magalhães

    2012-12-01

    Autoantibodies in early rheumatoid arthritis (RA) have important diagnostic value. The association between the presence of autoantibodies against cyclic citrullinated peptide and the response to treatment is controversial. To prospectively evaluate a cohort of patients with early rheumatoid arthritis (peptide antibodies (anti-CCP) and citrullinated anti-vimentin (anti-Sa) with the occurrence of clinical remission, forty patients diagnosed with early RA at the time of diagnosis were evaluated and followed for 3 years, in use of standardized therapeutic treatment. Demographic and clinical data were recorded, disease activity score 28 (DAS 28), as well as serology tests (ELISA) for RF (IgM, IgG, and IgA), anti-CCP (CCP2, CCP3, and CCP3.1) and anti-Sa in the initial evaluation and at 3, 6, 12, 18, 24, and 36 months of follow-up. The outcome evaluated was the percentage of patients with clinical remission, which was defined by DAS 28 lower than 2.6. Comparisons were made through the Student t test, mixed-effects regression analysis, and analysis of variance (significance level of 5%). The mean age was 45 years, and a female predominance was observed (90%). At the time of diagnosis, RF was observed in 50% of cases (RF IgA-42%, RF IgG-30%, and RF IgM-50%), anti-CCP in 50% (no difference between CCP2, CCP3, and CCP3.1) and anti-Sa in 10%. After 3 years, no change in the RF prevalence and anti-CCP was observed, but the anti-Sa increased to 17.5% (P = 0.001). The percentage of patients in remission, low, moderate, and intense disease activity, according to the DAS 28, was of 0, 0, 7.5, and 92.5% (initial evaluation) and 22.5, 7.5, 32.5, and 37.5% (after 3 years). There were no associations of the presence of autoantibodies in baseline evaluation and in serial analysis with the percentage of clinical remission during follow-up of 3 years The presence of autoantibodies in early RA has no predictive value for clinical remission in early RA.

  17. Ra-228, Ra-226 and Ra-228/Ra-226 Activity Ratio in the Northern South China Sea

    Science.gov (United States)

    Yu-Chia, C.

    2004-05-01

    We report for the first time the surface water distributions of Ra-228 and Ra-226 in the northern South China Sea (SCS) and vertical profiles in the central deep basin of the SCS. Being a marginal sea, the SCS displays activities of both nuclides much higher than the open oceans. The surface water Ra-228 varies between 22 and 33 dpm/100L with higher values at stations adjacent to the landmass. The surface water Ra-226 varies from 10 to 15 dpm/100L with a distribution pattern similar to that of Ra-228. The Ra-228/Ra-226 activity ratio is fairly constant at about 2 or slightly higher. Ra-228 decreases rapidly from a surface maximum of about 22 dpm/100L to about 12 dpm/100L at and below 300m depth in the deep central basin. The deep water values are much higher than those of the open oceans. Ra-226, on the other hand, shows a surface activity of 14 dpm/100L, decreases to 10 dpm/100L at 200m, and then increases monotonically with depth to about 35 dpm/100L at and below 3000m. This distribution pattern is similar to that observed in the western North Pacific but the activity is higher by about 5 dpm/100L for the entire water column. The resulting Ra-228/Ra-226 is greater than one above 250m and becomes less than one below this depth with the ratio decreasing to about 0.35 in the deep water below 3000m. This ratio remains much greater than that in the open oceans, implying a strong Ra-228 input relative to Ra-226 into the SCS deep water.

  18. THE IMMUNOLOGICAL CHARACTERISTIC OF RA PATIENTS WITH ANAEMIA

    Directory of Open Access Journals (Sweden)

    A. E. Sizikov

    2014-07-01

    Full Text Available Abstract. The aim of the investigation was to study the immunological characteristics of RA patients with anaemia. Clinical and laboratory data including the percentage of the main lymphocyte subclasses, phagocyte and DTH-effector activity, serum concentration of immunoglobulins, the percentage of cells producing IFNγ and/or IL-4 and percent of monocytes producing TNF. We revealed some significant clinical, laboratory and immunological differences between RA patients and healthy donors and between patients with and without anaemia. Our data demonstrate RA anemic patients to have more severe disorders than patients without anaemia. We also revealed some significant immunological differences between RA patients and healthy donors and between patients with and without anaemia, including percent of cells producing IFNγ and/or IL-4. Our data permit to conclude that RA patients have many different immunological disturbances, more severe in anaemic patients.

  19. Clinical evaluation of proinflammatory cytokine inhibitors (sTNFR I, sTNFR II, IL-1 ra), anti-inflammatory cytokines (IL-10, IL-13) and activation of neutrophils after burn-induced inflammation.

    Science.gov (United States)

    Sikora, J P; Chlebna-Sokół, D; Andrzejewska, E; Chrul, S; Polakowska, E; Wysocka, A; Sikora, A

    2008-08-01

    The study was aimed at evaluating the involvement of sTNFR I, sTNFR II, IL-1 ra, IL-10, IL-13 and reactive oxygen species (ROS) in systemic inflammatory response syndrome (SIRS) development in severely burned children and at assessing the prognostic value of the immunological markers studied. The study comprised 37 patients (17 burned children and 20 controls). Serum levels of the markers determined by means of ELISA and respiratory burst of neutrophils as well as p55 and p75 tumour necrosis factor-alpha (TNF-alpha) receptor expression using flow cytometry were evaluated twice. The burned children presented significantly higher levels of IL-10 and cytokine inhibitors within the first 6-24 h after injury compared with controls (P burn therapy, whereas ROS generation evidently augmented (P burned children; their monitoring allows for an assessment of the systemic inflammatory reaction activity. The neutrophil BURSTTEST and IL-1 ra might have been clinically helpful markers of SIRS prognosis.

  20. IL-1Ra: its role in rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    M. Cutolo

    2011-09-01

    Full Text Available Interleukin-1 (IL-1 is one of the pivotal cytokines in initiating and driving the processes of rheumatoid arthritis (RA, and the body’s natural response, IL-1 receptor antagonist (IL-1Ra, has been shown conclusively to block its effects. IL-1 mediate several clinical symptoms of the inflammatory reaction (i.e. fever, pain, sleep disturbances. IL-1 is considered a key mediator in RA joint damage because of its greater capacity (greater than TNF of increasing matrix degradation by inducing the production of MMPs and PGE2 in synovial cells, as well by its role as mediator of bone and cartilage destruction. In addition, IL-1 decreases the repair process by suppressing matrix synthesis and shows a strong synergism with TNF in inducing many inflammatory genes at both local and systemic level. The induced endogenous production of IL-1Ra, in presence of the RA synovitis, is too low to contrast the high affinity of IL-1 for the cell receptors. Therefore, IL-1Ra presence should result in very effective prevention of IL-1 signal transduction particularly in the inflammatory site. In laboratory and animal studies inhibition of IL-1 by either antibodies to IL-1 or IL-1Ra proved beneficial to the outcome. IL-1Ra is a member of the IL-1 superfamily. The effects of different DMARDs on IL-1Ra levels in RA patients support the important role that selected anticytokine treatments might exert in the pathophysiology of the disease. However, since anti TNFα therapy it is not effective in all RA patients, nor does it fully control the arthritic process in affected joints of good responders and complete TNF suppression should be avoided, the combined treatment with intermediate doses of TNF and IL-1 blockers, reaching synergistic suppression of arthritis, seems warranted in RA.

  1. Understanding Rheumatoid Arthritis (RA): Research

    Science.gov (United States)

    ... page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Research Past Issues / Summer 2014 Table of ... project plan to address relevant challenges for rheumatoid arthritis. Read Part 1 on Lupus in MedlinePlus magazine, ...

  2. Poéticas del montaje Albert Kahn y D.W.Griffith en el nacimiento de la era de la máquina

    Directory of Open Access Journals (Sweden)

    Luis Pancorbo Crespo

    2016-05-01

    Full Text Available Resumen Esta investigación trata de establecer un doble paralelismo entre cine y arquitectura moderna, centrándose en un momento de refundación de ambas disciplinas, los primeros años del siglo XX y apoyándonos en dos personajes seminales: D.W. Griffith y Albert Kahn. Exploraremos primero un paralelismo temporal y geográfico en sus líneas evolutivas principales, que recorren un camino similar en sus inicios, desde los Estados Unidos hasta la URSS, para volver al lugar de origen. Este viaje fue activado gracias a la llegada a la URSS de las primeras copias de la película” Intolerancia” en 1918 y de Albert Kahn en 1928 para la realización de numerosas obras industriales durante el Primer Plan Quinquenal. Por otro lado, exploraremos un paralelismo de carácter más conceptual, estudiando el uso de la noción de montaje en ambas disciplinas durante ese periodo, utilizando otra vez la obra de nuestros dos protagonistas como base de la investigación, pero recurriendo también a otros esenciales para el tema como son los soviéticos Eisenstein y Miliutin.

  3. kahn Terminal Aerodrome Forecast

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TAF (terminal aerodrome forecast or terminal area forecast) is a format for reporting weather forecast information, particularly as it relates to aviation. TAFs are...

  4. The Serum Levels and Clinical Significance of HGF and KL-6 in Patients of Interstitial Lung Disease with Reumatoid Arthritis%HGF 与 KL-6在 RA-ILD 患者血清中的表达水平及意义

    Institute of Scientific and Technical Information of China (English)

    王树刚; 王晓东; 慈春增; 于杰; 李向东

    2015-01-01

    目的:通过检测肝细胞生长因子( HGF)和人Ⅱ型肺泡细胞表面抗原( KL-6)在类风湿关节炎合并肺间质病变( RA-ILD)患者血清中的表达水平,探讨其在RA-ILD中的意义。方法采用ELISA法检测60例RA(包括28例RA-ILD)和20例健康体检者血清HGF,KL-6的表达水平。结果 RA-ILD组中HGF的含量明显低于单纯RA组及对照组,差异有统计学意义(P<0.05);RA-ILD组中KL-6的含量明显高于单纯RA组及对照组,差异有统计学意义(P<0.05);且HGF与KL-6呈负相关关系;在RA-ILD组,HGF与疾病活动性指标DAS28评分呈负相关关系,KL-6与疾病活动性指标DAS28评分呈正相关关系。结论 HGF和KL-6可能参与RA-ILD的发生发展过程,HGF和KL-6可作为判断RA-ILD活动的指标。%Objective To analyze the hepatocyte growth factor( HGF) and human typeⅡalveolar cell sur-face antigen( KL-6 ) serum levels and their clinical significance in the patients of interstitial lung disease with rheumatoid arthritis( RA-ILD) .Methods The serum levels of HGF and KL-6 were detected in 60 patients with rheumatoid arthritis ( including 28 patients with interstitial lung disease) and 20 healthy individuals by means of enzyme linked immunosor-bent assay( ELISA) .Results In patients of RA-ILD,the serum levels of HGF was lower than simple RA group and the control group,and the serum levels of KL-6 was higher than simple RA group and the control group,there were signifi-cantly statistical difference(P<0.05).The levels of HGF and KL-6 were negatively related;In group RA-ILD,HGF was negatively correlated with disease activity index DAS28 score,KL-6 was positively correlated with disease activity index DAS28 score.Conclusion The cytokines of HGF and KL-6 may play important roles in the development of RA-ILD;perhaps they can be seen as indexes of RA-ILD activities.

  5. Aspectos clínicos do entrópio de desenvolvimento em cães da raça Shar Pei Clinical aspects of developmental entropion in Shar Pei dogs

    Directory of Open Access Journals (Sweden)

    F.A.B. Viana

    2006-04-01

    Full Text Available Avaliaram-se os aspectos clínicos do entrópio de desenvolvimento em filhotes de cães da raça Shar Pei. Utilizaram-se 50 animais com idades entre 18 e 128 dias, que apresentavam graus variáveis de inversão palpebral e lesões oculares, as quais foram classificadas de acordo com um modelo específico proposto. As lesões encontradas foram fotofobia, epífora, inversão da margem palpebral, blefarospasmo, conjuntivite, quemose, edema, erosão e vascularização da córnea e phthisis bulbi.The clinical aspects of entropion in puppies of the Shar Pei breed were studied using 50 animals, 18 to 128 day-old, that presented variable degrees of palpebral inversion and ocular lesions. The ocular lesions were classified according to a specific model. Photophobia, epiphora, palpebral margins inversion, blepharospasm, conjuntivitis, quemosis, corneal edema, erosion and vascularization and phthisis bulbi were observed.

  6. Mathematics as Filter of Equity -- An "Old" Story and a New Telling. Response to Michael Kahn: A Class Act--Mathematics as Filter of Equity in South Africa's Schools

    Science.gov (United States)

    Adler, Jill; Setati, Mamokgethi

    2005-01-01

    In his article, A class act -- Mathematics as filter of equity in South African schools, Michael Kahn analyses South African data from matriculation examinations and draws on and re-examines previous analyses he himself has done. This document highlights the important insights into participation and performance in mathematics in South Africa that…

  7. VeVeRa-IV

    NARCIS (Netherlands)

    Evelien Eggink; Debbie Oudijk; Klarita Sadiraj

    2012-01-01

    Original title: VeVeRa-IV The Dutch population is set to age rapidly in the coming years. More and more people will also attain a very great age. This means that the need for home care and care provided in nursing or residential care homes will also increase. As part of the Long-term Care Programme

  8. Clinical grade expansion of CD45RA, CD45RO, and CD62L-positive T-cell lines from HLA-compatible donors: high cytotoxic potential against AML and ALL cells.

    Science.gov (United States)

    Barbui, Anna M; Borleri, Gianmaria; Conti, Elena; Ciocca, Alice; Salvi, Anna; Micò, Caterina; Introna, Martino; Rambaldi, Alessandro

    2006-04-01

    Identification of a clinical grade method for the ex vivo generation of donor-derived T cells cytotoxic against both myeloid and lymphoblastic cells still remains elusive. We investigated rapid generation and expansion of donor derived-allogeneic T-cell lines cytotoxic against patient leukemic cells. Acute myelogenous leukemia (AML) and acute lymphoblastic leukemia (ALL) blasts were cultured 5 days in Stem Span, granulocyte macrophage colony-stimulating factor, interleukin-4, and calcium ionophore. All B-precursor ALL (N22) and AML (N13), but not T-cell ALL (N3), differentiated into mature leukemia-derived antigen-presenting cells (LD-APC). All but one LD-APC generated cytotoxic T lymphocyte (CTL) from adult human leukocyte antigen (HLA)-identical (N8) or unrelated donors (N2). Upon in vitro culture, donor-derived CTL acquired a memory T phenotype, showing concomitant high CD45RA, CD45RO, CD62L expression. CD8(+) cells, but not CD4(+) cells, were granzyme, perforine, and interferon-gamma-positive. Pooled CD4(+) and CD8(+) cells were cytotoxic against leukemic blasts (32%, 30:1 E:T ratio), but not against autologous or patient-derived phytohemagglutinin blasts. LD-APC from five ALL patients were used to generate CTL from cord blood. A mixed population of CD4(+) and CD8(+) cells was documented in 54% of wells. T cells acquired classical effector memory phenotype and showed a higher cytotoxicity against leukemia blasts (47%, 1:1 E:T ratio). Adult and cord blood CTL showed a skewing from a complete T-cell receptor repertoire to an oligo-clonal/clonal pattern. Availability of these cells should allow clinical trials for salvage treatment of leukemia patients relapsing after allogeneic stem cell transplantation.

  9. Compilation of Spectroscopic Data of Radium (Ra I and Ra II)

    NARCIS (Netherlands)

    Dammalapati, U.; Jungmann, K.; Willmann, L.

    2016-01-01

    Energy levels, wavelengths, lifetimes, and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II, have been compiled. Wavelengths and wavenumbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of

  10. Compilation of spectroscopic data of Radium (Ra I and Ra II)

    CERN Document Server

    Dammalapati, U; Willmann, L

    2016-01-01

    Energy levels, wavelengths, lifetimes and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II have been compiled. Wavelengths and wave numbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of even and odd-A isotopes of neutral radium atom and singly ionized radium are included. Experimental lifetimes of the states for both neutral and ionic Ra are also added, where available. The information is beneficial for present and future experiments aimed at different physics motivations using neutral Ra and singly ionized Ra.

  11. VELoCiRaPTORS.

    Science.gov (United States)

    Lundgren, J.; Esham, B.; Padalino, S. J.; Sangster, T. C.; Glebov, V.

    2007-11-01

    The Venting and Exhausting of Low Level Air Contaminants in the Rapid Pneumatic Transport of Radioactive Samples (VELoCiRaPTORS) system is constructed to transport radioactive materials quickly and safely at the NIF. A radioactive sample will be placed inside a carrier that is transported via an airflow system produced by controlled differential pressure. Midway through the transportation process, the carrier will be stopped and vented by a powered exhaust blower which will remove radioactive gases within the transport carrier. A Geiger counter will monitor the activity of the exhaust gas to ensure that it is below acceptable levels. If the radiation level is sufficient, the carrier will pass through the remainder of the system, pneumatically braking at the counting station. The complete design will run manually or automatically with control software. Tests were performed using an inactive carrier to determine possible transportation problems. The system underwent many consecutive trials without failure. VELoCiRaPTORS is a prototype of a system that could be installed at both the Laboratory for Laser Energetics at the University of Rochester and the National Ignition Facility at LLNL.

  12. [Update on Current Care Guidelines. Rheumatoid Arthritis (RA)].

    Science.gov (United States)

    2015-01-01

    Patients with signs and symptoms of early rheumatoid arthritis (RA) should be referred to a multidisciplinary rheumatology clinic. The ACR-EULAR criteria help in identification of patients with risk for erosive RA. Treatment should aim at early remission. Start with the combination of methotrexate, hydroxychloroquine, sulfasalazine, and low-dose glucocorticoid is recommended if contraindications exist. Methotrexate has better bioavailability as injection. Glucocorticoids are injected into active joints. Patient education with shared decision is essential. Exercise training is recommended. If treatment target is not achieved by the DMARD combination, a biological drug is added.

  13. Clinical aspects and dynamics of auricular parasitosis in Gir cattle Aspectos clínicos e dinâmica de parasitoses auriculares em bovinos da raça Gir

    Directory of Open Access Journals (Sweden)

    Patrícia V.B. Leite

    2013-03-01

    Full Text Available We evaluated the dynamics of ear infestations caused by Rhabditis spp. and Raillietia spp., which were correlated with animal age, intensity of clinical signs and climate factors. Sixty-four Gir cattle were distributed into three groups: GA - 23 calves with 4 to 6 months of age; GB - 18 calves with 7 to 12 months of age; and GC - 23 heifers with 13 to 33 months of age. Five samplings, defined as S1, S2, S3, S4 and S5 were performed every three months from August 2008 to August 2009. The ear secretion was collected using the auricular washing method for the right ear and a swab for the left ear. A clinical assessment of the animals was performed, and they were classified according to the presence and severity of otitis. The highest relative frequency of rhabditosis was 52.2% in GC at the last sampling. In the first sampling, 42.2% of the animals were infested by Raillietia spp. The older cattle were more susceptible to infestations by both parasites. No correlation of Rhabditis spp. and Raillietia spp. parasitism with climate factors was found. The results showed that both parasites could infest Gir cattle, and in most cases, there was no co-infestation. Only older animals parasitized by the nematode showed clinical signs of the disease.Avaliou-se a dinâmica da infestação auricular causada por Rhabditis spp. e por Raillietia spp., relacionando-a com a idade dos animais, com a intensidade dos sinais clínicos e com os fatores climáticos. Utilizaram-se 64 bovinos Gir, distribuídos em três grupos: GA - 23 bezerros de quatro a seis meses de idade, GB - 18 bezerros de sete a 12 meses e GC - 23 novilhas de 13 a 33 meses. Foram feitas cinco coletas a cada três meses. A secreção auricular foi coletada utilizando o método de lavagem auricular na orelha direita e um swab na orelha esquerda. Fez-se avaliação clínica dos animais classificando-os de acordo com a presença e gravidade da otite. A maior frequência relativa da rhabditiose

  14. LCA versus RA - an introduction

    DEFF Research Database (Denmark)

    Olsen, Stig Irving

    2000-01-01

    Risk Assessment (RA) of chemicals is an environmental management tool used to assess the risk of specific chemicals, which are harmful to man or the environment under certain circumstances of use or in certain environmental recipients. Life Cycle Assessment (LCA) or environmental assessment...... of products is another environmental management tool that gains more and more ground, and which is often thought of as universal due to its basic holistic philosophy. As the environmental impacts of one product can only be seen in relation to the impacts of other products providing the same functions, LCA...... is a comparative tool. The primary purpose of this article is to identify harmonies, discrepancies and relations between the two tools, exemplified by the risk assessment principles of the European Commission (EC) as stated in 'Technical Guidance Document' (EC, 1996) and the LCA method 'EDIP' (Environmental Design...

  15. "A different kind of beauty": scientific and architectural style in I.M. Pei's Mesa Laboratory and Louis Kahn's Salk Institute.

    Science.gov (United States)

    Leslie, Stuart W

    2008-01-01

    I.M. Pei's Mesa Laboratory for the National Center for Atmospheric Research in Boulder, Colorado, and Louis Kahn's Salk Institute in La Jolla, California, are rare examples of laboratories as celebrated for their architecture as for their scientific contributions. Completed in the mid-1960s, these signature buildings still express the scientific style of their founding directors, Walter Roberts and Jonas Salk. yet in commissioning their laboratories, Roberts and Salk had to work with architects as strong-willed as themselves. A close reading of the two laboratories reveals the ongoing negotiations and tensions in collaborations between visionary scientist and visionary architect. Moreover, Roberts and Salk also had to become architects of atmospheric and biomedical sciences. For laboratory architecture, however flexible in theory, necessarily stabilizes scientific practice, since a philosophy of research is embedded in the very structure of the building and persists far longer than the initial vision and mission that gave it life. Roberts and Salk's experiences suggest that even the most carefully designed laboratories must successfully adapt to new disciplinary configurations, funding opportunities, and research priorities, or risk becoming mere architectural icons.

  16. Računalom potpomognute tehnike revizije

    OpenAIRE

    2008-01-01

    Namjera ovoga rada je ukazati na mogućnosti učinkovitijeg revidiranja u okruženju sve intenzivnijega korištenja računalnih tehnika koje pomažu reviziji CAAT, jer sveukupni ciljevi i opseg revizije ne mijenjaju se kada se revizija obavlja u računalno-informatičkom okruženju. CAATs mogu poboljšati učinkovitost i produktivnost revizijskih procedura. Računalom potpomognute tehnike revizije (CAATs) jesu načini na koje, u kompjuteriziranom sustavu informacija, revizor može koristiti rač...

  17. The clinical significance of the combined detection on serum glucose -6 - phosphate Phosphate Isomerase (GPI) and Rheumatoid Factor (RF) in rheumatoid arthritis(RA)%血清葡萄糖-6-磷酸异构酶(GPI)和类风湿因子(RF)联合检测在类风湿关节炎(RA)中的临床意义

    Institute of Scientific and Technical Information of China (English)

    陆寒茵; 陆萍

    2012-01-01

    目的:探讨血清葡萄糖-6-磷酸异构酶(GPI)和类风湿因子(RF)联合检测在类风湿关节炎(RA)中的临床意义.方法:用酶联免疫吸附试验(ELISA)双抗体夹心法检测GPI抗原,用免疫散射比浊法检测类风湿因子(RF).结果:①RA患者血清中GPI浓度明显高于其他风湿病组和健康组(P<0.01)②GPI和RF两者联合检验,敏感性虽有所下降,但特异性却有了很大的提高.③GPI与RF之间存在显著相关性.结论:葡萄糖-6-磷酸异构酶(GPI)和类风湿因子(RF)联合检测,可明显提高对类风湿关节炎诊断的特异性,有助于类风湿关节炎的诊断治疗.

  18. To evaluate the clinical diagnosic value of anti-cyclic citrul inated peptide(anti-CCP) antibody and rheumatoid factor(RF) in patients with rheumatoid arthritis(RA)%联合检测抗CCP抗体与RF对类风湿关节炎诊断的临床意义

    Institute of Scientific and Technical Information of China (English)

    赵海燕

    2014-01-01

    目的:探讨联合检测抗环瓜氨酸肽抗体(抗CCP抗体)及类风湿因子(RF)对类风湿性关节炎(RA)的临床诊断价值。方法:分别检测130例RA患者,98例非RA的风湿病患者及40例正常人血清的抗CCP抗体和RF。结果:抗CCP抗体和RF联合检测的特异性,阳性预测值,阳性似然比,阴性似然比与任何单一项检测比较均有显著差异(P<0.05)。结论:联合检测抗CCP抗体和RF可明显提高类风湿性关节炎的诊断率。%Objective: To evaluate the clinical diagnosic value of anti-cyclic citrul inated peptide(anti-CCP) antibody and rheumatoid factor(RF) in patients with rheumatoid arthritis(RA). Methods: Anti-CCP antibody was defected by quantitative ELISA and rheumatoid factor by BNP nephelometer in 130 cases of RA, 98 cases of non-RA rheumatic diseases and 40 cases of healthy individuals. Results: The diagnosis specificity, positive predictive value, positive/negative likelihood ratios of combinate determination of anti-CCP antibody and RF were significantly higher than either one. Conclusion: The measurements of anti-CCP antibody and rheumatoid factor wil remarkably improve the accuracy of diagnosis of RA.

  19. Classifying Finitely Generated Indecomposable RA Loops

    CERN Document Server

    Cornelissen, Mariana

    2012-01-01

    In 1995, E. Jespers, G. Leal and C. Polcino Milies classified all finite ring alternative loops (RA loops for short) which are not direct products of proper subloops. In this paper we extend this result to finitely generated RA loops and provide an explicit description of all such loops.

  20. 226Ra and 228Ra in the Seawater of the Western Yellow Sea

    Institute of Scientific and Technical Information of China (English)

    MEN Wu; WEI Hao; LIU Guangshan

    2006-01-01

    Radium isotopes 226Ra and 228Ra in seawater of the western Yellow Sea were measured by using the Mn-fiber adsorption- HPGe γ spectrum method.The distribution features of the two isotopes have been studied.The activities of 226Ra and 228Ra are 2.72-5.57 Bq m-3 and 7.51-34.3 Bq m-3, respectively.The activities of 226Ra and 228Ra from surface to bottom for each depth profile station are comparable within the experimental error, but the mean activities decrease with distance from the shore.From the distribution data of 228Ra, the horizontal eddy diffusion coefficient was estimated at 29 × 106 cm2 s 1.

  1. IL-1RA gene-transfected bone marrow-derived mesenchymal stem cells in APA microcapsules could alleviate rheumatoid arthritis.

    Science.gov (United States)

    Hu, Jianhua; Li, Hongjian; Chi, Guanhao; Yang, Zhao; Zhao, Yi; Liu, Wei; Zhang, Chao

    2015-01-01

    In order to investigate the encapsulation of interleukin 1 receptor antagonist (IL-RA) gene-modified mesenchymal stem cells (MSCs) in alginate-poly-L-lysine (APA) microcapsules for the persistent delivery of interleukin 1 receptor antagonist (IL-RA) to treat Rheumatoid arthritis (RA). We transfect mesenchymal stem cells with IL-RA gene, and quantify the IL-RA proteins released from the encapsulated cells followed by microencapsulation of recombinant mesenchymal stem cells, and thus observe the permeability of APA microcapsules and evaluate clinical effects after induction and treatment of collagen-induced arthritis (CIA). The concentration of IL-RA in the supernatant was determined by IL-RA ELISA kit by run in technical triplicates using samples from three separate mice. Encapsulated IL-RA gene-transfected cells were capable of constitutive delivery of IL-RA proteins for at least 30 days. Moreover, the APA microcapsules could inhibit the permeation of fluorescein isothiocyanate-conjuncted immunoglobulin G. Also, it has been found that the APA microcapsules can significantly attenuate collagen induced arthritis after delivering of APA microcapsules to rats. Our results demonstrated that the nonautologous IL-RA gene-transfected stem cells are of potential utility for RA therapy.

  2. Understanding Rheumatoid Arthritis (RA): Treatment and Causes

    Science.gov (United States)

    ... this page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Treatment and Causes Past Issues / Summer 2014 Table of Contents How Is Rheumatoid Arthritis Treated? Doctors have many ways to treat this ...

  3. RA Construction KC, LLC Information Sheet

    Science.gov (United States)

    RA Construction KC, LLC (the Company) is located in Gladstone, Missouri. The settlement involves renovation activities conducted at a property constructed prior to 1978, located in Kansas City, Missouri.

  4. Radiation exposure of relatives of patients treated with Ra-223 dichloride; Strahlenexposition von Angehoerigen bei Therapie mit Ra-223-Dichlorid

    Energy Technology Data Exchange (ETDEWEB)

    Wanke, C.; Szermerski, B.; Solle, A.; Geworski, L. [Medizinische Hochschule Hannover (Germany). Stabsstelle Strahlenschutz und Abt. Medizinische Physik; Pinkert, J. [Bayer Vital GmbH, Leverkusen (Germany); Kranert, W.T. [Frankfurt Univ. (Germany). Klinik fuer Nuklearmedizin; Andreeff, M. [Universitaetsklinikum ' ' Carl Gustav Carus' ' TU Dresden (Germany). Klinik fuer Nuklearmedizin

    2015-07-01

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T{sub 1/2} = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  5. Removal of 226Ra and 228Ra from TENORM sludge waste using surfactants solutions.

    Science.gov (United States)

    Attallah, M F; Hamed, Mostafa M; El Afifi, E M; Aly, H F

    2015-01-01

    The feasibility of using surfactants as extracting agent for the removal of radium species from TENORM sludge produced from petroleum industry is evaluated. In this investigation cationic and nonionic surfactants were used as extracting agents for the removal of radium radionuclides from the sludge waste. Two surfactants namely cetyltrimethylammonium bromide (CTAB) and Triton X-100 (TX100) were investigated as the extracting agents. Different parameters affecting the removal of both (226)Ra and (228)Ra by the two surfactants as well as their admixture were studied by the batch technique. These parameters include effect of shaking time, surfactants concentration and temperature as well as the effect of surfactants admixture. It was found that, higher solution temperature improves the removal efficiency of radium species. Combined extraction of nonionic and cationic surfactants produces synergistic effect in removal both (226)Ra and (228)Ra, where the removals reached 84% and 80% for (226)Ra and (228)Ra, respectively, were obtained using surfactants admixture.

  6. Determination of {sup 226}Ra and {sup 228}Ra in water by using liquid scintillation spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Mingote, Raquel Maia; Gomes, Nilton Carlos [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Quimica e Radioquimica], E-mail: mingote@cdtn.br; Gomes, Lorena Pedrosa; Menezes, Maria Angela de B.C. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Reator e Irradiacoes

    2007-07-01

    A procedure for the determination of {sup 226}Ra and {sup 228}Ra in water samples by using liquid scintillation spectrometry was applied. The chemical separation of radium as Ba(Ra)SO{sub 4} was performed by the usual method of coprecipitation with barium carrier. The precipitated was mixed with water, Instagel{sup TM} and Ultima Gold AB{sup TM} scintillation cocktails after the delay time for {sup 226}Ra/{sup 222}Rn radioactive equilibrium. Activities of {sup 226}Ra and {sup 228}Ra were inferred from the alpha and beta counting respectively. It was used the pulse shape analyzer and correction factors for minimizing mutual radiometric interferences. The combined standard uncertainties were evaluated using the law of uncertainty propagation by partial derivatives method. The difficulties of method are discussed. (author)

  7. Laser trapping of Ra-225 and Ra-226 and progress towards an electric dipole moment measurement

    Science.gov (United States)

    Guest, J. R.; Scielzo, N. D.; Ahmad, I.; Bailey, K.; Greene, J. P.; Holt, R. J.; Lu, Z.-T.; O'Connor, T. P.; Potterveld, D. H.

    2006-10-01

    Permanent electric dipole moments (EDMs) in atoms or molecules are signatures of Time (T)-and Parity (P)-violation and represent an important window onto physics beyond the Standard Model. We are developing a next generation EDM search around laser-cooled and trapped Ra-225 (t1/2 = 15 d). Due to octupole deformation of the nucleus, Ra-225 is predicted to be two to three orders of magnitude more sensitive to T-violating interactions than Hg-199, which currently sets the most stringent limits in the nuclear sector. We will discuss our progress, including the successful laser cooling and trapping of Ra-225 and Ra-226 atoms. We have demonstrated transverse cooling, Zeeman slowing, and capture of Ra-225 and Ra-226 atoms in a magneto-optical trap (MOT). By driving a second atomic transition, we have extended the lifetime of the trap from milliseconds to seconds and performed necessary spectroscopic measurements.

  8. Personalized Risk Estimator for Rheumatoid Arthritis (PRE-RA) Family Study: Rationale and design for a randomized controlled trial evaluating rheumatoid arthritis risk education to first-degree relatives

    OpenAIRE

    Sparks, Jeffrey A.; Iversen, Maura D.; Kroouze, Rachel Miller; Mahmoud, Taysir G.; Triedman, Nellie A.; Kalia, Sarah S.; Atkinson, Michael L.; Lu, Bing; Deane, Kevin D.; Costenbader, Karen H.; Green, Robert C.; Elizabeth W. Karlson

    2014-01-01

    We present the rationale, design features, and protocol of the Personalized Risk Estimator for Rheumatoid Arthritis (PRE-RA) Family Study (ClinicalTrials.gov NCT02046005). The PRE-RA Family Study is an NIH-funded prospective, randomized controlled trial designed to compare the willingness to change behaviors in first-degree relatives of rheumatoid arthritis (RA) patients without RA after exposure to RA risk educational programs. Consented subjects are randomized to receive education concernin...

  9. Association between anti-Porphyromonas gingivalis or anti-α-enolase antibody and severity of periodontitis or rheumatoid arthritis (RA) disease activity in RA.

    Science.gov (United States)

    Lee, Joo Youn; Choi, In Ah; Kim, Jin-Hee; Kim, Kyoung-Hwa; Lee, Eun Young; Lee, Eun Bong; Lee, Yong-Moo; Song, Yeong Wook

    2015-08-12

    Periodontitis (PD) has been reported to be associated with rheumatoid arthritis (RA). Porphyromonas gingivalis (P. gingivalis) is a gram-negative anaerobic bacterium that is recognized as one of the major pathogenic organisms in PD and is the only bacterium known to express peptidylarginine deiminase (PAD). Antibody against human α-enolase (ENO1) is one of the autoantibodies in RA. ENO1 is a highly conserved protein, and could be a candidate molecule for molecular mimicry between bacterial and human proteins. In the present study, we measured serum antibody against P. gingivalis and human ENO1 in patients with RA and investigated their association with the severity of PD or disease activity of RA. Two hundred, forty-eight patients with RA and 85 age- and sex-matched healthy controls were evaluated by rheumatologic and periodontal examinations. The serum levels of anti-P. gingivalis and anti-ENO1 antibodies were measured by an enzyme-linked immunosorbent assay (ELISA). Patients with RA had significantly higher levels of anti-P. gingivalis and anti-ENO1 antibody titers than the controls (p = 0.002 and 0.0001, respectively). Anti-P. gingivalis antibody titers significantly correlated with anti-ENO1 antibody titers in RA patients (r = 0.30, p < 0.0001). There were significant correlations between anti-P. gingivalis antibody titers and the gingival index (GI), probing pocket depth (PPD), bleeding on probing (BOP) and clinical attachment level (CAL) (p = 0.038, 0.004, 0.004 and 0.002, respectively) in RA. Anti-P. gingivalis antibody titers were not correlated with disease activity score 28 (DAS28) or anti-CCP titer. However, anti-ENO1 antibody titers were significantly correlated not only with the periodontal indices, such as PPD, BOP, and CAL (p = 0.013, 0.023 and 0.017, respectively), but also RA clinical characteristics, such as DAS28, anti-CCP titer, and ESR (p = 0.009, 0.015 and 0.001, respectively). Anti-P. gingivalis and anti-ENO1 antibody

  10. Ra-226 and Pb-210/Ra-226 Activity Ratio in the Northern South China Sea

    Science.gov (United States)

    Chi-Ju, L.; Yu-Chia, C.; Tsung-En, W.

    2004-05-01

    The surface water distributions and vertical profiles of Ra-226 in the northern South China Sea (SCS) have been measured. Surface water Ra-226 varies between 10 and 16 dpm/100 kg with higher values at stations adjacent to the landmass. Each Ra-226 profile shows an increase from the surface toward the bottom. Above 1000m depth Ra-226 is systematically about 5 dpm/100kg higher in the northern South China Sea than in the western North Pacific. This difference may be attributed to a strong Ra-226 source from the shelf and slope area of the SCS. Below this depth Ra-226 displays large variation within some of the profiles with lower limits being comparable to the activities of the western North Pacific but higher limits being systematically about 5 dpm/100kg higher. These high Ra-226 activities may reflect effects of the longer isolation time for the deep water in the SCS basin and strong Ra input from the underlying sediments. The Pb-210/Ra-226 activity ratio ranges between 1.4 and 2.7 in the surface water with higher activity ratio at the station closer to the Luzon Strait. The Pb-210 in excess over Ra-226 in the surface water due to atmospheric input may penetrate to a depth of about 200 to 500m. Below this depth, Pb-210/Ra-226 activity ratio ranges between 0.5 and 0.7 because Pb-210 is scavenged by settling particulates. Box model calculations within a mixed layer of 50m in the area yield a mean residence time of about 1 yr for Pb-210 if an atmospheric Pb-210 flux of 1 dpm/cm2/y is adopted. The activity ratio of about 0.5 to 0.7 in the deep water corresponds to a Pb-210 mean residence time of about 30 to 70 yrs with respect to particulate scavenging.

  11. Developing a Construct to Evaluate Flares in Rheumatoid Arthritis: A Conceptual Report of the OMERACT RA Flare Definition Working Group

    DEFF Research Database (Denmark)

    Alten, Rieke; Choy, Ernest H; Christensen, Robin

    2011-01-01

    Rheumatoid arthritis (RA) patients and healthcare professionals (HCP) recognize that episodic worsening disease activity, often described as a "flare," is a common feature of RA that can contribute to impaired function and disability. However, there is no standard definition to enable measurement...... of its intensity and impact. The conceptual framework of the Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group includes an anchoring statement, developed at OMERACT 9 in 2008: "flare in RA" is defined as worsening of signs and symptoms of sufficient intensity...... is intended to enhance patient-HCP communication. This article describes the conceptual framework being used by the OMERACT RA Flare Definition Working Group in developing a standardized method for description and measurement of "flare in RA" to guide individual patient treatment....

  12. Asbestiprobleem Eestis lahendamata / Hubert Kahn

    Index Scriptorium Estoniae

    Kahn, Hubert

    2006-01-01

    Asbesti tervist kahjustavast toimest ning asbesti tootmise ja kasutamise järkjärgulisest piiramisest eri riikides. Tabelid: Asbesti liigid; Asbesti osatähtsus tehnikas ja tehnoloogias; Asbesti toodang maailmas 1988. aastal

  13. Asbestiprobleem Eestis lahendamata / Hubert Kahn

    Index Scriptorium Estoniae

    Kahn, Hubert

    2006-01-01

    Asbesti tervist kahjustavast toimest ning asbesti tootmise ja kasutamise järkjärgulisest piiramisest eri riikides. Tabelid: Asbesti liigid; Asbesti osatähtsus tehnikas ja tehnoloogias; Asbesti toodang maailmas 1988. aastal

  14. Treatment of ankylosing spondylitis with [{sup 224}Ra]-Radiumchloride; Therapie der Spondylitis ankylosans mit [{sup 224}Ra]-Radiumchlorid

    Energy Technology Data Exchange (ETDEWEB)

    Reiners, C. [Klinik und Poliklinik fuer Nuklearmedizin der Univ. Wuerzburg (Germany); Braun, J. [Rheumazentrum Ruhrgebiet Herne (Germany)

    2001-07-01

    Ankylosing spondylitis (AS) is a chronic disease which in 30-50% of the patients leads to considerable episodes of pain, a remarkable reduction of quality of life and disablement. For treatment mostly nonsteroidal antiphlogistic drugs are used which are able to reduce pain in approximately 80% of the patients only. Those drugs however, have to be withdrawn in approximately 30% of the patients due to its known toxicity (mainly in the gastrointestinal tract). Basis medication (DMARDs) is helpful in a minority of AS patients only. Recently [{sup 224}Ra]-Radiumchloride, which has been used previously between 1955 and 1990, has been made available again for treatment of AS. Whereas biokinetics, radiation exposure and the risk-profile of [{sup 224}Ra]-Radiumchloride are documented well by experimental and clinical data, most of the historical studies about the efficacy of this radiopharmaceutical do not fulfill the requirements of modern therapy studies. Therefore as many patients as possible should be recruited for a prospective long-time Phase IV study. A close and well-coordinated cooperation between rheumatologists and nuclear medicine physicians is needed, when [{sup 224}Ra]-Radiumchloride is used for treatment of AS. (orig.) [German] Die meist chronisch, oft auch in Schueben verlaufende Spondylitis ankylosans (AS) fuehrt bei 30-50% der Patienten zu betraechtlichen Schmerzen und einer nicht selten erheblichen Einschraenkung der Lebensqualitaet und Behinderung. Die am haeufigsten zur Therapie verwendeten nichtsteroidalen Antiphlogistika koennen nur bei etwa 80% der Patienten die Schmerzen lindern. Allerdings muessen diese Medikamente bei 20-30% der AS-Patienten wegen ihrer bekannten Toxizitaet - vor allem im Gastrointestinaltrakt - abgesetzt werden. Basistherapeutika (DMARDs) helfen bei der AS nur sehr begrenzt. Mit [{sup 224}Ra]-Radiumchlorid steht seit kurzem ein bereits in den Jahren 1945-1990 fuer die Behandlung der AS verwendetes Radiopharmakon wieder zur

  15. 228Ra, 226Ra, 224Ra and 223Ra in potential sources and sinks of land-derived material in the German Bight of the North Sea: implications for the use of radium as a tracer

    NARCIS (Netherlands)

    Schmidt, C.; Hanfland, C.; Regnier, P.; Van Cappellen, P.; Schlüter, M.; Knauthe, U.; Stimac, I.; Geibert, W.

    2011-01-01

    Activities of the naturally occurring radium nuclides 228Ra, 226Ra, 224Ra and 223Ra were determined in waters of the open German Bight and adjacent nearshore areas in the North Sea, in order to explore the potential use of radium isotopes as natural tracers of land–ocean interaction in an environmen

  16. ICMPv6 RA Flooding Vulnerability Research

    Directory of Open Access Journals (Sweden)

    Linas Jočys

    2016-06-01

    Full Text Available ICMPv6 is the newest version of internet control message protocol, whose main purpose is to send error message indicating packet processing failure. It is know that ICMPv6 is technologically vulnerable. One of those vulnerabilities is the ICMPv6 RA flooding vulnerability, which can lead to systems in Local Area Network slow down or full stop. This paper will discuss Windows (XP, 7, 8.1 and Linux Ubuntu 14 operating systems resistance to RA flooding attack research and countermeasures to minimize this vulnerability.

  17. Fever without apparent source on clinical examination, lower respiratory infections in children, and other infectious diseases.

    Science.gov (United States)

    McCarthy, P L; Klig, J E; Kahn, J S

    1999-02-01

    This section focuses on issues in infectious disease that are commonly encountered in pediatric office practice. Paul McCarthy discusses recent literature regarding the evaluation and management of acute fevers without apparent source on clinical examination in infants and children and the evaluation of children with prolonged fevers of unknown origin. Jean Klig reviews recent literature about lower respiratory tract infection in children. Finally, Jeffrey Kahn discusses recent developments concerning rotavirus vaccine.

  18. Fever without apparent source on clinical examination, lower respiratory infections in children, and enterovirus infections.

    Science.gov (United States)

    McCarthy, P L; Klig, J E; Kennedy, W P; Kahn, J S

    2000-02-01

    This section focuses on issues in infectious disease that are commonly encountered in pediatric office practice. McCarthy discusses recent literature regarding the evaluation and management of acute fevers without apparent source on clinical examination in infants and children and the evaluation of children with prolonged fevers of unknown origin. Klig reviews recent literature about lower respiratory tract infection in children. Finally, Kennedy and Kahn discuss recent developments in infectious diseases pertinent to office practice.

  19. Preverjanje znanja računalništva, pridobljenega z aktivnostmi za učenje računalništva brez računalnika

    OpenAIRE

    Zaviršek, Manca

    2015-01-01

    V magistrskem delu obravnavamo ugotavljanje računalniškega znanja, ki ga učenci pridobijo z aktivnostmi Računalništvo brez računalnika. Najprej opredelimo, kaj sploh je računalniško znanje in kaj so računalniški koncepti, ter se posvetimo sodobnim pristopom k poučevanju računalništva, kjer je v ospredju reševanje problemov, uresničujemo pa jih lahko z aktivnostmi Računalništvo brez računalniki in z nalogami s tekmovanja Bober. V empiričnem delu nas zanima, ali je ugotavljanje znanja, pridoblj...

  20. Controlled Cohort Study of Serum Gonadal and Adrenocortical Steroid Levels in Males Prior to Onset of Rheumatoid Arthritis (pre-RA: A Comparison to pre-RA Females and Sex Differences among the Study Groups

    Directory of Open Access Journals (Sweden)

    Alfonse T. Masi

    2013-01-01

    Full Text Available Serum testosterone levels are generally reported to be lower in male rheumatoid arthritis (RA patients, but it is not determined if a deficiency may occur before clinical onset of disease (pre-RA. Lower testosterone levels were recently reported in males many years before RA onset but were predictive only of rheumatoid factor (RF—negative disease. A preceding prospective study did not reveal androgenic-anabolic hormone association with risk of RA in men or women. This cohort study of males analyzed baseline serum levels of gonadal and adrenocortical steroids, luteinizing hormone, and prolactin in 18 pre-RA versus 72 matched non-RA control (CN subjects. Findings in males were compared to those in female pre-RA and CN subjects in the same cohort, and sex differences were analyzed. Steroidal and hormonal levels, including total testosterone, were similar between male study groups. In females, mean (±SE serum androstenedione (nmol/L was slightly (P=0.048 lower in 36 pre-RA (6.7 ± 0.36 than 144 CN (7.6 ± 0.22. With the exception of 3 partial correlations of hormonal variables observed to differ between pre-RA versus CN subjects, the patterns were similar overall. However, partial correlations of hormonal variables differed frequently by sex, both within and between study groups.

  1. A rotating target for Ra production

    NARCIS (Netherlands)

    Sohani, M.; Wilschut, H. W.

    2012-01-01

    A target wheel with pyrolytic graphite targets is designed and constructed at the TRI mu P facility to boost the production rate of Ra isotopes. Simulation, design properties and production results are discussed. (C) 2012 Elsevier B.V. All rights reserved.

  2. Neutron Resonance Parameters for Ra-226 (Radium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Volume 24 `Neutron Resonance Parameters' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms'. It provides the neutron resonance parameters for the isotope Ra-226 (Radium).

  3. IL-1Ra (recombinant human IL-1 receptor antagonist in the treatment of rheumatoid arthritis: the efficacy

    Directory of Open Access Journals (Sweden)

    L. Cozzi

    2011-09-01

    Full Text Available Interleukin 1 receptor antagonist (IL-1Ra is a naturally occurring IL-1 inhibitor, acting as a “receptor antagonist”, which blocks IL-1 mediated signal transduction. In 1990 IL-1Ra was cloned and later on, a large numbers of studies led to disclosure of the crucial importance of the imbalance between IL-1 and IL-1Ra in the pathogenesis of rheumatoid arthritis (RA. In 1991, almost 8 years after the initial isolation of IL-1, recombinant IL-1Ra (IL-1ra, Kineret was introduced in clinical trials involving patients with RA. Between 2001 and 2002 IL-1ra was approved by the US Food and Drug Administration and by the European Agency for the Evaluation of the Medicinal Products and in 2003 it was registered in Italy, too. In RA recombinant IL-1ra has been evaluated in 5 randomized, placebo-controlled clinical trials involving more than 2900 patients. Two of the trials involved the use of IL-1ra as monotherapy versus placebo and two trials in combination with methotrexate (MTX; the last trial explored the use of a fixed 100 mg/day IL-1ra dosage in a RA patient population including a wide array of co-morbid conditions as well as concomitant medications. The studies confirmed both the efficacy and the safety of IL-1ra in patients with active and severe RA. 43% of patients receiving 150 mg/day IL-1ra achieved a 20% response according to the American College of Rheumatology criteria (ACR20, compared to 27% in the placebo group. In the MTX combination therapy study, 42% of the patients receiving 1 mg/Kg/day of IL-1ra achieved an ACR20, 24% an ACR50 and 10% an ACR70. In each study, significant improvements in the Health Assessment Questionnaire scores (HAQ were observed. There were rapid gains in the number of days at work or domestic activity in the treated patients, and the increases in productivity were dose related. At early 24 weeks, there was significant reduction of both the score for progression of joint space narrowing (JSN and the Total modified

  4. Genetics of RA susceptibility, what comes next?

    Science.gov (United States)

    Ding, James; Eyre, Stephen; Worthington, Jane

    2015-01-01

    Summary Genome-wide association studies (GWASs) have been used to great effect to identify genetic susceptibility loci for complex disease. A series of GWAS and meta-analyses have informed the discovery of over 100 loci for rheumatoid arthritis (RA). In common with findings in other autoimmune diseases the lead signals for the majority of these loci do not map to known gene sequences. In order to realise the benefit of investment in GWAS studies it is vital we determine how disease associated alleles function to influence disease processes. This is leading to rapid development in our knowledge as to the function of non-coding regions of the genome. Here we consider possible functional mechanisms for intergenic RA-associated variants which lie within lncRNA sequences. PMID:26509058

  5. Entrevista a Raúl Gagliardi.

    Directory of Open Access Journals (Sweden)

    Diego Campos (Pagina 1-7

    2008-10-01

    Full Text Available En el V encuentro de Enseñanza de la Biología y Educación Ambiental, celebrado los días 17, 18 y 19 de Junio del año en curso, los miembros del comité editorial de la revista del Departamento de Biología de la Universidad Pedagógica Nacional entrevistaron al conferencista internacional Raúl Galgliardi.

  6. Chôra : Creation and Pathology

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    Plato's dialogue the Timaeus describes not only the making of the cosmos (order), but also the condition of what is not order, neither for the human body nor for the universe. What is disorder in cosmogonic terms it is disease for the human body. Timaeus applies to the concept chôra in discussing....... http://www.ejop.org/archives/2009/05/chara_creation.html...

  7. 甲亢性心脏病应用碘131核素辅以普萘洛尔的临床研究%Clinical Study of 131 Hyperthyroid Heart Disease Application of Ra-dionuclide Combined with Propranolol

    Institute of Scientific and Technical Information of China (English)

    张丽莉

    2016-01-01

    Objective To analyze the application of iodine 131 radionuclide combined with the clinical effects of pro-pranolol treatment of hyperthyroid heart disease. Methods March 2015 to March 2016 in our hospital for treatment of 84 cases of hyperthyroid patients with heart disease, the application of computer sampling group, the control group of 42 cases were treated by propranolol,the observation group of 42 cases of application of radionuclide iodine 131 treat-ment with propranolol,observe clinical efficacy and adverse reactions. Results The total study group was 92.86%higher than 73.81%, P0.05. Conclusion Iodine 131 radionuclide combined with propranolol to treat hyperthyroidism heart disease can sig-nificantly reduce the amount of thyroid hormone, promote clinical efficacy.%目的:研究分析应用碘131核素辅以普萘洛尔治疗甲亢性心脏病的临床效果。方法选择2015年3月—2016年3月期间在该院进行治疗的84例甲亢性心脏病患者,应用计算机抽样法进行分组,对照组42例应用普萘洛尔进行治疗,观察组42例应用碘131核素辅以普萘洛尔进行治疗,观察临床疗效和不良反应。结果研究组总有效率92.86%高于对照组73.81%,P0.05。结论应用碘131核素辅以普萘洛尔治疗甲亢性心脏病可明显降低甲状腺激素的含量,促进临床疗效的提高。

  8. A transmembrane polymorphism in FcgammaRIIb (FCGR2B) is associated with the production of anti-cyclic citrullinated peptide autoantibodies in Taiwanese RA.

    Science.gov (United States)

    Chen, J-Y; Wang, C-M; Ma, C-C; Hsu, L-A; Ho, H-H; Wu, Y-J J; Kuo, S-N; Wu, J

    2008-12-01

    The aim of the current study was to determine whether the FcgammaRIIb 187-Ile/Thr polymorphism is a predisposition factor for subtypes of RA defined by disease severity and production of autoantibodies against cyclic citrullinated peptides (anti-CCPs) in Taiwanese RA patients. Genotype distributions and allele frequencies of FcgammaRIIb 187-Ile/Thr were compared between 562 normal healthy controls and 640 RA patients as stratified by clinical parameters and autoantibodies. Significant enrichment of 187-Ile allele was observed in RA patients positive for anti-CCP antibodies as compared with the anti-CCP negative RA patients (P=0.001, OR 1.652 (95% CI 1.210-2.257)) or as compared with the normal controls (P=0.005, OR 1.348 (95% CI 1.092-1.664)). In addition, 187-Ile allele was found to be enriched in RA patients positive for rheumatoid factor (RF) compared to the RF negative RA patients (P=0.024, OR 1.562 (95% CI 1.059-2.303)). Furthermore, the homozygotes were enriched in destructive male RA patients (P=0.035; OR 2.038 (95% CI 1.046-3.973)) and the 187-Ile allele was associated with early-onset of RA in Taiwanese patients (P=0.045, OR 1.548 (95% CI 1.007-2.379)). Thus, FcgammaRIIb SNP 187-Ile/Thr may influence the RA phenotypes in Taiwanese RA.

  9. The Geography of the ta-ra-si-ja

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    2000-01-01

    Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places......Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places...

  10. 独活寄生汤联合来氟米特治疗类风湿关节炎临床研究%Live with parasitic soup from the joint treatment of rheumatoid arthritis (ra) of clinical research

    Institute of Scientific and Technical Information of China (English)

    万亮瑜; 杨开; 梅小平

    2016-01-01

    Objective: to live with parasitic soup from the joint special piece of clinical curative effect of observation for the treatment of rheumatoid arthritis. Methods: the unique living parasitic soup from the joint piece for the treatment of rheumatoid arthritis (liver and kidney deficiency type) clinical efficacy was retrospectively analyzed. Application of random Numbers table put into 120 patients were randomly divided into treatment group and control group, two groups of 60 cases, control group given to fluorine milt treatment; Treatment group shall be the sole living parasitic soup from the joint special treatment, as a course for 6 months, respectively, before treatment, treatment of 1 month, 2 months, 3 months for patients with DAS-28 marking and HAQ health assessment questionnaire is adopted to improve the quality of life assessment. Results: the total effective rate in treatment group, and show the efficiency of 88.33% and 80%, respectively; the control group total effective rate, efficiency of 73.33% and 61.61% respectively. The total effective rate, the efficiency of the treatment group was significantly better than the control group. Two groups of patients with HAQ scores, DAS-28 grading is improved in the treatment of 1 month, in remission. Two groups of patients with HAQ scores, DAS-28 score after 2 months continue to decrease, preliminary alleviate illness, before this treatment had significant difference (P 0.05);Two groups at the end of the treatment of patients with HAQ scores, DAS-28 score decreased significantly, the control condition, the group before and 1 month treatment had significant difference (P < 0.05), compared between groups had significant difference (P < 0.05).Conclusion: unique live parasitic soup from joint piece can effectively improve the liver and kidney deficiency type of rheumatoid arthritis patients clinical symptoms and laboratory indexes, and no obvious adverse reaction, improve the quality of survival, satisfactory results

  11. Early electroretinografic changes in elderly RA patients treated with hydroxychloroquine

    Directory of Open Access Journals (Sweden)

    C. Gelmi

    2011-09-01

    Full Text Available Objective: to evaluate the effectiveness of fundoscopy, electrooculography, electroretinogram and visually evoked potentials in early detection of hydroxychloroquine retinal toxicity in RA patients and to evaluate the influence of patients’ age, drug dosage, concomitant therapy (prednisone and methotrexate and serum creatinine levels in the development of this side effect. Methods: from september to december 1999, we have enrolled 32 RA patients (13 males, 19 females starting hydroxichlorochine treatment. The patients underwent regular ophthalmological examination (fundoscopy, electro-oculography, electro-retinogram and visually evoked potentials every 4 months. Disease activity was evaluated every two months by clinical and routine serological examination. Results: no patients developed retinopathy during 1 year’s follow-up; fundoscopy, electrooculography, and visually evoked potentials did not vary from the baseline. On the other hand, electroretinogram showed early alterations of scotopic and photopic response; moreover a significant statistical correlation between patients’ age (more than 65 years and b1 photopic wave increase (p < 0,05 was observed. No correlation was found between the developement of electro- retinographic alterations and hydroxychloroquine dosage, concomitant therapy and serum creatinine levels Conclusion: our data show the inefficacy of fundoscopy, electrooculography and visually evoked potentials in early detection of hydroxychloroquine retinopathy. On the other hand electroretinogram allows early detection of retinal alterations during hydroxychloroquine treatment, in patients older than 65 years.

  12. High-Speed RaPToRS

    Science.gov (United States)

    Henchen, Robert; Esham, Benjamin; Becker, William; Pogozelski, Edward; Padalino, Stephen; Sangster, Thomas; Glebov, Vladimir

    2008-11-01

    The High-Speed Rapid Pneumatic Transport of Radioactive Samples (HS-RaPToRS) system, designed to quickly and safely move radioactive materials, was assembled and tested at the Mercury facility of the Naval Research Laboratory (NRL) in Washington D.C. A sample, which is placed inside a four-inch-diameter carrier, is activated before being transported through a PVC tube via airflow. The carrier travels from the reaction chamber to the end station where it pneumatically brakes prior to the gate. A magnetic latch releases the gate when the carrier arrives and comes to rest. The airflow, optical carrier-monitoring devices, and end gate are controlled manually or automatically with LabView software. The installation and testing of the RaPToRS system at NRL was successfully completed with transport times of less than 3 seconds. The speed of the carrier averaged 16 m/s. Prospective facilities for similar systems include the Laboratory for Laser Energetics and the National Ignition Facility.

  13. Ra-224 and Ra-226: A New Method for Measuring Groundwater Seepage in Lake Michigan

    Science.gov (United States)

    Stevens, K. R.; Buyan, A. C.; Waples, J. T.

    2008-12-01

    Radium isotopes have been used to estimate groundwater discharge (GWD) in coastal marine waters for decades, but this technique has never before been used in the Laurentian Great Lakes. In this study, we used a RAD7 radon-in-air monitor to measure naturally-occurring radium isotopes Ra-224 (half-life= 3.64 d) and Ra-226 (half-life = 1600 a) in groundwater and three shallow water sites along Lake Michigan's Wisconsin coastline. Radium-224 activities in groundwater ranged from 1153 dpm m-3 in a deep aquifer (New Berlin well no.7) to 31 dpm m-3 in a shallow aquifer (Pryor well). Nearshore Lake Michigan measurements of Ra-224 were lowest at Red Arrow Beach (0.2 dpm m-3), higher in the Milwaukee harbor (GLWI slip, 1.1 dpm m-3) and highest at Harrington Beach (4.1 dpm m-3) and correspond well with groundwater seepage estimates made by Cherkauer et al. (1990) using alternate methods (i.e., where higher radium activity is indicative of higher GWD). These Ra-224 measurements are the first ever made in Lake Michigan (and presumably any of the Great Lakes) and we conclude that, by sampling offshore radium activity gradients, this RAD7 technique is a viable method for directly measuring GWD in Lake Michigan and other freshwater systems.

  14. Imaging of Ra-223 with a small-pixel CdTe detector

    Science.gov (United States)

    Scuffham, J. W.; Pani, S.; Seller, P.; Sellin, P. J.; Veale, M. C.; Wilson, M. D.; Cernik, R. J.

    2015-01-01

    Ra-223 Dichloride (Xofigo™) is a promising new radiopharmaceutical offering survival benefit and palliation of painful bone metastases in patients with hormone-refractory prostate cancer [1]. The response to radionuclide therapy and toxicity are directly linked to the absorbed radiation doses to the tumour and organs at risk respectively. Accurate dosimetry necessitates quantitative imaging of the biodistribution and kinetics of the radiopharmaceutical. Although primarily an alpha-emitter, Ra-223 also has some low-abundance X-ray and gamma emissions, which enable imaging of the biodistribution in the patient. However, the low spectral resolution of conventional gamma camera detectors makes in-vivo imaging of Ra-223 challenging. In this work, we present spectra and image data of anthropomorphic phantoms containing Ra-223 acquired with a small-pixel CdTe detector (HEXITEC) [2] with a pinhole collimator. Comparison is made with similar data acquired using a clinical gamma camera. The results demonstrate the advantages of the solid state detector in terms of scatter rejection and quantitative accuracy of the images. However, optimised collimation is needed in order for the sensitivity to rival current clinical systems. As different dosage levels and administration regimens for this drug are explored in current clinical trials, there is a clear need to develop improved imaging technologies that will enable personalised treatments to be designed for patients.

  15. Personalized Risk Estimator for Rheumatoid Arthritis (PRE-RA) Family Study: rationale and design for a randomized controlled trial evaluating rheumatoid arthritis risk education to first-degree relatives.

    Science.gov (United States)

    Sparks, Jeffrey A; Iversen, Maura D; Miller Kroouze, Rachel; Mahmoud, Taysir G; Triedman, Nellie A; Kalia, Sarah S; Atkinson, Michael L; Lu, Bing; Deane, Kevin D; Costenbader, Karen H; Green, Robert C; Karlson, Elizabeth W

    2014-09-01

    We present the rationale, design features, and protocol of the Personalized Risk Estimator for Rheumatoid Arthritis (PRE-RA) Family Study (ClinicalTrials.gov NCT02046005). The PRE-RA Family Study is an NIH-funded prospective, randomized controlled trial designed to compare the willingness to change behaviors in first-degree relatives of rheumatoid arthritis (RA) patients without RA after exposure to RA risk educational programs. Consented subjects are randomized to receive education concerning their personalized RA risk based on demographics, RA-associated behaviors, genetics, and biomarkers or to receive standard RA information. Four behavioral factors associated with RA risk were identified from prior studies for inclusion in the risk estimate: cigarette smoking, excess body weight, poor oral health, and low fish intake. Personalized RA risk information is presented through an online tool that collects data on an individual's specific age, gender, family history, and risk-related behaviors; presents genetic and biomarker results; displays relative and absolute risk of RA; and provides personalized feedback and education. The trial outcomes will be changes in willingness to alter behaviors from baseline to 6 weeks, 6 months, and 12 months in the three intervention groups. The design and the execution of this trial that targets a special population at risk for RA, while incorporating varied risk factors into a single risk tool, offer distinct challenges. We provide the theoretical rationale for the PRE-RA Family Study and highlight particular design features of this trial that utilize personalized risk education as an intervention.

  16. LoRA: A Loudspeaker-Based Room Auralization System

    DEFF Research Database (Denmark)

    Favrot, Sylvain Emmanuel; Buchholz, Jörg

    2010-01-01

    In order to study basic human perception in reverberant environments, a novel loudspeaker-based room auralization (LoRA) system is proposed in this paper. The LoRA system efficiently combines modern room acoustic models with high-order Ambisonic auralization. An objective evaluation has been...... carried out demonstrating the applicability of the LoRA system. Room acoustic parameters (reverberation time, clarity, speech transmission index and inter-aural cross correlation coefficients) of room impulse responses were compared at the input and the simulated output of the LoRA system. Results show...

  17. Drugs or disease: evaluating salivary function in RA patients

    Directory of Open Access Journals (Sweden)

    Sandra Regina TORRES

    Full Text Available Abstract Oral complications of RA may include temporomandibular joint disorders, mucosa alterations and symptoms of dry mouth. The aim of this study was to evaluate the salivary gland function of subjects with rheumatoid arthritis (RA comparing it to healthy controls. Subjects with other systemic conditions known to affect salivary functions were excluded. A questionnaire was applied for the evaluation of xerostomia. Resting and chewing-stimulated salivary flow rates (SFR were obtained under standard conditions. There were 145 subjects included of the study (104 RA and 38 controls. About 66.7% of the RA subjects and 2.4% in control group presented xerostomia. The median resting SFR were 0.24 ml/min for RA subjects and 0.40 mL/min for controls (p = 0.04. The median stimulated SFR were 1.31 mL/min for RA subjects and 1.52 ml/min for controls (p = 0.33. No significant differences were found between resting and stimulated SFR of RA subjects not using xerogenic medications and controls. There was significantly higher number of subjects presenting hyposalivation in the RA group than among controls, even when subjects using xerogenic medications were eliminated from the analysis. In conclusion, hyposalivation and xerostomia were more frequent among RA subjects not using xerogenic medication than among controls, although there were no significant differences in the median SFR between groups.

  18. Separation of Ra/Ca by ion exchange; Separacion de Ra/Ca por intercambio ionico

    Energy Technology Data Exchange (ETDEWEB)

    Iturbe, J.L.; Jimenez R, M.; Flores M, J

    1991-04-15

    The radium and the calcium belong to the same group in the periodic classification and as consequence both they present very similar chemical properties, that makes difficult its separation. Both elements are also frequently associate in the nature, the calcium is very abundant, the radium is not it and for that reason it is indispensable its separation to analyze to this last one. The alpha spectroscopy is very appropriate to analyze to the {sup 226} Ra, however to achieve a good resolution of the spectra, the samples should contain small quantities of calcium. The purposes of this work were to know the chromatographic behavior of the alkaline-earthy cations: calcium, barium and radium and to apply these knowledge to the separation of the {sup 226} Ra and its analysis by means of alpha spectroscopy. (Author)

  19. Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America.

    Science.gov (United States)

    Bonotto, D M

    2004-01-01

    Groundwater samples were analysed for 222Rn, 226Ra, and 228Ra in Guarani aquifer spreading around 1 million km2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.

  20. Laser-trapping of Ra-225 and Ra-226 with repumping by room temperature blackbody radiation

    CERN Document Server

    Guest, J R; Bailey, K; Greene, J P; Holt, R J; Lu, Z T; O'Connor, T P; Potterveld, D H; Scielzo, N D

    2007-01-01

    We have demonstrated Zeeman slowing and capture of neutral Ra-225 and Ra-226 atoms in a magneto-optical trap (MOT). The intercombination transition 1S0-3P1 is the only quasi-cycling transition in radium and was used for laser-cooling and trapping. Repumping along the 3D1-1P1 transition extended the lifetime of the trap from milliseconds to seconds. Room-temperature blackbody radiation was demonstrated to provide repumping from the metastable 3P0 level. We measured the isotope shift and hyperfine splittings on the 3D1-1P1 transition with the laser-cooled atoms, and set a limit on the lifetime of the 3D1 level based on the measured blackbody repumping rate. Laser-cooled and trapped radium is an attractive system for studying fundamental symmetries.

  1. Periodontal Disease and Subgingival Microbiota as Contributors for RA Pathogenesis: Modifiable Risk Factors?

    Science.gov (United States)

    Scher, Jose U.; Bretz, Walter A.; Abramson, Steven B.

    2014-01-01

    Purpose of review Since the early 1900s, the role of periodontal disease in the pathogenesis of rheumatoid arthritis has been a matter of intense research. The last decade has witnessed many advances supporting a link between periodontitis, the presence of specific bacterial species (i.e., Porphyromonas ginigivalis) and their effects in immune response. This review will examine available evidence on the subject. Recent findings Epidemiological studies have stressed the commonalities shared by periodontal disease and rheumatoid arthritis. Many groups have focused their attention towards understanding the periodontal microbiota and its alterations in states of health and disease. The presence of circulating antibodies against periodontopathic bacteria and associated inflammatory response has been found in both RA patients and subjects at-risk for disease development. Most recently, the periodontal microbiota of smokers and patients with RA has been elucidated, revealing profound changes in the bacterial communities compared to that of healthy controls. This has led to several small clinical trials of PD treatment as adjuvant for disease-modifying therapy in RA. Summary Smoking and periodontal disease are emerging risk factors for the development of RA. Epidemiological, clinical and basic research has further strengthened this association, pointing towards changes in the oral microbiota as possible contributors to systemic inflammation and arthritis. PMID:24807405

  2. Determination of {sup 226}Ra and {sup 224}Ra in sediments samples by liquid scintillation counting

    Energy Technology Data Exchange (ETDEWEB)

    Villa, M. [Facultad de Fisica. Av. Reina Mercedes s/n, apdo 1065, Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, 41080-Sevilla (Spain)]. E-mail: mvilla@us.es; Moreno, H.P. [E.T.S. Arquitectura. Av. Reina Mercedes, 2, Departamento de Fisica Aplicada II, Universidad de Sevilla, 41012-Sevilla (Spain); Manjon, G. [E.T.S. Arquitectura. Av. Reina Mercedes, 2, Departamento de Fisica Aplicada II, Universidad de Sevilla, 41012-Sevilla (Spain)

    2005-10-01

    An experimental procedure has been developed for a rapid determination of the activity concentration of {sup 226}Ra and {sup 224}Ra in sediments by liquid scintillation counting. The importance of the method lies in its application to the measurement of sediments where the Ra-isotopes activity concentration has been increased due to an anthropomorphic enhancement based on releases of naturally occurring radioactive material (NORM). A sample pre-treatment, including a digestion with aqua regia and a precipitation of hydroxides, was applied to samples before the radium extraction, which was made by co-precipitation with barium. Measurements were done in a low background scintillation spectrometer Quantulus 1220, which can separate and detect simultaneously {alpha} and {beta} particles. Additionally, some improvements are suggested for a better {alpha} and {beta} interference correction of the results. The obtaining of radiochemical yields is also improved using {sup 133}Ba as tracer, which decays by emission of conversion electrons and {gamma}-rays; the wide range of radiochemical yields obtained confirms the need of this analyses. The procedure has been applied to the measurement of riverbed sediments from an estuary in the south-west of Spain, affected in the past by direct and indirect phosphogypsum discharges.

  3. Women, men, and rheumatoid arthritis: analyses of disease activity, disease characteristics, and treatments in the QUEST-RA study

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Toloza, Sergio; Cutolo, Maurizio

    2009-01-01

    remission. Therefore, we aimed to study possible associations of gender and disease activity, disease characteristics, and treatments of RA in a large multinational cross-sectional cohort of patients with RA called Quantitative Standard Monitoring of Patients with RA (QUEST-RA). METHODS : The cohort...... includes clinical and questionnaire data from patients who were seen in usual care, including 6,004 patients at 70 sites in 25 countries as of April 2008. Gender differences were analyzed for American College of Rheumatology Core Data Set measures of disease activity, DAS28 (disease activity score using 28.......3 versus 3.8, and fatigue of 4.6 versus 3.7 (P disease activity (0 to 1) on SJC28, women had statistically significantly higher mean values compared with men in all other disease activity...

  4. Determination of gross alpha, 224Ra, 226Ra, and 228Ra activities in drinking water using a single sample preparation procedure.

    Science.gov (United States)

    Parsa, Bahman; Obed, Reynaldo N; Nemeth, William K; Suozzo, Gail P

    2005-12-01

    The current federal and New Jersey State regulations have greatly increased the number of gross alpha and radium tests for public and private drinking water supplies. The determination of radium isotopes in water generally involves lengthy and complicated processes. In this study, a new approach is presented for the determination of gross alpha, 224Ra, 226Ra, and 228Ra activities in water samples. The method includes a single sample preparation procedure followed by alpha counting and gamma-ray spectroscopy. The sample preparation technique incorporates an EPA-approved co-precipitation methodology for gross alpha determination with a few alterations and improvements. Using 3-L aliquots of sample, spiked with 133Ba tracer, the alpha-emitting radionuclides are isolated by a BaSO4 and Fe(OH)3 co-precipitation scheme. First the gross alpha-particle activity of the sample is measured with a low-background gas-flow proportional counter, followed by radium isotopes assay by gamma-ray spectroscopy, using the same prepared sample. Gamma-ray determination of 133Ba tracer is used to assess the radium chemical recovery. The 224Ra, 226Ra, and 228Ra activities in the sample are measured through their gamma-ray-emitting decay products, 212Pb, 214Pb/214Bi, and 228Ac, respectively. In cases where 224Ra determination is required, the gamma-ray counting should be performed within 2-4 d from sample collection. To measure 226Ra activity in the sample, the gamma-ray spectroscopy can be repeated 21 d after sample preparation to ensure that 226Ra and its progeny have reached the equilibrium state. At this point, the 228Ac equilibration with parent 228Ra is already established. Analysis of aliquots of de-ionized water spiked with NIST-traceable 230Th, 224Ra, 226Ra, and 228Ra standards demonstrated the accuracy and precision of this method. Various performance evaluation samples were also assayed for gross alpha as well as radium isotope activity determination using this procedure and the

  5. Raúl Pepe Verano Montesinos

    Directory of Open Access Journals (Sweden)

    José Luis Luque

    2013-05-01

    Full Text Available El 31 de enero de 2005 falleció en Lima el doctor Raúl Verano. Nacido el 12 de julio de 1940 en Cajatambo, realizó sus estudios superiores en la Universidad Nacional Mayor de San Marcos, graduándose en 1971 de bachiller en Educación y en 1972 obtuvo el grado de bachiller en Biología con la tesis Foraminíferos del litoral del departamento de Lima; optando la profesión de Biólogo en 1973. Empezó sus actividades docentes en 1965 como Ayudante de Prácticas en las cá- tedras de zoología y desde 1971 fue Jefe de Prácticas. Ascendiendo a Auxiliar en 1974, para luego ocupar diversos cargos en la administración universitaria, siendo los más destacados el de Director del Instituto de Investigaciones Antonio Raimondi entre 1981 y 1985 y Decano de la Facultad de Ciencias Biológicas de la Universidad Nacional Mayor de San Marcos en el período 1988 a 1991. Sus actividades de investigación estuvieron alrededor de la ictioparasitología, obteniendo el grado de Doctor en Ciencias Biológicas en 1987 con la tesis Kudoa peruviana Mateo, 1972, redescripción y ultraestructura; Kudoa sarmientae sp. n y Kudoa estela sp. n en peces de la costa peruana

  6. Rheumatoid Arthritis (RA) associated interstitial lung disease (ILD).

    LENUS (Irish Health Repository)

    O'Dwyer, David N

    2013-10-01

    Rheumatoid Arthritis (RA) is the most common Connective Tissue Disease (CTD) and represents an increasing burden on global health resources. Interstitial lung disease (ILD) has been recognised as a complication of RA but its potential for mortality and morbidity has arguably been under appreciated for decades. New studies have underscored a significant lifetime risk of ILD development in RA. Contemporary work has identified an increased risk of mortality associated with the Usual Interstitial Pneumonia (UIP) pattern which shares similarity with the most devastating of the interstitial pulmonary diseases, namely Idiopathic Pulmonary Fibrosis (IPF). In this paper, we discuss recent studies highlighting the associated increase in mortality in RA-UIP. We explore associations between radiological and histopathological features of RA-ILD and the prognostic implications of same. We emphasise the need for translational research in this area given the growing burden of RA-ILD. We highlight the importance of the respiratory physician as a key stakeholder in the multidisciplinary management of this disorder. RA-ILD focused research offers the opportunity to identify early asymptomatic disease and define the natural history of this extra articular manifestation. This may provide a unique opportunity to define key regulatory fibrotic events driving progressive disease. We also discuss some of the more challenging and novel aspects of therapy for RA-ILD.

  7. Gene expression analysis in RA: towards personalized medicine

    NARCIS (Netherlands)

    Burska, A.N.; Roget, K.; Blits, M.; Gomez, L.; Loo, F.A.J. van de; Hazelwood, L.D.; Verweij, C.L.; Rowe, A.; Goulielmos, G.N.; Baarsen, L.G. van; Ponchel, F.

    2014-01-01

    Gene expression has recently been at the forefront of advance in personalized medicine, notably in the field of cancer and transplantation, providing a rational for a similar approach in rheumatoid arthritis (RA). RA is a prototypic inflammatory autoimmune disease with a poorly understood etiopathog

  8. RA – beskeden genetisk disposition - resultater fra nyt dansk tvillingstudie

    DEFF Research Database (Denmark)

    Svendsen, Anders Jørgen

    2010-01-01

    Vi har nu indsamlet data fra en velkarakteriseret kohorte af danske tvillinger med RA, og med den tilhørende biobank-data åbner det mulighed for videre forskning i både genetiske, epigenetiske og miljømæssige forholds betydning for udvikling af RA. De første resultater fra denne udvidede danske u...

  9. 226Ra determination in phosphogypsum by alpha-particle spectrometry

    Science.gov (United States)

    Aguado, J. L.; Bolívar, J. P.; García-Tenorio, R.

    1999-01-01

    A radiochemical method for226Ra determination by alpha-particle spectrometry in environmental samples has been developed in our laboratory. The method has been validated by measurements in samples with known concentrations of this radionuclide and it has been applied in studies related to226Ra behaviour in phosphogypsum (the main by-product of producing phosphoric acid from phosphate rocks).

  10. Study on Clinical Significance and Detection of 56 Cases of RA Patients with Anti CCP Antibody, RF, CRP, ESR and C3, C4%56例RA患者抗CCP抗体、RF、CRP、血沉及C3、C4的检测与临床意义探讨

    Institute of Scientific and Technical Information of China (English)

    马建国; 茆春红; 赵兴国

    2013-01-01

    目的:探讨抗-CCP抗体、RF、CRP、血沉及C3、C4在RA的早期诊断中作用。方法对56例RA患者,47例非RA患者用ELISA法检测抗CCP抗体,免疫比浊法检测RF、CRP及C3、C4,手工法检测血沉,并与45例健康对照组作比较。结果RA组的抗CCP抗体、RF、CRP高于非RA组,两者之间存在差异,但RA组与非RA组之间的血沉阳性率无显著性差异;RA组、非RA组及健康对照组之间C3、C4的结果无显著性差异。结论在RA的早期诊断中,抗-CCP抗体的特异性明显高于RF;抗CCP抗体与RF的联合检测,可以弥补RF的特异性低的缺点,减少假阳性率。%Objective To explore the diagnostic value of anti-CCP、RF、CRP、ESR and C3、C4 in the early diagnosis of RA. Methods In 56 cases of RA patients, 47 cases of non RA patients ,ELISA was used to detect with anti -CCP antibody, immune turbidimetric assay for detection of RF、CRP and C3、C4, manual method detection for ESR, and compared with 45 controls.Results The anti-CCP、RF、 CRP in RA group was signiifcantly higher than that of non RA group,but there was no signiifcant difference in positive rate of ESR betweenthem;There was no signiifcant difference between RA group, non RA group and controls in C3, C4 results. Conclusions In the early diagnosis of RA, anti -CCP antibody was signiifcantly higher than that in RF;The combined detection ofanti-CCP antibody and RF, can make up for low speciifcity of RF.

  11. Radium Ra 223 dichloride in castration-resistant prostate cancer.

    Science.gov (United States)

    Joung, J Y; Ha, Y S; Kim, I Y

    2013-08-01

    Radium Ra 223 dichloride (Xofigo®, formerly Alpharadin) is one of the representative α-particle-emitting isotopes that delivers radiation with a higher biological effect to a more localized area. Preclinical studies in mouse, rat and canine models have demonstrated that radium Ra 223 dichloride has a definite skeletal affinity and antitumor effect with a relatively low toxicity on bone marrow. More recently, in a large randomized phase III trial (ALSYMPCA), patients with bone metastasis and castration-resistant prostate cancer (CRPC) received six cycles of 50 kBq/kg of radium Ra 223 dichloride in 4-week intervals. In these men, radium Ra 223 dichloride improved the median overall survival by 3.6 months when compared to the placebo group. Collectively, these results suggest that radium Ra 223 dichloride is a promising candidate for managing bone metastases in patients with CRPC. Copyright 2013 Prous Science, S.A.U. or its licensors. All rights reserved.

  12. Recovery of Ra-223 from natural thorium irradiated by protons

    Energy Technology Data Exchange (ETDEWEB)

    Vasiliev, Aleksandr N.; Ostapenko, Valentina S. [Lomonosov Moscow State Univ. (Russian Federation); Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Lapshina, Elena V.; Ermolaev, Stanislav V.; Zhuikov, Boris L. [Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Danilov, Sergey S. [Lomonosov Moscow State Univ. (Russian Federation); Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation); National Research Center ' Kurchatov Institute' (NRC ' Kurchatov Institute' ), Moscow (Russian Federation)

    2016-11-01

    Irradiation of natural thorium with medium-energy protons is considered to be a prospective approach to large-scale production of {sup 225}Ac and {sup 223}Ra. In addition to the earlier-developed method of {sup 225}Ac isolation, the present work focuses on the simultaneous recovery of {sup 223}Ra from the same thorium target. Radiochemical procedure is based on liquid-liquid extraction, cation exchange and extraction chromatography. The procedure provides separation of radium from spallation and fission products generated in the thorium target. High chemical yield (85-90%) and radionuclide purity of {sup 223}Ra (> 99.8% except {sup 224}Ra and {sup 225}Ra isotopes) have been achieved.

  13. Geochemical Speciation of Soil 7Be,137Cs,226Ra and 228Ra as Tracers to Particle Trnsport

    Institute of Scientific and Technical Information of China (English)

    BALZHANGUO; WANGUOJIANG; 等

    1997-01-01

    A brunisolic soil collected from an erosive forest land(HF-1-1) and a yellow soil from and accumulative shallow basin(HF-6-1) in the watershed of Lake Hongfeng (HF) were used for activity measurements of 7Be,137Cs,226Ra and 228Ra in different geochemical speciation.More than 85% of 7Be,137Cs,226Ra and 228Ra in the soils were bound to organic Fe-Mn oxy-hydroxide and residual fractions.They could move with soil particlesw and be used as tracers for the erosion and /or accumulation of soil particles.7Be gohemical specition in the soils agreed with its trace for seasonal particle transport.137Cs geohemial speciaiton was suitable for tracing soil particle accumulation and for sediment aating.226Ra and 228Ra were ombined in crystalline skeleton of clay minerals and mainly remained as residues in the soils and little was bound to the soluble,exchangeable and carbonate fractions.The differentiation of 226 Ra/228Ra activity ratios in different geoheical fractions in the soils could be used as a parameter to trace accumulation and /or erosion of soil particles.

  14. DISTRIBUITION OF 226Ra AND 228Ra IN UNDERGROUND WATER INTO THE SOUTH REGION OF SAO PAULO STATE

    Directory of Open Access Journals (Sweden)

    CARVALHO DE JESUS, Sueli; CHIRINOS, Hugo;

    2011-08-01

    Full Text Available Monitor of natural radionuclides in aquatic raw is very important to guaranty the normal control level inthe environmental medium and the human. In this report were available the concentration of 226Ra and 228Ra inCananeia’s underground water, Iguape and Comprida Island into the south region of Sao Paulo state, by grossalpha and beta counting method. The concentration of 226Ra was variety into the interval 0.80 to 23 mBqL-1 inApril/2009 (rain period and into the interval 0.63 to 12 mBqL -1in August/2009 (dried period. The concentrationof 228Ra was variety into the interval 18 to 39 mBqL-1 in April/2009 and into the interval 15 to 72 mBqL-1 inAugust/2009. The Activities ratio of 228Ra/226Ra was variety into the interval 3.3 to 31.7 at rain period and 1.1 to26.7 at dried period. To compare the yield values of 226Ra and 228Ra these show high activity of the 228Raisotope. The calculate dose no arising the reference of effective dose level available by WHO.

  15. Study of 223Ra uptake mechanism by Fe3O4 nanoparticles: towards new prospective theranostic SPIONs

    Science.gov (United States)

    Mokhodoeva, Olga; Vlk, Martin; Málková, Eva; Kukleva, Ekaterina; Mičolová, Petra; Štamberg, Karel; Šlouf, Miroslav; Dzhenloda, Rustam; Kozempel, Ján

    2016-10-01

    The use of superparamagnetic iron oxide nanoparticles ( SPIONs) and radiolabelled nanoparticles ( NPs) has grown considerably over the recent years, and the SPIONs labelled with medicinal radionuclides offer new opportunities in multimodal diagnostics and in the drug-delivery systems for targeted alpha-particle therapy (TAT) driven by magnetic field gradient or by biologically active moieties bound on NPs shell. However, the mechanisms of NPs radiolabelling are not studied substantially and still remain unclear, even though the way of label attachment directly implies the stability of the label-nanoparticle construct. Since the 223Ra was the first clinically approved alpha-emitter, it is a promising nuclide for further development of its targeted carriers. We report here on the study of 223Ra uptake by the Fe3O4 SPIONs, together with an attempt to propose the 223Ra uptake mechanism by the Fe3O4 NPs in the presence of a phosphate buffer a typical formulation medium, under the pseudo-equilibrium conditions. Further, the in vitro stability tests of the prepared [223Ra]Fe3O4 NPs were performed to estimate the 223Ra label stability. The potential use of 223Ra-labelled SPIONs in theranostic applications is also discussed.

  16. Ra: The Sun for Science and Humanity

    Science.gov (United States)

    1996-01-01

    To guide the development of the Ra Strategic Framework, we defined scientific and applications objectives. For our primary areas of scientific interest, we choose the corona, the solar wind, the Sun's effect on the Earth, and solar theory and model development. For secondary areas of scientific interest, we selected sunspots, the solar constant, the Sun's gravitational field, helioseismology and the galactic cosmic rays. We stress the importance of stereoscopic imaging, observations at high spatial, spectral, and temporal resolutions, as well as of long duration measurements. Further exploration of the Sun's polar regions is also important, as shown already by the Ulysses mission. From an applications perspective, we adopted three broad objectives that would derive complementary inputs for the Strategic Framework. These were to identify and investigate: possible application spin-offs from science missions, possible solar-terrestrial missions dedicated to a particular application, and possible future applications that require technology development. The Sun can be viewed as both a source of resources and of threats. Our principal applications focus was that of threat mitigation, by examining ways to improve solar threat monitoring and early warning systems. We compared these objectives to the mission objectives of past, current, and planned international solar missions. Past missions (1962-1980) seem to have been focused on improvement of scientific knowledge, using multiple instrument spacecraft. A ten year gap followed this period, during which the results from previous missions were analyzed and solar study programmes were prepared in international organizations. Current missions (1990-1996) focus on particular topics such as the corona, solar flares, and coronal mass ejections. In planned missions, Sun/Earth interactions and environmental effects of solar activity are becoming more important. The corona is the centre of interest of almost all planned missions

  17. Leaching of 226Ra from components of uranium mill tailings

    Science.gov (United States)

    Landa, E.R.

    1991-01-01

    A sequential extraction procedure was used to characterize the geochemical forms of 226Ra retained by mixtures of quartz sand and a variety of fine-grained rock and mineral species. These mixtures had previously been exposed to the sulfuric acid milling liquor of a simulated acid-leach uranium milling circuit. For most test cases, the major fraction of the 226Ra was extracted with 1 mol/1 NH4Cl and was deemed to be exchangeable. However, 226Ra retained by the barite-containing mixture was resistant to both 1 mol/1 NH4Cl and 1 mol/HCHCl extraction. ?? 1991.

  18. Pulmonary cryptococcosis in rheumatoid arthritis (RA) patients: Comparison of imaging characteristics among RA, acquired immunodeficiency syndrome, and immunocompetent patients

    Energy Technology Data Exchange (ETDEWEB)

    Yanagawa, Noriyo, E-mail: noriyo_yana@ybb.ne.jp [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama Medical University International Medical Center, 1397-1 Yamane, Hidaka-shi, Saitama 350-1298 (Japan); Takemura, Tamiko [Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-ku, Tokyo 150-8935 (Japan); Ishikawa, Satoru [Department of Respiratory Medicine, National Hospital Organization Chiba-East-Hospital, 673 Nitona-cho, Chuo-ku, Chiba-shi, Chiba 260-8712 (Japan); Takaki, Yasunobu [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Hishima, Tsunekazu [Department of Pathology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Kamata, Noriko [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan)

    2013-11-01

    Purpose: The imaging characteristics of cryptococcosis in rheumatoid arthritis (RA) patients were analyzed by comparing them with those of acquired immunodeficiency syndrome (AIDS) and immunocompetent patients, and the imaging findings were correlated with pathological findings. Methods: Two radiologists retrospectively compared the computed tomographic (CT) findings of 35 episodes of pulmonary cryptococcosis in 31 patients with 3 kinds of underlying states (10 RA, 12 AIDS, 13 immunocompetent), focusing on the nature, number, and distribution of lesions. The pathological findings of 18 patients (8 RA, 2 AIDS, 8 immunocompetent) were analyzed by two pathologists, and then correlated with imaging findings. Results: The frequencies of consolidation and ground glass attenuation (GGA) were significantly higher, and the frequency of peripheral distribution was significantly lower in the RA group than in the immunocompetent group. Peripheral distribution was less common and generalized distribution was more frequent in the RA group than in the AIDS group. The pathological findings of the AIDS and immunocompetent groups reflected their immune status: There was lack of a granuloma reaction in the AIDS group, and a complete granuloma reaction in the immunocompetent group, while the findings of the RA group varied, including a complete granuloma reaction, a loose granuloma reaction and a hyper-immune reaction. Cases with the last two pathologic findings were symptomatic and showed generalized or central distribution on CT. Conclusion: Cryptococcosis in the RA group showed characteristic radiological and pathological findings compared with the other 2 groups.

  19. Identifying Preliminary Domains to Detect and Measure Rheumatoid Arthritis Flares: Report of the OMERACT 10 RA Flare Workshop

    DEFF Research Database (Denmark)

    Bingham, Clifton O; Alten, Rieke; Bartlett, Susan J

    2011-01-01

    Background. While disease flares in rheumatoid arthritis (RA) are a recognized aspect of the disease process, there is limited formative research to describe them. METHODS: The Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group is conducting an internatio......Background. While disease flares in rheumatoid arthritis (RA) are a recognized aspect of the disease process, there is limited formative research to describe them. METHODS: The Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group is conducting...... an international research project to understand the specific characteristics and impact of episodic disease worsening, or "flare," so that outcome measures can be developed or modified to reflect this uncommonly measured, but very real and sometimes disabling RA disease feature. Patient research partners provided...... was identified as a component of the research agenda needed to establish criterion validity for a flare definition; this can be used in prospective studies to further evaluate the Discrimination and Feasibility components of the OMERACT filter for a flare outcome measure. CONCLUSION: Our work to date has...

  20. Seasonal changes in submarine groundwater discharge to coastal salt ponds estimated using 226Ra and 228Ra as tracers

    Science.gov (United States)

    Hougham, A.L.; Moran, S.B.; Masterson, J.P.; Kelly, R.P.

    2008-01-01

    Submarine groundwater discharge (SGD) to coastal southern Rhode Island was estimated from measurements of the naturally-occurring radioisotopes 226Ra (t1/2 = 1600??y) and 228Ra (t1/2 = 5.75??y). Surface water and porewater samples were collected quarterly in Winnapaug, Quonochontaug, Ninigret, Green Hill, and Pt. Judith-Potter Ponds, as well as nearly monthly in the surface water of Rhode Island Sound, from January 2002 to August 2003; additional porewater samples were collected in August 2005. Surface water activities ranged from 12-83??dpm 100??L- 1 (60??dpm = 1??Bq) and 21-256??dpm 100??L- 1 for 226Ra and 228Ra, respectively. Porewater 226Ra activities ranged from 16-736??dpm 100??L- 1 (2002-2003) and 95-815??dpm 100??L- 1 (2005), while porewater 228Ra activities ranged from 23-1265??dpm 100??L- 1. Combining these data with a simple box model provided average 226Ra-based submarine groundwater fluxes ranging from 11-159??L m- 2 d- 1 and average 228Ra-derived fluxes of 15-259??L m- 2 d- 1. Seasonal changes in Ra-derived SGD were apparent in all ponds as well as between ponds, with SGD values of 30-472??L m- 2 d- 1 (Winnapaug Pond), 6-20??L m- 2 d- 1 (Quonochontaug Pond), 36-273??L m- 2 d- 1 (Ninigret Pond), 29-76??L m- 2 d- 1 (Green Hill Pond), and 19-83??L m- 2 d- 1 (Pt. Judith-Potter Pond). These Ra-derived fluxes are up to two orders of magnitude higher than results predicted by a numerical model of groundwater flow, estimates of aquifer recharge for the study period, and values published in previous Ra-based SGD studies in Rhode Island. This disparity may result from differences in the type of flow (recirculated seawater versus fresh groundwater) determined using each technique, as well as variability in porewater Ra activity. ?? 2007 Elsevier B.V. All rights reserved.

  1. Giver lave Ra-værdier bedre hygiejne?

    DEFF Research Database (Denmark)

    Gram, Lone; Bagge-Ravn, Dorthe; Kold, John;

    2004-01-01

    Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm.......Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm....

  2. Tehnikaromud saab peagi tasuta ära anda / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas

    2005-01-01

    13. augustist saab vana elektroonikat tasuta ära anda. MTÜ Eesti Elektroonikaromu on juba loonud selleks üle Eesti 44 kogumispunkti, EES-Ringlus ühingus endale konkurenti ei näe. Lisa: Vana tehnika

  3. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  4. Giver lave Ra-værdier bedre hygiejne?

    DEFF Research Database (Denmark)

    Gram, Lone; Bagge-Ravn, Dorthe; Kold, John

    2004-01-01

    Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm.......Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm....

  5. Tehnikaromud saab peagi tasuta ära anda / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas

    2005-01-01

    13. augustist saab vana elektroonikat tasuta ära anda. MTÜ Eesti Elektroonikaromu on juba loonud selleks üle Eesti 44 kogumispunkti, EES-Ringlus ühingus endale konkurenti ei näe. Lisa: Vana tehnika

  6. An early "Atkins' Diet": RA Fisher analyses a medical "experiment".

    Science.gov (United States)

    Senn, Stephen

    2006-04-01

    A study on vitamin absorption which RA Fisher analysed for WRG Atkins and co-authored with him is critically examined. The historical background as well as correspondence between Atkins and Fisher is presented.

  7. Research of RA Coding Algorithm Based on AWGN Channel

    Directory of Open Access Journals (Sweden)

    Xianzhong Chen

    2012-04-01

    Full Text Available In order to study the performance of RA, and the impacts of iterations and code length to the compiled code characteristics, we respectively made simulation analysis on RA, LDPC and TURBO with different parameters. We did it by designing code length, rate and iterations to analyze signals to noise ratio changes. With three patterns comparing the simulation analysis, it turned out that volume reaches the limit of Shannon when RA is in the condition of maximum likelihood decoding. The bit error ratio reduces as the message length goes up, and the performance comes near channel capacity. As the iterations increase, and bit error ratio reduces, and the performance will be better. Research shows that RA has more advantages and wide application propects whether in complexity or in performance.

  8. O pensamento desenvolvimentista de Raúl Prebisch Raúl Prebisch's thought on development

    Directory of Open Access Journals (Sweden)

    Joaquim Miguel Couto

    2007-04-01

    Full Text Available As idéias do economista argentino Raúl Prebisch (1901-1986 sempre estiveram voltadas para a ação. As dificuldades encontradas diante de problemas concretos (durante a crise dos anos 1930, tornaram Prebisch um homem prático. Assim, suas teorias sobre a substituição de importações, o sistema centro-periferia e a criação de um mercado comum latino-americano, possuíam um grande sentido de influenciar a realidade. A única exceção coube a sua "Teoria da Transformação", construída no último decênio de sua vida. Nesta, Prebisch se afasta da realidade e teoriza sobre a criação de um novo sistema econômico, através de uma síntese entre socialismo e liberalismo.The Argentinean economist Raúl Prebisch’s (1901-1986 ideas were always gone back to the action. Difficulties facing concrete problems made him a pragmatic man. Thus, his theories about import substitution, core-periphery system and the creation of a common Latin-American market, were embodied in a great purpose of influencing the reality. The only exception was the "Theory of Transformation", which was built in the last decade of this life. There, Prebisch moves off practical matters and speculates about the creation of a new economic system, through a synthesis of socialism and liberalism.

  9. Pharmacologic and economic differentiation of drugs for RA in Italy

    Directory of Open Access Journals (Sweden)

    Patrizia Berto

    2012-07-01

    Full Text Available Rheumatoid arthritis (RA is a chronic, progressive and degenerative illness, which affects about 0.5% of the adult population with significant social costs. In Italy there are approximately 300,000 people with RA, with twice as many women than men. RA causes progressive deformity and disability and is associated with numerous co-morbid conditions that reduce the life expectancy of 5-10 years. The costs of RA have a serious impact on the entire community, especially in terms of disability, hospitalization and medical care. In Italy has been estimated that cost of illness could reach about 1,600 million euros, of which over two thirds are represented by indirect costs. The treatment of RA is evolving and the introduction of biological drugs has resulted in a significant progress in terms of therapeutic possibilities. Etanercept, the only soluble receptor of TNF-alfa currently approved appears to be cost-effective and it is recommended by major guidelines for the treatment of RA.  http://dx.doi.org/10.7175/rhc.v3i3.201

  10. Fever without apparent source on clinical examination, infectious diseases, and lower respiratory infections in children.

    Science.gov (United States)

    McCarthy, P L; Kahn, J S; Shapiro, E; Klig, J

    1998-02-01

    This section focuses on issues in infectious diseases that are commonly encountered in pediatric office practice. Paul McCarthy discusses recent literature regarding the evaluation and management of acute fevers without apparent source on clinical examination in infants and children, and the evaluation of children with prolonged fevers of unknown origin. Jean Klig reviews recent literature about lower respiratory tract infection in children. Jeffrey Kahn and Eugene Shapiro discuss recent developments in pediatric infectious diseases concerning neonatal herpes infections, poliovirus immunization schedule, and group B streptococcus screening and treatment.

  11. Disparities in rheumatoid arthritis disease activity according to gross domestic product in 25 countries in the QUEST–RA database

    Science.gov (United States)

    Sokka, T; Kautiainen, H; Pincus, T; Toloza, S; da Rocha Castelar Pinheiro, G; Lazovskis, J; Hetland, M L; Peets, T; Immonen, K; Maillefert, J F; Drosos, A A; Alten, R; Pohl, C; Rojkovich, B; Bresnihan, B; Minnock, P; Cazzato, M; Bombardieri, S; Rexhepi, S; Rexhepi, M; Andersone, D; Stropuviene, S; Huisman, M; Sierakowski, S; Karateev, D; Skakic, V; Naranjo, A; Baecklund, E; Henrohn, D; Gogus, F; Badsha, H; Mofti, A; Taylor, P; McClinton, C; Yazici, Y

    2009-01-01

    Objective: To analyse associations between the clinical status of patients with rheumatoid arthritis (RA) and the gross domestic product (GDP) of their resident country. Methods: The Quantitative Standard Monitoring of Patients with Rheumatoid Arthritis (QUEST–RA) cohort includes clinical and questionnaire data from 6004 patients who were seen in usual care at 70 rheumatology clinics in 25 countries as of April 2008, including 18 European countries. Demographic variables, clinical characteristics, RA disease activity measures, including the disease activity score in 28 joints (DAS28), and treatment-related variables were analysed according to GDP per capita, including 14 “high GDP” countries with GDP per capita greater than US$24 000 and 11 “low GDP” countries with GDP per capita less than US$11 000. Results: Disease activity DAS28 ranged between 3.1 and 6.0 among the 25 countries and was significantly associated with GDP (r  =  −0.78, 95% CI −0.56 to −0.90, r2  =  61%). Disease activity levels differed substantially between “high GDP” and “low GDP” countries at much greater levels than according to whether patients were currently taking or not taking methotrexate, prednisone and/or biological agents. Conclusions: The clinical status of patients with RA was correlated significantly with GDP among 25 mostly European countries according to all disease measures, associated only modestly with the current use of antirheumatic medications. The burden of arthritis appears substantially greater in “low GDP” than in “high GDP” countries. These findings may alert healthcare professionals and designers of health policy towards improving the clinical status of patients with RA in all countries. PMID:19643759

  12. Investigation of $\\alpha$-decay rates of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in different environments

    CERN Multimedia

    2007-01-01

    It has recently been suggested, and indicated experimentally, that $\\alpha$- decay half-lives are modified by solid state effects in the surrounding environment. We propose here to measure with high accuracy the $\\alpha$-decay half-life of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in insulators and metals. Furthermore we plan to investigate the temperature dependency of the half-life in these materials (room temperature, 4 K and 10 mK).

  13. Clinical features of rheumatoid arthritis-associated interstitial lung disease.

    Science.gov (United States)

    Wang, Ting; Zheng, Xing-Ju; Liang, Bin-Miao; Liang, Zong-An

    2015-10-07

    Interstitial lung disease (ILD) is the most common extra-articular manifestations of rheumatoid arthritis (RA) in the lung. This study aimed to identify clinical features of RA-associated ILD (RA-ILD). Patients with RA were retrospectively enrolled and sub-classified as RA-ILD or RA without ILD based on high-resolution computed tomography imaging. Pulmonary function testing parameters and levels of RA-related biomarkers, tumour markers, and acute-phase proteins were compared between the two groups. Logistic regression model was used to assess the strength of association between RA-ILD and clinical features of interest. Receiver operating characteristic analysis was performed to assess potential predictive value of clinical features for detecting RA-ILD. Comparison analysis indicated that the percentage of predicted value of total lung capacity, inspiratory capacity, and diffusion capacity of the lung for carbon monoxide (DLCO) were reduced in patients with RA-ILD. Tumour markers CA15-3 and CA125 were increased in patients with RA-ILD. Logistic regression analysis revealed that decreased DLCO was related to the increased likelihood of RA-ILD (OR = 0.94, 95%CI = [0.91, 0.98]). The cut-off point at 52.95 percent of predicted value could sensitively discriminate RA patients with or without ILD. Our study suggested that DLCO value could be a useful tool for detecting ILD in patients with RA.

  14. Association of IL-1ra and adiponectin with C-peptide and remission in patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Pfleger, C.; Hansen, L.; Herder, C.

    2008-01-01

    OBJECTIVE: We investigated the association of anti-inflammatory cytokine interleukin (IL)-1 receptor antagonist (IL-1ra), adiponectin, proinflammatory cytokines IL-1 beta, IL-6, and CCL2, and tumor necrosis factor-alpha with beta-cell function, metabolic status, and clinical remission in patients...... with recent-onset type 1 diabetes. RESEARCH DESIGN AND METHODS: Serum was obtained from 256 newly diagnosed patients (122 males and 134 females, median age 9.6 years). Stimulated C-peptide, blood glucose, and A1C were determined in addition to circulating concentration of cytokines at 1, 6, and 12 months...... after diagnosis. Analyses were adjusted for sex, age, and BMI percentile. RESULTS: Anti-inflammatory IL-1ra was positively associated with C-peptide after 6 (P = 0.0009) and 12 (P = 0.009) months. The beneficial association of IL-1ra on beta-cell function was complemented by the negative association...

  15. Ra-226 and Ra-226/Ba Signatures of Intermediate and Deep Water Masses of the Labrador Sea

    Science.gov (United States)

    Pons-Branchu, E.; Hillaire-Marcel, C.; Ghaleb, B.

    2004-05-01

    The Labrador sea plays an important role in the formation of intermediate North Atlantic water, (cf. Labrador Sea Water -LSW) and subsequently, in the general thermohaline circulation of the ocean. In addition, water masses originating from the Norwegian and Greenland seas are present below the LSW, in the deeper part of the basin. Investigations on the geochemistry of radium have been undertaken as a mean to document these deep and intermediate circulation processes. The vertical distribution of Ra-226 and Ba contents has been established for 8 stations located along 2 sections from 48°44 N; 52°58W to 52°23 N 45°17W and from 53.59°N to 60.34°N, 48.13°W. Thermo-Ionization Mass Spectrometry coupled with a new radium extraction and purification technique permitted the measurement of Ra-226 using 200 ml samples (i.e., appr. 10 femtograms of Ra). In parallel, Ba contents were determined using M-C-ICP-MS in order to normalize Ra-226 concentrations, since Ba is often seen as a subrogate stable isotope of Ra, due to their almost similar geochemical behaviour. Large variations in Ra-226 concentrations are observed. They range from 51 fg/g in intermediate and deep water samples to 31 fg/g in surface waters. When normalised to a salinity of 35 or to the Ba contents large discrepancies are still observed. They suggest a specific Ra-signature for each of the major water masses present in the basin. Particular attention has been paid to Ra-226 contents in the LSW in relation to its production rate as well as to the influence of the Western Boundary Under Current (WBUC), which carries the North Atlantic Deep water masses into their gyre along the lower slopes of the Labrador sea. Based on the presently available data set, a peak in Ra-226 and Ba contents seems to characterise the high velocity axis of the WBUC. These data suggest moreover a lower Ra-226 content for the LSW than for the deeper water masses.

  16. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12. Each unit contains teacher…

  17. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12.…

  18. Rapid determination of 226Ra in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod L.; Culligan, Brian K.

    2012-02-04

    A new rapid method for the determination of {sup 228}Ra in natural water samples has been developed at the SRNL/EBL (Savannah River National Lab/ Environmental Bioassay Laboratory) that can be used for emergency response or routine samples. While gamma spectrometry can be employed with sufficient detection limits to determine {sup 228}Ra in solid samples (via {sup 228}Ac) , radiochemical methods that employ gas flow proportional counting techniques typically provide lower MDA (Minimal Detectable Activity) levels for the determination of {sup 228}Ra in water samples. Most radiochemical methods for {sup 228}Ra collect and purify {sup 228}Ra and allow for {sup 228}Ac daughter ingrowth for ~36 hours. In this new SRNL/EBL approach, {sup 228}Ac is collected and purified from the water sample without waiting to eliminate this delay. The sample preparation requires only about 4 hours so that {sup 228}Ra assay results on water samples can be achieved in < 6 hours. The method uses a rapid calcium carbonate precipitation enhanced with a small amount of phosphate added to enhance chemical yields (typically >90%), followed by rapid cation exchange removal of calcium. Lead, bismuth, uranium, thorium and protactinium isotopes are also removed by the cation exchange separation. {sup 228}Ac is eluted from the cation resin directly onto a DGA Resin cartridge attached to the bottom of the cation column to purify {sup 228}Ac. DGA Resin also removes lead and bismuth isotopes, along with Sr isotopes and {sup 90}Y. La is used to determine {sup 228}Ac chemical yield via ICP-MS, but {sup 133}Ba can also be used instead if ICP-MS assay is not available. Unlike some older methods, no lead or strontium holdback carriers or continual readjustment of sample pH is required.

  19. Eesti mees - arhitekt Louis Kahn / Toivo Tammik

    Index Scriptorium Estoniae

    Tammik, Toivo

    2006-01-01

    1901. aastal Saaremaal sündinud mehest, kelle elutee viis USA-sse ja koostöös eestlase August Komendantiga valmisid suurepärased projektid. Eestis, Saaremaal, valmistutakse Louis Kahni päevadeks 2006. aasta oktoobris

  20. Louis Kahn. Ajaloost ajatust otsides / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2006-01-01

    6.-7. okt. 2006. a. toimuvad Kuressaares esimesed Kahni päevad. Eestist pärit ameerika arhitekti Louis Isadore Kahni (1901-1974) eluloolisi andmeid ja loomingust. Kommenteerivad Mart Kalm, Raine Karp, Veljo Kaasik, Toivo Tammik

  1. Louis Kahn. Ajaloost ajatust otsides / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2006-01-01

    6.-7. okt. 2006. a. toimuvad Kuressaares esimesed Kahni päevad. Eestist pärit ameerika arhitekti Louis Isadore Kahni (1901-1974) eluloolisi andmeid ja loomingust. Kommenteerivad Mart Kalm, Raine Karp, Veljo Kaasik, Toivo Tammik

  2. Eesti mees - arhitekt Louis Kahn / Toivo Tammik

    Index Scriptorium Estoniae

    Tammik, Toivo

    2006-01-01

    1901. aastal Saaremaal sündinud mehest, kelle elutee viis USA-sse ja koostöös eestlase August Komendantiga valmisid suurepärased projektid. Eestis, Saaremaal, valmistutakse Louis Kahni päevadeks 2006. aasta oktoobris

  3. Process waste assessment: Color print processing (RA-4)

    Energy Technology Data Exchange (ETDEWEB)

    Catlett, P.

    1994-05-01

    The Kodak RA-4 process is used to develop prints and overhead transparencies from photographic negatives. The assessment was based on usage, effluent discharge, and final disposition of waste generated by the process. Two options explored were bleach-fix regeneration and the conversion to a digital image processing system. The RA-4 process is process is environmentally sound and generates a relatively small amount of waste. The bleach-fix option would provide only a small effluent reduction. The digital imaging conversion option, if fully implemented, could greatly reduce waste generated in the photo lab.

  4. RAPID DETERMINATION OF RA-226 IN ENVIRONMENTAL SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.

    2012-01-03

    A new rapid method for the determination of {sup 226}Ra in environmental samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for emergency response or routine sample analyses. The need for rapid analyses in the event of a Radiological Dispersive Device or Improvised Nuclear Device event is well-known. In addition, the recent accident at Fukushima Nuclear Power Plant in March, 2011 reinforces the need to have rapid analyses for radionuclides in environmental samples in the event of a nuclear accident. {sup 226}Ra (T1/2 = 1,620 years) is one of the most toxic of the long-lived alpha-emitters present in the environment due to its long life and its tendency to concentrate in bones, which increases the internal radiation dose of individuals. The new method to determine {sup 226}Ra in environmental samples utilizes a rapid sodium hydroxide fusion method for solid samples, calcium carbonate precipitation to preconcentrate Ra, and rapid column separation steps to remove interferences. The column separation process uses cation exchange resin to remove large amounts of calcium, Sr Resin to remove barium and Ln Resin as a final purification step to remove {sup 225}Ac and potential interferences. The purified {sup 226}Ra sample test sources are prepared using barium sulfate microprecipitation in the presence of isopropanol for counting by alpha spectrometry. The method showed good chemical recoveries and effective removal of interferences. The determination of {sup 226}Ra in environmental samples can be performed in less than 16 h for vegetation, concrete, brick, soil, and air filter samples with excellent quality for emergency or routine analyses. The sample preparation work takes less than 6 h. {sup 225}Ra (T1/2 = 14.9 day) tracer is used and the {sup 225}Ra progeny {sup 217}At is used to determine chemical yield via alpha spectrometry. The rapid fusion technique is a rugged sample digestion method that ensures that any

  5. Multimodalinė transporto infrastruktūra turizmo paslaugoje

    OpenAIRE

    Simanavičius, Egidijus

    2013-01-01

    Darbo pavadinimas: Multimodalinė transporto infrastruktūra turizmo paslaugoje. Darbo tikslas: įvertinti multimodalinės transporto infrastruktūros turizmo paslaugoje situaciją. Darbo objektas: multimodalinė transporto infrastruktūra turizmo paslaugoje. Tyrimo uždaviniai: 1. Atskleisti multimodalinės transporto infrastruktūros turizmo paslaugoje esmę; 2. Pristatyti Lietuvos transporto infrastruktūros turizmo paslaugoje situaciją; 3. Ištirti multimodalinę infrastruktūrą geležin...

  6. Raça e lesão de órgãos-alvo da hipertensão arterial em pacientes atendidos em um ambulatório universitário de referência na cidade de Salvador Race and hypertensive target-organ damage in patients from an university-affiliated outpatient care referral clinic in the city of Salvador

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Beisl Noblat

    2004-02-01

    Full Text Available OBJETIVO: Avaliar se a raça do paciente estaria associada à presença de hipertrofia ventricular esquerda, acidente vascular cerebral e insuficiência renal crônica em hipertensos atendidos em ambulatório de referência em Salvador-BA. MÉTODOS: Analisados dados de 622 pacientes com o primeiro atendimento em ambulatório de hipertensão, entre 1982 e 1986, e identificados os com história prévia ou seqüela de acidente vascular cerebral, hipertrofia ventricular esquerda ou insuficiência renal (creatinina sérica > 1,4 mg/dL. Modelos de regressão logística foram utilizados para estimar odds ratio (OR da associação entre raça (mulatos ou negros vs brancos e lesão de órgãos-alvo de hipertensão, ajustadas para sexo e idade. RESULTADOS: A média de idade dos pacientes foi 53,8±14,3 anos, 74,1% mulheres. Quanto à raça, 15,1% eram brancos, 65,9% mulatos e 19,0% negros. Acidente vascular cerebral foi significantemente mais freqüente em negros ou mulatos do que em brancos (odds ratio ajustada (ORa=3,44; intervalo de confiança (IC 95%=1,23-9,67. Quanto às associações envolvendo raça com os eventos hipertrofia ventricular esquerda e insuficiência renal as ORa não foram estatisticamente significantes, mas foram consistentes com maior prevalência de hipertrofia ventricular esquerda e insuficiência renal em negros e mulatos. CONCLUSÃO: Negros e mulatos hipertensos têm maior risco de lesão de órgão alvo do que brancos, com diferença racial maior para acidente vascular cerebral não fatal. Deve ser avaliada se diferenças raciais em mortalidade relacionada a complicações da hipertensão influenciam as associações observadas entre raça e lesão de órgãos-alvo.OBJECTIVE: To assess whether a patient's race is associated with the presence of left ventricular hypertrophy, stroke, and renal failure in hypertensive patients from an outpatient care referral clinic in the city of Salvador in the state of Bahia. METHODS: We

  7. {sup 226}Ra, {sup 228}Ra and {sup 40}K in scales formed in boilers of industrial installations

    Energy Technology Data Exchange (ETDEWEB)

    Poggi, Claudia M. Braga; Farias, Emerson Emiliano G. de; Hazin, Clovis A., E-mail: hazin@cnen.gov.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear; Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Gazineu, Maria Helena P., E-mail: helena@unicap.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear; Universidade Catolica de Pernambuco (UNICAP), Recife, PE (Brazil). Centro de Ciencias e Tecnologia

    2011-07-01

    Many industrial processes involve the production of steam in boilers, which is sent through pipes to machines and other equipment used in different sectors of the installations. The water commonly used in these processes is groundwater, which generally has high concentrations of calcium and magnesium salts, that can co-precipitate with naturally occurring radioactive elements such as {sup 226}Ra and {sup 228}Ra creating radioactive scales, which are deposited in pipes, thus decreasing the efficiency of steam production. In addition, {sup 40}K that is present in all soils and rocks with a concentration of about 0.012% of natural potassium can also be concentrated in these scales. No data was found in literature relating to radionuclides present in the scales formed on boilers in general. In this context, the purpose of this work was to determine concentrations of {sup 226}Ra, {sup 228}Ra and {sup 40}K, in scales generated inside boilers from different industries in the cities of Caruaru, Paulista and Goiana, Pernambuco. Determination of the radionuclides concentration was performed by gamma spectrometry with an HPGe detector, calculating their specific activities. Activity concentrations of {sup 226}Ra were in the range of < 1.4 (Detection Limit) to 1,328.0 {+-} 23.0 Bq.kg{sup -1} and {sup 228}Ra activity concentrations varied from < 1.8 (Detection Limit) to 265.5 {+-} 8.0 Bq.kg{sup 1}. Activity concentrations of {sup 40}K were in the range of < 14.6 (Detection Limit) to 288.1 {+-} 11.5 Bq.kg{sup -1}. All these activity concentrations were lower than the limits established by the Brazilian Nuclear Energy Commission of for this type of matrix. (author)

  8. Kui ei taha, ära õpi? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Autor leiab, et viimase 10 aasta jooksul levinud arusaam - kui ei taha, ära õpi - on tegelikult väga negatiivsete tagajärgedega seisukoht. Haridus ei ole vaid individuaalne hüve ja selle puudumine individuaalne õnnetus, see on kogu ühiskonna probleem

  9. On RA Abstracts: From Rhetorical Structure to Thematic Organisation

    Science.gov (United States)

    Lores, Rosa

    2004-01-01

    This paper reports an analysis of research article (RA) abstracts from linguistics journals from two related angles: rhetorical organisation and thematic structure. Based on a small scale study it reveals two major types of rhetorical organisation, here called the IMRD type and the CARS type. When thematic analysis, in terms of thematic…

  10. Eesti kasutas ära kõik NATO lennutunnid

    Index Scriptorium Estoniae

    2014-01-01

    Eesti on tänavu ära kasutanud kõik NATO strateegilises õhutranspordiprogrammis (SAC) ette nähtud 35 lennutundi, millega Eesti sai kasutada transpordilennukit Boeing C-17 Globemaster. Lennutunnid kulusid Eesti jalaväeüksuse tagasitoomiseks Afganistanist

  11. Improved limit on the $^{225}$Ra electric dipole moment

    CERN Document Server

    Bishof, Michael; Bailey, Kevin G; Greene, John P; Holt, Roy J; Kalita, Mukut R; Korsch, Wolfgang; Lemke, Nathan D; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P; Singh, Jaideep T; Dietrich, Matthew R

    2016-01-01

    Background: Octupole-deformed nuclei, such as that of $^{225}$Ra, are expected to amplify observable atomic electric dipole moments (EDMs) that arise from time-reversal and parity-violating interactions in the nuclear medium. In 2015, we reported the first "proof-of-principle" measurement of the $^{225}$Ra atomic EDM. Purpose: This work reports on the first of several experimental upgrades to improve the statistical sensitivity of our $^{225}$Ra EDM measurements by orders of magnitude and evaluates systematic effects that contribute to current and future levels of experimental sensitivity. Method: Laser-cooled and trapped $^{225}$Ra atoms are held between two high voltage electrodes in an ultra high vacuum chamber at the center of a magnetically shielded environment. We observe Larmor precession in a uniform magnetic field using nuclear-spin-dependent laser light scattering and look for a phase shift proportional to the applied electric field, which indicates the existence of an EDM. The main improvement to o...

  12. Improved experimental limit on the EDM of 225Ra

    Science.gov (United States)

    Bishof, Michael; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Parker, Richard H.; Rabga, Tenzin; Singh, Jaideep T.

    2015-10-01

    Searches for permanent electric dipole moments (EDMs) in fundamental and composite particles are sensitive probes of beyond-standard-model symmetry violation that could explain the dominance of matter over anti-matter. The 225Ra (t1/2 = 15d, I = 1/2) atom is a particularly attractive system to use for an EDM measurement because its large nuclear octupole deformation, closely spaced ground-state parity doublet, and large atomic mass make 225Ra uniquely sensitive to symmetry-violating interactions in the nuclear medium. We have developed an experiment to measure the EDM of 225Ra and demonstrated the first ``proof-of-principle'' measurement, giving a 95% confidence upper limit of 5E-22 e-cm. After implementing a vacuum upgrade, we have observed nuclear spin coherence after 20 s of free evolution - a factor of ten improvement over our earlier results - and have lowered the 225Ra EDM limit by over an order of magnitude. Upcoming experimental upgrades have the potential to further improve our EDM sensitivity by many orders of magnitude, allowing us to test symmetry violation at an unprecedented level. This work is supported by U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  13. Diapycnal nutrient fluxes across the benthic boundary layers at the continental slopes off Peru and Mauritania based on 224Ra/223Ra-ratios

    Science.gov (United States)

    Reichert, P.; Scholten, J. C.; Eisenhauer, A.; Miquel, J. C.; Gasser, B.; Liebetrau, V.; Sommer, S.; Dengler, M.; Bryant, L. D.

    2014-12-01

    Marine sediments may act as sources and/or sinks of nutrients in oxygen minimum zones (OMZs) where solute fluxes between sediments and the above water column are believed to be an important component for the bioproductivity in the mixed layer. However, solute fluxes between sediments and the water column above are difficult to obtain. We determined the diapycnal nutrient fluxes across the benthic boundary layer at the OMZs off Peru and Mauritania using nutrient concentration profiles and vertical diffusion coefficients derived from 224Ra/223Ra isotope ratios. The radium isotopes 223Ra (half-life: 11.4 days) and 224Ra (half-life: 3.66 days) are produced in sediments by radioactive decay of 227Th and 228Th ,respectively: Diffusion of radium out of the sediments results in gradients of 224Ra/223Ra above the sediments; and these gradients may be used to estimate vertical diffusion coefficients. We determined 224Ra/223Ra along two transects at the continental slopes off Peru (12° S) and off Mauritania (18° N) in water depths between 65m - 1000mand 53m - 1100m, respectively. For the 223Ra/224Ra sampling we used acrylic fibers/cartridges coated with MnO2. The Mn-fibers were attached to benthic landers (moored for ~ 24 hours at the sea floor) and the Mn-cartridges were placed in series on several in-situ filtration pumps (Challenger Oceanic and McLane pumps). 223Ra and 224Ra were measured on-board using a delayed coincidence counting system (RaDeCC). In our presentation we will present the 224Ra/223Ra distribution along these transects investigated and we will compare the diapycnal radium-derived nutrient fluxes with those determined using benthic chambers and microstructure measurements.

  14. Identification of a HERV-K env surface peptide highly recognized in Rheumatoid Arthritis (RA) patients: a cross-sectional case-control study.

    Science.gov (United States)

    Mameli, G; Erre, G L; Caggiu, E; Mura, S; Cossu, D; Bo, M; Cadoni, M L; Piras, A; Mundula, N; Colombo, E; Buscetta, G; Passiu, G; Sechi, L A

    2017-07-01

    Endogenous retroviruses (HERV) are believed to be pathogenic in several autoimmune diseases. Among them, HERV-K viruses have been reported recently to be involved in the pathogenesis of rheumatoid arthritis (RA). In this study we have explored the role of humoral immune response against HERV-K as a potential pathogenetic mechanism in RA. Four different peptides from the extracellular portion of the env protein of HERV-K (env-su19-37 , env-su109-126 , env-su164-186 , env-su209-226 ) were selected by bioinformatic analysis on the basis of their putative immunogenicity. Indirect enzyme-linked immunosorbent assay (ELISA) was then carried out to quantify antibodies against those peptides on blood samples of 70 consecutive RA patients and 71 healthy controls (HC). Differences between the two groups were analysed using the Mann-Whitney test. Potential correlations between RA laboratory, clinical descriptors and immunoglobulin (Ig)G levels were explored by bivariate regression analysis. Serum autoantibodies against one of four tested peptides of HERV-K (env-su19-37 ) were significantly higher in RA than in HC (19 versus 3%, P = 0·0025). Subgroup analysis showed no association between anti-HERV-K peptide humoral response and clinical, serological and clinimetric RA disease descriptors. Serum from RA patients in our series reacted significantly against HERV-K env-su19-37 peptide in comparison to the general population suggesting a role for the HERV-K- related, secondary antigenic-driven immune response in the pathogenesis of RA. Further studies are needed to confirm these results and to explore the role of this HERV-K surface peptide as a potential therapeutic target. © 2017 British Society for Immunology.

  15. Canino mandibular con dos raíces

    Directory of Open Access Journals (Sweden)

    Laura Ricardina Ramírez-Sotelo

    Full Text Available El canino inferior es un diente con raíz larga y ancha que le permite una adecuada implantación en el arco dentario. Es considerado un pilar valioso en muchos tratamientos rehabilitadores. Con la finalidad de mantener este elemento dentario es necesario realizar un correcto diagnóstico, para lo que se tendrá en cuenta el conocimiento de las variaciones anatómicas. El objetivo del artículo es presentar un caso de canino mandibular con dos raíces con sus respectivos canales radiculares .Paciente femenina de 21 años, que acudió a la Clínica de Radiología de la Facultad de Odontología de Piracicaba con indicación de una radiografía panorámica para valorar cirugía de terceros molares. Llamó la atención una configuración inusual de las raíces de los caninos mandibulares. En el examen de tomografía computarizada de haz cónico se observó que el canino mandibular del lado derecho presentaba dos raíces separadas, cada una con sus respectivos canales radiculares. Se concluyó que a pesar de la baja prevalencia de las variaciones anatómicas, estas pueden ocurrir en el número de raíces y canales de los caninos mandibulares, tal como se presenta en este reporte de caso.

  16. Improved limit on the 225Ra electric dipole moment

    Science.gov (United States)

    Bishof, Michael; Parker, Richard H.; Bailey, Kevin G.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P.; Singh, Jaideep T.; Dietrich, Matthew R.

    2016-08-01

    Background: Octupole-deformed nuclei, such as that of 225Ra, are expected to amplify observable atomic electric dipole moments (EDMs) that arise from time-reversal and parity-violating interactions in the nuclear medium. In 2015 we reported the first "proof-of-principle" measurement of the 225Ra atomic EDM. Purpose: This work reports on the first of several experimental upgrades to improve the statistical sensitivity of our 225Ra EDM measurements by orders of magnitude and evaluates systematic effects that contribute to current and future levels of experimental sensitivity. Method: Laser-cooled and trapped 225Ra atoms are held between two high-voltage electrodes in an ultrahigh-vacuum chamber at the center of a magnetically-shielded environment. We observe Larmor precession in a uniform magnetic field using nuclear-spin-dependent laser light scattering and look for a phase shift proportional to the applied electric field, which indicates the existence of an EDM. The main improvement to our measurement technique is an order-of-magnitude increase in spin-precession time, which is enabled by an improved vacuum system and a reduction in trap-induced heating. Results: We have measured the 225Ra atomic EDM to be less than 1.4 ×10-23e cm (95 % confidence upper limit), which is a factor of 36 improvement over our previous result. Conclusions: Our evaluation of systematic effects shows that this measurement is completely limited by statistical uncertainty. Combining this measurement technique with planned experimental upgrades, we project a statistical sensitivity at the 1 ×10-28e cm level and a total systematic uncertainty at the 4 ×10-29e cm level.

  17. Ultrasound-detectable grey scale synovitis predicts future fulfilment of the 2010 ACR/EULAR RA classification criteria in patients with new-onset undifferentiated arthritis

    Science.gov (United States)

    Horton, Sarah C; Tan, Ai Lyn; Wakefield, Richard J; Freeston, Jane E; Buch, Maya H; Emery, Paul

    2017-01-01

    Objective To determine the clinical outcomes for patients with new-onset undifferentiated arthritis (UA), not fulfilling the 2010 American College of Rheumatology (ACR)/European League Against Rheumatism (EULAR) rheumatoid arthritis (RA) classification criteria, and the clinical and imaging predictors of disease progression in these patients. Methods A prospective observational study was conducted in treatment-naïve UA patients. Baseline ultrasound involved semiquantitative assessment of grey scale (GS) synovitis and power Doppler activity (PD) at 26 joints. Outcomes were fulfilment of 2010 RA criteria (joint involvement determined clinically) and initiation of methotrexate over 12 months. Cox proportional hazards analysis was used to investigate predictors of outcome. Results Of 60 patients, 13(22%) progressed to RA and 32(53%) ever received methotrexate. Analyses of predictors of outcome were conducted in the subgroup (n=41) of patients with complete baseline data. The presence of GS was associated with progression to RA and methotrexate use: HRs (95% CI) were 1.25(1.07 to 1.45) and 1.16(1.02 to 1.32), respectively, for the number of joints with GS≥ grade 2 after adjustment for swollen joints. PD was not predictive in the low levels at which it was observed. Progression to RA was also associated with fulfilment of the 2010 criteria using ultrasound synovitis for enumerating joint involvement, higher baseline disability and radiographic erosion. Conclusions This is the first report of ultrasound findings in early UA (defined by presence of clinical synovitis and non-fulfilment of 2010 RA criteria). A significant proportion of patients with UA progressed to RA and/or required methotrexate. GS synovitis was predictive of disease progression. PMID:28469936

  18. RAPIDARC (RA) in the uterine cervical cancer; dosimetric gain vs 3D-Crt; RAPIDARC (RA) en el cancer de cervix uterino; ganancia dosimetrica vs 3D-CRT

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez, J.; Garcia, B.; Quispe, K.; Gonzales, A.; Marquina, J., E-mail: jose.ramirez@aliada.com.pe [Clinica Aliada, Oncologia Integral, Av. Jose Galvez Barrenechea 1044, San Isidro, Lima (Peru)

    2014-08-15

    This work aims to quantitatively assess RAPIDARC (RA) treatments versus three dimensional-Conformal Radiation Therapy with field to field technique (3D-Crt-Fin F). 11 patients with cervical cancer treated at our institution radically or adjuvant clinical stages I-III B were evaluated. The prescribed dose was 50 Gy (2 Gy / Fr). The RA plans consisted of two isocentric complete arcs and conformational plans of 4 isocentric fields (previous, subsequent, right side and left side) with 3D-Crt-Fin F technique; both cases carried out ??in the Eclipse version 10 planner with calculation algorithm analytical anisotropic algorithm (AAA) and volumetric optimization software (for VMAT plans). Homogeneity indices (Hi), conformity indices (CI) Sigma indices (S-Index), monitor units (MU) and the time required for each treatment were compared. The mean age was 52 years (32-65) of the 11 patients 9 were clinical stages I-II B. The Hi varied from 0.052 for RA to 0.163 for 3D-Crt-Fin F (p = 0.009), and the CI between 1.005 and 1.35 (p = 0.26), the S-index from 1.2 to 3.7 (p = 0.001) and the H-index of 1.08 to 1.15 (p = 0.24). All dose limits in risk organs were met with a significant difference in the RA plans versus 3D-Crt-Fin F. In patients with cervical cancer the treatment plans quality with the indices aforementioned seems to be better with the RA technique, being observed a significant reduction of radiation to surrounding organs. (author)

  19. Determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom from a naturally high radioactive region

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, Mychelle M.L.; Custodio, Luis Gustavo; Cheberle, Luan T.V.; Taddei, Maria Helena T., E-mail: mychelle@cnen.gov.br, E-mail: lgcustodio@hotmail.com, E-mail: lt.cheberle@bol.com.br, E-mail: mhtaddei@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Maihara, Vera A., E-mail: vmaihara@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CNEN/IPEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Many studies have shown that mushrooms are organisms which efficiently accumulate radionuclides and can be used as indicators of environmental contamination and ecosystem quality. The Pocos de Caldas plateau, in Minas Gerais, is a region that has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. Seventy areas of radioactive anomalies have been identified in this region. From the radiological point of view the determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb is relevant because they are decay products of the natural series of {sup 238}U and {sup 232}Th, mainly responsible for natural radioactive exposures of man. The present paper is part of a broader study conducted in the Pocos de Caldas plateau, in which the concentration activities of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom samples were determined. The mushrooms were collected at different points of the plateau under the influence of radioactive anomalies and away from the influence of anomalies. From statistical studies a correlation between the accumulation of radionuclides in mushrooms and anomalies was established and it was possible to confirm the efficiency that the mushrooms present as environmental contamination indicators. (author)

  20. RA8, A human anti-CD25 antibody against human treg cells

    Energy Technology Data Exchange (ETDEWEB)

    Arias, Robyn; Flanagan, Meg; Miller, Keith D.; Nien, Yu-Chih; Hu, Peisheng; Gray, Dixon; Khawli, Leslie A.; Epstein, Alan L.

    2007-06-01

    Although anti-CD25 antibodies exist for clinical use in patients, there is a need for the development of a human Treg antibody that will abrogate the immunosuppressive function of this small but critical T cell subtype. Based upon mounting evidence that the level of Treg cells in the tumor microenvironment correlates with clinical prognosis and stage in man, it appears that Treg cells play an important role in the tumor's ability to overcome host immune responses. In mice, the rat anti-mouse CD25 antibody PC61 causes depletion of CD25-bearing Treg cells both peripherally in lymphatic tissues and in the tumor microenvironment, without inducing symptoms of autoimmunity. A similar antibody, though with the ability to delete Treg cells specifically, would be an important new tool for reversing tumor escape associated with Treg immunosuppression in man. To begin to generate such a reagent, we now describe the development of a human anti-CD25 antibody using a novel yeast display library. The target antigen CD25-Fc was constructed and used for five rounds of selection using a non-immune yeast display library that contained as many as 109 single chain variable fragments (scFv). Two unique clones with low KD values (RA4 and RA8) were then selected to construct fully human anti-CD25 antibodies (IgG1/kappa) for stable expression. One antibody, RA8, showed excellent binding to human CD25+ cell lines and to human Treg cells and appears to be an excellent candidate for the generation of a human reagent that may be used in man for the immunotherapy of cancer.

  1. Inventory of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in marine sediments cores of Southwest Atlantic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Alice M.R.; Oliveira, Joselene de, E-mail: alice.costa@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Metrologia das Radiacoes. Lab. de Radiometria Ambiental; Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    {sup 210}Pb (22.3 y) is a radioactive isotope successfully applied as tracer of sediment dating of the last 100-150 years. The application of {sup 226}Ra and {sup 228}Ra as paleoceanographic tracers (half-lives of 1,600 y and 5.7 y, respectively) also gives some information of ocean's role in past climate change. In this work, it was analyzed 2 sediment cores collect at Southwest Atlantic Ocean. The sediments samples were freeze-dried and acid digested in microwave. It was carried out a radiochemical separation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb and performed a gross alpha and gross beta measurement of both precipitates Ba(Ra)SO{sub 4} and PbCrO{sub 4} in a low background gas-flow proportional counter. Activity concentrations of {sup 226}Ra ranged from 45 Bq kg{sup -1} to 70 Bq kg{sup -1} in NAP-62 and from 57 Bq kg{sup -1} to 82 Bq kg{sup -1} in NAP-63 samples. The concentration of {sup 228}Ra varied between 37 Bq kg{sup -1} and 150 Bq kg{sup -1} in NAP-62 and between 23 Bq kg{sup -1} and 111 Bq kg{sup -1} in NAP-63 samples. The concentration of total {sup 210}Pb ranged from 126 Bq kg{sup -1} to 256 Bq kg{sup -1} in NAP-62 and from 63 Bq kg{sup -1} to 945 Bq kg{sup -1} in NAP-63 samples. Results of {sup 210}Pb{sub uns} varied from 68 Bq kg{sup -1} to 192 Bq kg{sup -1} for NAP-62, while varied from <4.9 Bq kg{sup -1} to 870 Bq kg{sup -1} in NAP-63 profile. Increased values of {sup 210}Pb{sub uns} were found on the top of both NAP-62 and NAP- 63 sediment profile. (author)

  2. Measurement of 223Ra and 224Ra via RaDeCC and its application at Liaohe River Estuary%辽河口水体中223Ra、224Ra的RaDeCC法测定及应用

    Institute of Scientific and Technical Information of China (English)

    许博超; 姚庆祯; 江雪艳; 于志刚

    2012-01-01

    介绍了同步延时计数法,并应用其对辽河口水体中的223 Ra和224 Ra进行了测定,结合pH、DO、COD、叶绿素、营养盐等参数对223 Ra和224 Ra的放射性活度及其比值随盐度的变化和影响因素进行了讨论,继而以“镭同位素表观年龄模型”计算了辽河口水体的停留时间.结果表明:2010年4月,辽河口调查水域水体中的224 Ra、223 Ra随盐度变化趋势不保守,在盐度为10和26的海域出现了放射性活度高峰值,可能分别由悬浮颗粒物解吸和滨岸咸化的地下水排放等因素造成.水体停留时间随着离开河口距离的增大而增大,最大值出现在盐度为14的海域,达到8.34 d.%Radium delayed coincidence countering system has become the state-of-the-art technique for short-lived radium isotopes (223Ra, 224Ra) measurement. In this paper, we described this system, and used it to measure 223Ra, 224Ra activities at the Liaohe River Estuary. Other parameters, like pH, DO, COD, petroleum hydrocarbon, chlorophyll and nutrients, were used to demonstrate the distribution and impact factors of isotopes activity and ratio versus salinity. Furthermore, the "Apparent Radium Age" model was applied to assess the water residence time at this area. Ra and Ra were not conservative with salinity at the studying area in A-pril, 2010. Two peak activities at salinity 10 and 26 were caused by suspended particles desorption and submarine groundwater discharge , respectively. Water residence time increased with the distance. The oldest age was 8. 34 days at the area with salinity of 14.

  3. Shared care or nurse consultations as an alternative to rheumatologist follow-up for rheumatoid arthritis (RA) outpatients with stable low disease-activity RA

    DEFF Research Database (Denmark)

    Sørensen, Jan; Primdahl, J; Horn, Hc

    2014-01-01

    Objectives: To compare the cost-effectiveness of three types of follow-up for outpatients with stable low-activity rheumatoid arthritis (RA). Method: In total, 287 patients were randomized to either planned rheumatologist consultations, shared care without planned consultations, or planned nurse...... clinics and general practice, prescription and non-prescription medicine, dietary supplements, other health-care resources, and complementary and alternative care. Measures of effectiveness and costs were collected by self-reported questionnaires at inclusion and after 12 and 24 months. Incremental cost...... and nurse care groups compared with the rheumatologist group. Shared care and nurse care were non-significantly less costly than rheumatologist care. As both shared care and nurse care were associated with slightly better EQ-5D improvements and lower costs, they dominated rheumatologist care. At EUR 10 000...

  4. MEFV, TNF1rA, CARD15 and NLRP3 mutation analysis in PFAPA.

    Science.gov (United States)

    Dagan, Efrat; Gershoni-Baruch, Ruth; Khatib, Ihab; Mori, Adi; Brik, Riva

    2010-03-01

    PFAPA is a periodic fever disease, of unknown etiology, characterized by aphthous stomatitis, pharyngitis and cervical adenitis. To inquire whether genes implicated in other auto-inflammatory diseases might be involved in its pathogenesis, predominant mutations in the genes causing familial Mediterranean fever, TNF receptor-associated periodic fever syndrome, Crohn's disease and Muckel-Wells syndrome were analyzed in PFAPA patients. Patients (n = 57) with PFAPA, according to previously published criteria were recruited, at the Meyer Children Hospital during 2006-2007. Clinical information was complemented during physicians-parents encounter. Predominant mutations in MEFV, TNF1rA, CARD15/NOD2 and NLRP3 genes were tested. Mean age at diagnosis was 30.64 +/- 16.4 months. Boys (n = 33; 58%) were diagnosed earlier than girls (n = 21; 42%) at 26.18 +/- 13.83 and 36.41 +/- 18.32 months, respectively (P = 0.05). Fifteen patients (27%) carried an MEFV mutation; two patients (3.6%) a CARD15 mutation, one patient (1.8%) a variance in TNF1rA and another had both an MEFV and a CARD15 mutation. Clinical symptoms were equally manifested in carriers and non-carriers. The high carrier rate of MEFV mutations in our PFAPA cases compares well with that of the general population in Israel. It is debated whether MEFV mutations, when mediated by the presence of additional modifiers, may expose a transient fever condition, namely PFAPA.

  5. Disparities in rheumatoid arthritis disease activity according to gross domestic product in 25 countries in the QUEST-RA database

    DEFF Research Database (Denmark)

    Sokka, T; Kautiainen, H; Pincus, T

    2009-01-01

    OBJECTIVE: To analyse associations between the clinical status of patients with rheumatoid arthritis (RA) and the gross domestic product (GDP) of their resident country. METHODS: The Quantitative Standard Monitoring of Patients with Rheumatoid Arthritis (QUEST-RA) cohort includes clinical......-related variables were analysed according to GDP per capita, including 14 "high GDP" countries with GDP per capita greater than US$24,000 and 11 "low GDP" countries with GDP per capita less than US$11,000. RESULTS: Disease activity DAS28 ranged between 3.1 and 6.0 among the 25 countries and was significantly...... associated with GDP (r = -0.78, 95% CI -0.56 to -0.90, r(2) = 61%). Disease activity levels differed substantially between "high GDP" and "low GDP" countries at much greater levels than according to whether patients were currently taking or not taking methotrexate, prednisone and/or biological agents...

  6. Fever without apparent source on clinical examination, lower respiratory infections in children, other infectious diseases, and acute gastroenteritis and diarrhea of infancy and early childhood.

    Science.gov (United States)

    McCarthy, P L; Klig, J E; Kahn, J S; Shapiro, E D; Baron, M A

    1997-02-01

    This section focuses on issues in infectious disease that are commonly encountered in pediatric office practice. Paul McCarthy discusses recent literature regarding the evaluation and management of acute fevers without apparent source on clinical examination in infants and children and the evaluation of children with prolonged fevers of unknown origin. Jean Klig reviews recent literature about lower respiratory tract infection in children. Jeffrey Kahn and Eugene Shapiro discuss literature concerning several infectious diseases commonly seen in office settings and concerning which recent developments are of interest. Michael Baron reviews recent literature about gastroenteritis and diarrhea of infancy and early childhood.

  7. Most přes Račí potok

    OpenAIRE

    Novotný, Matěj

    2014-01-01

    Bakalářská práce řeší most na komunikaci I/60 přes Račí potok. Konstrukce je navrhovaná ve třech variantách. Vybraná byla předpjatá desková konstrukce délky 18,2 metrů uvažovaná jako prostý nosník. Výpočet zatížení je proveden programem SCIA. Konstrukce je posuzována podle platných norem. The Bachelor thesis deals with the road bridge on tfe road I/60 across the "Račí" brook. Construction is proposed in three variants. The selected design was prestressed board length18,2 meters, intended a...

  8. Nuclear structure of 216Ra at high spin

    Indian Academy of Sciences (India)

    S Muralithar; G Rodrigues; R P Singh; R K Bhowmik; P Mukherjee; B Sethi; I Mukherjee

    2012-09-01

    High-spin states of 216Ra ( = 88, = 128) have been investigated through 209Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to $∼ 33\\hbar$ spin and 7.2 MeV excitation energy in the present experiment with placement of 28 new -transitions over what has been reported earlier. Tentative spin-parity assignments are done for the newly proposed levels on the basis of the DCO ratios corresponding to strong gates. Empirical shell model calculations were carried out to provide an understanding of the underlying nuclear structure.

  9. Enrichment of Vitamin D response elements in RA associated loci supports a role for vitamin D in the pathogenesis of RA

    Science.gov (United States)

    Yarwood, Annie; Martin, Paul; Bowes, John; Lunt, Mark; Worthington, Jane; Barton, Anne; Eyre, Steve

    2013-01-01

    The aim of this study was to explore the role of vitamin-D in rheumatoid arthritis (RA) pathogenesis by investigating enrichment of vitamin-D response elements (VDREs) in confirmed RA susceptibility loci and testing variants associated with vitamin-D levels for association with RA. Bioinformatically, VDRE genomic positions were overlaid with non HLA confirmed RA susceptibility regions. The number of VDREs at RA loci was compared to a randomly selected set of genomic loci to calculate an average relative risk (RR). SNPs in the DHCR7/NADSYN1 and CYP2R1 loci, previously associated with circulating vitamin-D levels, were tested in UK RA cases (n = 3870) and controls (n = 8430). Significant enrichment of VDREs was seen at RA loci (p=9.23×10−8) when regions were defined either by gene (RR 5.50) or position (RR 5.86). SNPs in the DHCR7/NADSYN1 locus showed evidence of positive association with RA, rs4944076 (p=0.008, OR 1.14 95% CI 1.03-1.24). The significant enrichment of VDREs at RA associated loci and the modest association of variants in loci controlling levels of circulating vitamin-D, supports the hypothesis that vitamin-D plays a role in the development of RA. PMID:23636220

  10. Characterization of the CpxRA regulon in Haemophilus ducreyi.

    Science.gov (United States)

    Labandeira-Rey, Maria; Brautigam, Chad A; Hansen, Eric J

    2010-11-01

    The Haemophilus ducreyi 35000HP genome encodes a homolog of the CpxRA two-component cell envelope stress response system originally characterized in Escherichia coli. CpxR, the cytoplasmic response regulator, was shown previously to be involved in repression of the expression of the lspB-lspA2 operon (M. Labandeira-Rey, J. R. Mock, and E. J. Hansen, Infect. Immun. 77:3402-3411, 2009). In the present study, the H. ducreyi CpxR and CpxA proteins were shown to closely resemble those of other well-studied bacterial species. A cpxA deletion mutant and a CpxR-overexpressing strain were used to explore the extent of the CpxRA regulon. DNA microarray and real-time reverse transcriptase (RT) PCR analyses indicated several potential regulatory targets for the H. ducreyi CpxRA two-component regulatory system. Electrophoretic mobility shift assays (EMSAs) were used to prove that H. ducreyi CpxR interacted with the promoter regions of genes encoding both known and putative virulence factors of H. ducreyi, including the lspB-lspA2 operon, the flp operon, and dsrA. Interestingly, the use of EMSAs also indicated that H. ducreyi CpxR did not bind to the promoter regions of several genes predicted to encode factors involved in the cell envelope stress response. Taken together, these data suggest that the CpxRA system in H. ducreyi, in contrast to that in E. coli, may be involved primarily in controlling expression of genes not involved in the cell envelope stress response.

  11. LoRa for the Internet of Things

    OpenAIRE

    Bor, Martin; Vidler, John Edward; Roedig, Utz

    2016-01-01

    New transceiver technologies have emerged which enable power efficient communication over very long distances. Examples of such Low-Power Wide-Area Network (LPWAN)technologies are LoRa, Sigfox and Weightless. A typicalapplication scenario for these technologies is city wide meter reading collection where devices send readings at very low frequency over a long distance to a data concentrator (one-hop networks). We argue that these transceiversare potentially very useful to construct more gener...

  12. Octupole collectivity in $^{220}$Rn and $^{224}$Ra

    CERN Document Server

    Gaffney, Liam Paul

    Collective properties of the radioactive nuclei $^{220}$Rn and $^{224}$Ra have been studied via Coulomb excitation of a 2.8$\\,$A.MeV radioactive ion beam (RIB) incident upon $^{60}$Ni, $^{112,114}$Cd and $^{120}$Sn targets. The experiments took place at the REX-ISOLDE RIB facility, CERN. De-excitation $\\gamma$-ray yields following multiple-step Coulomb excitation were detected in coincidence with recoiling target nuclei in the Miniball spectrometer. For the first time, B(E3;3$^+ \\rightarrow 0^+$) values have been directly measured with a radioactive ion beam. In the process, $^{224}$Ra becomes the heaviest post-accelerated RIB to date at ISOLDE (with the possible exception of the quasi-stable $^{238}$U). The measurements presented in this thesis represent a tripling of the number of nuclei around Z$\\simeq88$ and N$\\simeq134$, for which direct measurements of the octupole collectivity have been performed. The only previous measurements being for the relatively long-lived $^{226}$Ra. The $\\gamma$-ray yields, in...

  13. 223Ra levels fed in the 223Fr β decay

    Science.gov (United States)

    Abdul-Hadi, A.; Barci, V.; Weiss, B.; Maria, H.; Ardisson, G.; Hussonnois, M.; Constantinescu, O.

    1993-01-01

    The 223Fr β decay was reinvestigated using high-resolution single γ spectrometry as well as γ-γ coincidence techniques. For single γ-spectra measurements, radiochemically pure 223Fr sources were obtained by chromatographic separation from a 75 MBq activity 227Ac parent source and continuously purified of 223Ra and daughters. The analysis of the γ spectra of 30 sources showed the existence of 131 γ lines, of which 87 are reported for the first time in the 223Fr β decay although many of them are observed following the 227Th α decay. The 223Fr half-life was remeasured and found to be T1/2=22.00+/-0.07 min. γ-γ-t coincidence measurements were also carried out with 223Fr purified sources. The 223Ra level scheme was built on the basis of our γ data, as well as 227Th α-decay data. Among the 32 excited 223Ra levels, of which 22 were also known from 227Th α decay, 13 are newly reported from 223Fr β decay. Low energy levels (E<400 keV) may be classified as parity doublet bands according to the predictions of the reflection asymmetric rotor model. Above a 700 keV gap, a coexistence of symmetric and asymmetric shapes including both static and dynamic octupole correlations is suggested.

  14. Trapping of short lived Ra{sup +} ions

    Energy Technology Data Exchange (ETDEWEB)

    Bekker, H.; Nunes Portela, M.; Seelen, D.; Dermois, O.; Jungmann, K.; Onderwater, C.J.G.; Timmermans, R.G.E.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, NL (Germany)

    2012-07-01

    A precision measurement of atomic parity violation in order to determine electroweak mixing angle at low energy scale is underway at the KVI, University of Groningen. The experiment exploits the large sensitivity of a single trapped Ra{sup +} ion. It requires the trapping of short lived radium ions in a Paul trap. Our first laser spectroscopy on an ensemble of trapped short-lived {sup 209-214}Ra{sup +} isotopes employed buffer gas cooled ions in a linear Paul trap. It provided hyperfine structure of the 6d {sup 2}D{sub 3/2} states and isotope shift of the 6d {sup 2}D{sub 3/2}-7p {sup 2}P{sub 1/2} transition. In a next step the buffer gas cooled Ra ions are extracted from the trap and transported in an electrostatic transport system towards a small Paul trap in an UHV environment. Here the ion can be cooled and subsequently microwave transitions between hyperfine states in the 6d {sup 2}D{sub 3/2} manifold can be driven in order to yield high precision results on the hyperfine constants. These results provide input for the ongoing precision atomic structure calculations.

  15. Raízes e estruturas da sociedade brasileira

    Directory of Open Access Journals (Sweden)

    Leonor Natividade de Campos Medeiros

    2014-05-01

    Full Text Available Este estudo teve como objetivo conhecer e refletir as raízes e estruturas da sociedade brasileira, na visão de dois grandes pensadores: Sérgio Buarque de Holanda com Raízes do Brasil e Gilberto Freyre com Casa-Grande & Senzala. Holanda dividiu o Brasil em duas fases a primeira da colonização portuguesa e a segunda uma critica ao Estado Novo. Freyre mostra a organização social, política e econômica da época da colonização e desenvolve seus estudos ao final da década de 1920, época em que o ambiente intelectual brasileiro está sob a força do modernismo. Conclui-se que o pensamento de Holanda e Freyre se assemelha em alguns aspectos e diverge em outros.   Sociologia de Freyre; Sociologia de Holanda; Raízes da sociedade brasileira

  16. An improved limit on the EDM of 225 Ra

    Science.gov (United States)

    Bishof, Michael; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P.; Parker, Richard H.; Rabga, Tenzin; Singh, Jaideep T.

    2016-05-01

    Searches for permanent electric dipole moments (EDMs) are sensitive probes of symmetry violation that could explain the dominance of matter over anti-matter. The 225 Ra (t1/2 = 15 days, I = 1/2) atom is a particularly attractive system to use for an EDM measurement because its octupole-deformed nucleus, closely spaced ground-state parity doublet, and large nuclear charge make 225 Ra uniquely sensitive to symmetry-violating interactions in the nuclear medium. In 2015, we reported the first ``proof of principle'' measurement of the 225 Ra EDM, giving a 95% confidence upper limit of 5* 10-22 e-cm; representing the first EDM measurement using laser-trapped atoms as well as the first EDM measurement of an atom with an octupole-deformed nucleus. After implementing upgrades to our apparatus, we now observe nuclear spin coherence after 20 s of free evolution - a factor of ten improvement. A new EDM measurement based on the upgraded system improved the 95% confidence upper limit by a factor of 36. We also report on the progress of current experimental upgrades that have the potential to further improve our EDM sensitivity by many orders of magnitude, allowing us to test symmetry violation at an unprecedented level. This work is supported by U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  17. Doses from {sup 222}Rn, {sup 226}Ra, and {sup 228}Ra in groundwater from Guarani aquifer, South America

    Energy Technology Data Exchange (ETDEWEB)

    Bonotto, D.M. E-mail: dbonotto@rc.unesp.br

    2004-07-01

    Groundwater samples were analysed for {sup 222}Rn, {sup 226}Ra, and {sup 228}Ra in Guarani aquifer spreading around 1 million km{sup 2} within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.

  18. Possibility of rapidly reporting 226Ra activity in 226Ra-222Rn samples with unknown equilibrium factor by γ spectrometer

    Institute of Scientific and Technical Information of China (English)

    SU Qiong; ZHENG Rui; CHEN Yong; CHENG Jian-Ping

    2004-01-01

    This paper reports the observed changes for equilibrium factors between 226Ra and 222Rn with sealing time of the samples. The samples include soil, raw coal, mineral water, cement, rock, etc. Especially the conceptions of "pre-equilibrium time" and "pre-equilibrium factor" have been put forward and methods of measuring and processing data have been given which can be used for rapidly reporting activity of 226Ra in samples with unknown equilibrium factor. It is definitely concluded that, using methods given in the paper, a test report will be completed in 3~7days, instead of one month, after receiving the sample whose activity is not lower than LLD of the spectrometer.

  19. U-Th-Ra disequilibria at the Masaya (Nicaragua); Desequilibres U-Th-Ra au Masaya (Nicaragua)

    Energy Technology Data Exchange (ETDEWEB)

    Sigmarsson, O.; Condomines, M. [Centre de Recherches Volcanologiques, CNRS URA-10, 63 - Clermont Ferrand (France)

    1996-12-31

    {sup 238}U-{sup 230}Th-{sup 226}Ra radioactive disequilibria were measured in several basalt samples of the post-caldera flows of the Masaya volcano (Nicaragua). {sup 230}Th/{sup 232}Th ratios are from the highest known in the world (about 2.53) with {sup 230}Th/{sup 238}U ratios close to 1. These exceptionally high isotopic thorium ratios from the Masaya and other neighboring volcanoes (Conception, Cerro Negro, Momotombo) are followed by very high {sup 10}Be/{sup 9}Be ratios (60 10{sup -11} for the 1722 flow). These geochemical characteristics with {delta}{sup 18}O of typical mantle origin (5.55) suggest an influence of the subducted sediments fluids in the magma source. The age of the metasomatism ranges from 10 to 0.3 Ma. Initial {sup 226}Ra/{sup 230}Th ratios measured in four historical flows vary from 1.3 to 1.4 and are anti-correlated with the Th content. These variations are probably linked to the fractionated crystallisation of plagioclase minerals. The initial {sup 226}Ra/Ba ratio remains constant and suggests the existence of a huge stationary magmatic reservoir. This hypothesis is also confirmed by the disproportion between the SO{sub 2} quantity emitted by the volcano and by the degassing of lavas on the ground. The {sup 226}Ra excess observed in the Masaya lavas can be the result of a second stage of metasomatism which occurred less than 8000 years B.P. during partial fusion. Abstract only. (J.S.).

  20. An evaluation of ²²⁶Ra and ²²⁸Ra in drinking water in several counties in Texas, USA.

    Science.gov (United States)

    Landsberger, S G; George, G

    2013-11-01

    Naturally Occurring Radioactive Material (NORM) or Technology Enhanced Naturally Occurring Radioactive Material (TENORM) can be a potential health risk. It is now well known that the underlying geology in many parts of Texas has given rise to levels of (226)Ra and (228)Ra that often exceed the limits set by the US Environmental Protection Agency. A detailed literature search was undertaken to assess the levels of (226)Ra and (228)Ra in all of the Texas counties. Several statistical evaluations of the data were performed. The Hickory aquifer in the Llano Uplift region of Texas has consistently had the highest number of (226)Ra and (228)Ra concentrations above the legal limit. As well many of the affected rural communities may not have the financial resources to rectify the problem.

  1. Genetic variants in IL2RA and IL7R affect multiple sclerosis disease risk and progression

    Science.gov (United States)

    Traboulsee, Anthony L.; Bernales, Cecily Q.; Ross, Jay P.; Lee, Joshua D.; Sadovnick, A. Dessa; Vilariño-Güell, Carles

    2016-01-01

    Multiple sclerosis (MS) is a common demyelinating neurodegenerative disease with a strong genetic component. Previous studies have associated genetic variants in IL2RA and IL7R in the pathophysiology of the disease. In this study we describe the association between IL2RA (rs2104286) and IL7R (rs6897932) in the Canadian population. Genotyping 1,978 MS patients and 830 controls failed to identify any significant association between these variants and disease risk. However, stratified analysis for family history of disease, and disease course identified a trend towards association for IL2RA in patients without a family history (p = 0.05; odds ratio = 0.77), and a significant association between IL7R and patients who developed progressive MS (PrMS) (p = 0.002; odds ratio = 0.73). Although not statistically significant, the effect of IL2RA (rs2104286) in patients without a family history of MS indicates that the genetic components for familial and sporadic disease are perhaps distinct. This data suggests the onset of sporadic disease is likely determined by a large number of variants of small effect, whereas MS in patients with a family history of disease is caused by a few deleterious variants. In addition, the significant association between PrMS and rs6897932 indicates that IL7R may not be disease-causing but a determinant of disease course. Further characterization of the effect of IL2RA and IL7R genetic variants in defined MS subtypes is warranted to evaluate the effect of these genes on specific clinical outcomes and to further elucidate the mechanisms of disease onset and progression. PMID:24770783

  2. Radiochemical determination and separation or total radium, 226Ra and 224Ra; Analisis Radioquimico de Radio total, Radio-226 y Radio-224

    Energy Technology Data Exchange (ETDEWEB)

    Suarez, J. A.; Gonzalez, J. A.; Pablo, M. A. de

    1987-07-01

    Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs.

  3. Determination of Ra natural isotopes in marine samples from Itamaraca coastal regions; Determinacao de isotopos naturais de Ra em amostras costeiras da regiao de Itamaraca (PE)

    Energy Technology Data Exchange (ETDEWEB)

    Silveira, Patricia B.; Valentim, Eliane; Lima, Ricardo A. [Centro Regional de Ciencias Nucleares (CRCN), Recife, PE (Brazil)]. E-mail: pbrandao@cnen.gov.br; Medeiros, Carmem [Pernambuco Univ., Recife, PE (Brazil). Dept. de Oceanografia; Oliveira, Joselene [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    2005-07-01

    Groundwater plays an important role in the transport of nutrients and pollutants to the coastal marine environment s and other surfaces water. Concentrations of {sup 223}Ra, {sup 224}Ra and {sup 226}Ra in marine water of the Itamaraca coastal region, PE, were measured during the winter of 2004, aiming to investigate the presence of radionuclides as a tracer of submarine groundwater discharges (SGD) in the environment studied. Measurements of temperature, salinity and nutrients were also carried out. (author)

  4. Validation of ACR/EULAR definition of remission in rheumatoid arthritis from RA practice: the ESPOIR cohort.

    Science.gov (United States)

    Zhang, Bin; Combe, Bernard; Rincheval, Nathalie; Felson, David T

    2012-06-29

    In development of the American College of Rheumatology (ACR)/European League Against Rheumatism (EULAR) rheumatoid arthritis (RA) remission definitions using clinical trials data, one criterion used to compare different remission definitions was whether, compared with those not in remission, those in remission had evidence of later disease stability defined by x-ray and functional status. Validation of the RA remission criteria using observational study data is necessary before recommending their use in practice. Using data from those who met RA criteria in the ESPOIR cohort, we matched each person in remission with a person not in remission and then carried out analyses comparing later stability of x-ray and health assessment questionnaire (HAQ) between the two groups. We compared the predictive validity of the same candidate definitions of remission evaluated in the ACR/EULAR process. To minimize potential bias and produce more stable results, we used a bootstrap resampling approach to select those not in remission, repeating the sample matching analysis process 500 times. Results were similar to those of clinical trials analyzed for the ACR/EULAR remission criteria. Specifically, the ACR/EULAR remission definitions using either an simple disease activity index (SDAI) ≤ 3.3, clinical disease activity index (CDAI) ≤ 2.8 or a definition of remission requiring tender joint count, swollen joint count, patient global assessment all ≤ 1 performed as well or better than other candidate definitions of remission in terms of predicting later x-ray and function stability. ACR/EULAR definitions of remission developed for trials are similarly valid in observational studies in RA and could be used in practice.

  5. Selective extraction of naturally occurring radioactive Ra2+ from aqueous waste streams

    NARCIS (Netherlands)

    van Leeuwen, F.W.B.

    2005-01-01

    This thesis describes the design and selectivity of new Ra2+ extractants. The results presented provide insight in both the requirements needed to give Ra2+ selectivity and in the achievable Ra2+/Mn+ (Mn+ = alkali(ne earth) cation) separations.

  6. 226Ra or 226Ra/Ba dating of Holocene volcanic rocks: application to Mt. Etna and Merapi volcanoes

    Science.gov (United States)

    Condomines, M.; Gauthier, P. J.; Tanguy, J. C.; Gertisser, R.; Thouret, J. C.; Berthommier, P.; Camus, G.

    2005-02-01

    This paper shows how 226Ra- 230Th disequilibria can be used to date Holocene volcanic rocks from some well selected volcanoes. A systematic study of these disequilibria on historical or well-dated volcanic samples is indeed first required to test the applicability of this method. Two examples are described here to illustrate its potential. In the case of Mt. Etna, the good correlation observed between ( 226Ra) 0 activities at the time of eruption and Th contents in lava flows from the last two millennia [M. Condomines, J.C. Tanguy, V. Michaud, Magma dynamics at Mt. Etna: constraints from U-Th-Ra-Pb radioactive disequilibria and Sr isotopes in historical lavas, Earth Planet. Sci. Lett. 132 (1995) 25-41] is used to infer the ages of several newly analysed lava flows. The calculated ages are in good agreement with those deduced from the archaeomagnetic curve describing the variation of the geomagnetic field direction in southern Italy [J.C. Tanguy, I. Bucur, J.F.C. Thompson, Geomagnetic secular variation in Sicily and revised ages of historic lavas from Mt. Etna, Nature 318 (1985) 453-455, J.C. Tanguy, M. Le Goff, V. Chillemi, A. Paiotti, C. Principe, S. La Delfa, G. Patane, Variation séculaire de la direction du champ géomagnétique enregistrée par les laves de l'Etna et du Vésuve pendant les deux derniers millénaires, C. R. Acad. Sci. Paris 329 (1999) 557-564, J.C. Tanguy, M. Le Goff, C. Principe, S. Arrighi, V. Chillemi, A. Paiotti, S. La Delfa, G. Patane, Archaeomagnetic dating of Mediterranean volcanics of the last 2100 years: validity and limits. Earth Planet. Sci. Lett. 211 (2003) 111-124]. We also present a whole set of new U-series data on historical, recent, and older samples from Merapi (Indonesia), and show that the ( 226Ra)/Ba ratio has probably maintained a quasi-steady state value during at least the past four millennia, and can be used to infer the ( 226Ra) 0/Ba ratio of old volcanics at the time of eruption, and thus their ages. Comparison with

  7. Bone-seeking radiopharmaceuticals for treatment of osseous metastases, Part 1: α therapy with 223Ra-dichloride.

    Science.gov (United States)

    Pandit-Taskar, Neeta; Larson, Steven M; Carrasquillo, Jorge A

    2014-02-01

    Metastatic disease to bone is commonly seen in the advanced stages of many cancers. The cardinal symptom, pain, is often the cause of significant morbidity and reduced quality of life. Treatment of bone pain includes nonsteroidal analgesics and opiates; however, long-term use of these drugs is commonly associated with significant side effects, and tolerance is common. External-beam radiation therapy is effective mainly in localized disease sites. Bone-targeting radiopharmaceuticals are beneficial in the management of patients with multiple metastatic lesions. This article focuses on the 3 most commonly used agents: the Food and Drug Administration-approved (89)Sr-chloride, (153)Sm-ethylenediaminetetramethylene phosphonic acid (EDTMP), and (223)Ra-dichloride. We will discuss the physical characteristics, clinical data, dosage, and administration of these agents, including optimal patient selection and toxicity associated with their use. These radioactive agents have proven efficacy in the treatment of painful osseous metastases from prostate cancer and breast cancer. Significant recent advances include use of these agents in combination with chemotherapy and the use of the α emitter (223)Ra-dichloride in prostate cancer, primarily to improve survival and skeletal related events. The review is presented in 2 parts. The first will discuss the characteristics and clinical use of (223)Ra-dichloride, and the second will discuss the β emitters (89)Sr and (153)Sm-EDTMP.

  8. High Resolution Study of the 222Ra Exotic Decay

    Science.gov (United States)

    Hussonnois, M.; Le Du, J. F.; Brillard, L.; Dalmasso, J.; Ardisson, G.

    1991-10-01

    The 14C-decay of 222Ra has been reinvestigated using a strong 230U source and the magnetic superconducting spectrometer SOLENO in view of looking for a possible feeding of the first 208Pb excited state. 210 14C-events were recorded in a single peak of (30.930±0.090) MeV energy; the 14C branching ratio values b=(2.31±0.31)×10-10 and <1×10-12 to the respective 208Pb ground and Iπ=3- octupole state were deduced.

  9. Endoparasitismo gastrintestinal em cabras da raça Anglonubiana

    OpenAIRE

    Batista,Joilson Ferreira; Campelo,José Elivalto Guimarães; Morais,Marcyele Ferreira; Silva,Pollyana Oliveira; Magalhães,Pâmela Cristina; Barçante,Felipe Pereira da Silva; Mendonça,Ivete Lopes

    2014-01-01

    A dificuldade de manutenção do rebanho em condições sanitárias adequada compromete a eficiência da criação de caprinos, principalmente em relação ao controle de endoparasitas. O objetivo com este trabalho foi avaliar a sensibilidade de matrizes da raça Anglonubiana a nematoides gastrintestinais, considerando as cabras estratificadas por estágio fisiológico (lactantes e não lactantes) dentro de três classes de idade. Utilizou-se as características: Ovos por grama de fezes (OPG), Grau de anemia...

  10. Bedside etiology of childhood cancer. [X radiation, /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Miller, R.W.

    1977-01-01

    The following topics are discussed: adenocarcinomas of the vagina in young women exposed prenatally to diethylstilbestrol; neuroblastoma in children exposed prenatally to hydantoin; increased frequency of leukemia in Japanese children surviving the atomic bomb; cancer in adults following administration of /sup 224/Ra during childhood; increased risk of lung cancer following environmental exposure of children to asbestos; lung cancer in adults following exposure to lead, copper, zinc, and arsenic; association of chromosomal aberrations with leukemia in children exposed to x radiation and benzene; immunosuppression in lymphoma patients; renal dysplasia in patients with Wilms' tumor; and aggregation of neoplasms in families. (HLW)

  11. Atomic Mass and Nuclear Binding Energy for Ra-226 (Radium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Ra-226 (Radium, atomic number Z = 88, mass number A = 226).

  12. Raça ovina Merino da Beira Baixa

    OpenAIRE

    Andrade, C.S.C.R.; Pires, T. H. S.

    2012-01-01

    O Merino da Beira Baixa é um animal cujas características fenotípicas estão estabelecidas e que se fixaram após um período evolutivo de cruzamentos das raças autóctones existentes a quando do Recenseamento Geral de Gados de 1870, bordaleiro churro e comum, com o Merino Espanhol introduzido em Portugal em 1920, o Merino Fonte Boa em 1929/30 e devido a transumâncias com os churros Mondegueiro e Serra da Estrela (6). A sua substituição por outras, teoricamente mais produtivas mas ...

  13. Ra and the average effective strain of surface asperities deformed in metal-working processes

    DEFF Research Database (Denmark)

    Bay, Niels; Wanheim, Tarras; Petersen, A. S

    1975-01-01

    Based upon a slip-line analysis of the plastic deformation of surface asperities, a theory is developed determining the Ra-value (c.l.a.) and the average effective strain in the surface layer when deforming asperities in metal-working processes. The ratio between Ra and Ra0, the Ra-value after...... and before deformation, is a function of the nominal normal pressure and the initial slope γ0 of the surface asperities. The last parameter does not influence Ra significantly. The average effective strain View the MathML sourcege in the deformed surface layer is a function of the nominal normal pressure...

  14. Sublethal exposure to alpha radiation (223Ra dichloride) enhances various carcinomas' sensitivity to lysis by antigen-specific cytotoxic T lymphocytes through calreticulin-mediated immunogenic modulation.

    Science.gov (United States)

    Malamas, Anthony S; Gameiro, Sofia R; Knudson, Karin M; Hodge, James W

    2016-12-27

    Radium-223 dichloride (Xofigo®; 223Ra) is an alpha-emitting radiopharmaceutical FDA-approved for the treatment of bone metastases in patients with advanced castration-resistant prostate cancer. It is also being examined clinically in patients with breast and lung carcinoma and patients with multiple myeloma. As with other forms of radiation, the aim of 223Ra is to reduce tumor burden by directly killing tumor cells. External beam (photon) and proton radiation have been shown to augment tumor sensitivity to antigen-specific CD8+ cytotoxic T lymphocytes (CTLs). However, little is known about whether treatment with 223Ra can also induce such immunogenic modulation in tumor cells that survive irradiation. We examined these effects in vitro by exposing human prostate, breast, and lung carcinoma cells to sublethal doses of 223Ra. 223Ra significantly enhanced T cell-mediated lysis of each tumor type by CD8+ CTLs specific for MUC-1, brachyury, and CEA tumor antigens. Immunofluorescence analysis revealed that the increase in CTL killing was accompanied by augmented protein expression of MHC-I and calreticulin in each tumor type, molecules that are essential for efficient antigen presentation. Enhanced tumor-cell lysis was facilitated by calreticulin surface translocation following 223Ra exposure. The phenotypic changes observed after treatment appear to be mediated by induction of the endoplasmic reticulum stress response pathway. By rendering tumor cells more susceptible to T cell-mediated lysis, 223Ra may potentially be effective in combination with various immunotherapies, particularly cancer vaccines that are designed to generate and expand patients' endogenous antigen-specific T-cell populations against specific tumor antigens.

  15. [ICO-166 monoclonal antibodies against the CD45RA antigen].

    Science.gov (United States)

    Frolova, E A; Baryshnikov, A Iu; Novikov, V V; Syrkin, A B

    1993-07-01

    Monoclonal antibodies (MCA) ICO-166 against CD45RA antigen were generated and characterized. In the indirect IFA, MCA ICO-166 reacted with 54.1 +/- 1.9% lymphocytes of human peripheral blood and 15.2 +/- 2.3% monocytes but not with granulocytes or thrombocytes. The method of double labelling of cells demonstrated that MCA ICO-166 detected all B-lymphocytes, all NK-cells and 31% of mature T-lymphocytes but only 55% of CD8 suppressor cells and only 21% of CDA helper cells carried this antigen on the surface. Experiments were carried out to block binding of FITC-labeled MCA ALB11 against CD45RA antigen with human lymphocytes by pretreatment of cells with different concentrations of MCA ICO-166. Treatment of cells with MCA ALB11 blocked binding of MCA ALB11-FITC by 85% on the average. MCA ICO-166 blocked binding of MCA ALB11-FITC by 66% on the average. When different dilutions of MCA ICO-166 were used, the dose-dependent effect of blocking of MCA ALB11-FITC binding was observed. MCA ICO-166 immunoprecipitated a protein band of molecular weight 220 kDa from lysates of mononuclear cells of the human peripheral blood.

  16. Atomic parity violation in a single Ra ion

    Energy Technology Data Exchange (ETDEWEB)

    Nunes Portela, M.; Beker, H.; Giri, G.; Jungmann, K.; Onderwater, C.J.G.; Schlesser, S.; Timmermans, R.G.E.; Versolato, O.O.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, NL (Germany)

    2012-07-01

    Precision measurements of atomic parity violation is the only path to determine the electroweak mixing angle in the Standard Model of particle physics at low energy scale. A single trapped Ra{sup +} ion is the most promising candidate for such an experiment. The system combines the advantages of large parity violation amplitudes due to the faster than Z{sup 3} scaling, the possibility to perform accurate atomic structure calculation on this one valence electron system and the ability to precision frequency measurements on trapped ion. Our first laser spectroscopy on an ensemble of trapped short-lived {sup 209-214}Ra{sup +} isotopes in a linear Paul trap provided hyperfine structure of the 6d {sup 2}D{sub 3/2} states and isotope shift of the 6d {sup 2}D{sub 3/2} - 7p {sup 2}P{sub 1/2} transition. These results provide input for the ongoing precision atomic structure calculations. The next step of the experiments towards laser cooling of a single trapped radium ion. The experimental setup is being commissioned with Ba ions.

  17. Raúl Castro a la hora de las decisiones

    Directory of Open Access Journals (Sweden)

    Janette HABEL

    2010-01-01

    Full Text Available Este artículo trata sobre el nuevo rol político de Raúl Castro en Cuba. Su misión no es fácil. Debe redefinir un proyecto de desarrollo viable en condiciones históricas y geopolíticas nuevas; garantizar la estabilidad del país; organizar el relevo entre los antiguos dirigentes históricos y las nuevas generaciones; y, además, iniciar negociaciones con la administración Obama. ¿Se podrá hablar en adelante de un «raulismo» o se seguirá imponiendo el «fidelismo»? Asimismo, ¿cómo salvaguardar la soberanía e independencia, junto a las principales conquistas sociales desde hace cincuenta años, mientras al mismo tiempo se llevan a cabo las reformas «estructurales » y se intenta normalizar relaciones con el continente, específicamente con Estados Unidos? Esa respuesta, que no es obvia, la debe dar Raúl Castro.

  18. Factors associated with influenza and pneumococcal vaccine uptake among rheumatoid arthritis patients in Denmark invited to participate in a pneumococcal vaccine trial (Immunovax_RA)

    DEFF Research Database (Denmark)

    Nguyen, MTT; Lindegaard, H.; Hendricks, O.

    2017-01-01

    Objective: This study investigates predictors of influenza and pneumococcal vaccine coverage among rheumatoid arthritis (RA) patients, and explores possible differences according to type of RA therapy. Method: RA patients from two clinics in the region of Southern Denmark were informed about...... the survey during scheduled follow-up visits. The questionnaire included questions concerning previous influenza and pneumococcal vaccine uptake, attitudes about vaccination, and socio-demographic factors. Factors associated with recalled vaccine uptake were assessed by multivariate logistic regression......-rheumatic drugs (bDMARDs). Self-reported uptake of vaccination against seasonal influenza ever was 59% overall; 57% among patients receiving cDMARDs and 61% in patients receiving bDMARDs. Self-reported vaccine uptake against pneumococcal diseases was only 6% overall. Older age, educational level, and information...

  19. Bioavailability pf radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in Brazilian phosphogypsum and phosphate fertilizers

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Ana Carolina; Saueia, Catia H.R.; Mazzilli, Barbara P., E-mail: chsaueia@ipen.br [Instituto de Pesquisas Energeticas e Nucleares(IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Phosphogypsum (PG) is a by-product of phosphate fertilizers industries. The USEPA classified PG as a - Technologically Enhanced Naturally Occurring Radioactive Material (TENORM). Its worldwide production on 2006 was estimated in 150 million tons. Annually the three main phosphate industries in Brazil are responsible for 5.5x106 tons of phosphogypsum, which is stored in stacks. The level of radionuclides present in phosphogypsum is well-known and makes its disposal or reutilization an environmental concern. Part of this byproduct can be reused, for example, to improve fertility of agricultural soils. To assess the long term environmental impact of radioactive contamination of ecosystems, information on source term including radionuclide speciation, mobility and biological uptakes have high importance. This paper intends to evaluate the bioavailability of the radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb to the environment by following a procedure established by the EC (European Community), which includes a single EDTA-NH{sub 4} 0.05M extraction at pH 7.0 prior to the analyses. These results is compared with the total activity concentration of these radionuclides in Brazilian PG and the most used phosphate fertilizers (SSP, TSP, MAP and DAP). This procedure intends to represent on a more realistic way the leaching of radionuclides from PG and fertilizers to soil and agricultural products. (author)

  20. Distribution of 226Ra in the Arctic Ocean and the Bering Sea and its hydrologic implications

    Institute of Scientific and Technical Information of China (English)

    邢娜; 陈敏; 黄奕普; 蔡平河; 邱雨生

    2003-01-01

    Radium-226 (226Ra) activities were measured in the surface water samples collected from the Arctic Ocean and the Bering Sea during the First Chinese National Arctic Research Expedition. The results showed that 226Ra concentrations in the surface water ranged from 0.28 to 1.56 Bq/m3 with an average of 0.76 Bq/m3 in the Arctic Ocean, and from 0.25 to 1.26 Bq/m3 with an average of 0.71 Bq/m3 in the Bering Sea. The values were obviously lower than those from open oceans in middle and low latitudes, indicating that the study area may be partly influenced by sea ice meltwater. In the Bering Sea, 226Ra in the surface water decreased northward, probably as a result of the exchange between the 226Ra-deficientsea ice meltwater and the 226Ra-rich Pacific water. In the Arctic Ocean, 226Ra in the surface water increased northward and eastward. This spatial distributionof 226Ra reflected the variation of the 226Ra-enriched river component in the water mass of the Arctic Ocean. The vertical profiles of 226Ra in the Canadian Basin showed a concentration maximum at 200 m, which could be attributed to the inputs of the Pacific water or/and the bottom shelf water with high 226Ra concentration. This conclusion was consistent with the results from 2H, 18O tracers.

  1. The Paran\\'a Ra'anga expedition

    CERN Document Server

    Gangui, Alejandro; Vena, Pablo

    2013-01-01

    Paran\\'a Ra'anga (the image of Paran\\'a, in Guaran\\'i) is the name of a cultural and scientific expedition that traveled the rivers: R\\'io de la Plata, Paran\\'a and Paraguay, from Buenos Aires to Asunci\\'on, during March 2010. The project brought together some forty scientists and artists from three countries in a slow and enriching cruise, putting in active contact actors from different backgrounds and disciplines -which usually run separately- in the framework of an unusual space-time experience. The project recovers the historical tradition of the trip as an instrument of knowledge and collaboration between the arts and sciences, necessary to build new ways of seeing and understanding the river and its banks. This article reports on the motivations of this project and its projection.

  2. Loe-ära-loe! Eesti lastekirjandus 2007 / Jaanika Palm

    Index Scriptorium Estoniae

    Palm, Jaanika

    2008-01-01

    Hainsalu, Lehte. Rõõmuratas (TEA Kirjastus) ; Vilep, Heiki. Katus sõidab (Vilep & Vallik) ; Vaiksoo, Jaanus. Onu Heino eksis ära (Koolibri) ; Vallik, Aidi. Tirtsti ja turtsti (TEA Kirjastus) ; Trull, Ilmar. Järvevaht ja joogivesi (Eesti Ekspressi Kirjastus) ; Kassel, Riina. Kalliralli (Ilo) ; Kumberg, Krista. Autopõnn Anto lemmiktoit (Koolibri) ; Ojar, Triinu. Suur must koer = Suur must pini (Päike ja Pilv) ; Pervik, Aino. Suleline, Puhuja ja must Munk (Tänapäev) ; Tomusk, Ilmar. Tere, Volli! (Tänapäev) ; Ausman, Piia. Tähtsad asjad (Haus Galerii) ; Ulman, Mihkel. Võlur taskust (Elmatar) ; Tangsoo, Jaan. Kotermann Juko imeline reis läbi Eestimaa (Varrak) ; Made, Reet. Tuhin tiibades (Koolibri) ; Vallik, Aidi. Mis sinuga juhtus, Ann? (Tänapäev)

  3. Search for psipp\\ra\\rho\\pi at BESII

    CERN Document Server

    Ablikim, M

    2005-01-01

    Non-$D\\bar{D}$ decay $\\psppto \\rhopi$ is searched for using a data sample of $(17.3\\pm 0.5)~pb^{-1}$ taken at the center-of-mass energy of 3.773 GeV by the BESII detector at the BEPC. No $\\rhopi$ signal is observed, and the upper limit of the cross section is measured to be $\\sigma(\\EETO \\rhopi)<6.0~pb$ at 90% C. L. Considering the interference between the continuum amplitude and the $\\pspp$ resonance amplitude, the branching fraction of $\\pspp$ decays to $\\rho\\pi$ is determined to be $\\BR(\\pspp\\ra\\rho\\pi)\\in(6.0\\times10^{-6},~2.4\\times10^{-3})$ at 90% C. L. This is in agreement with the prediction of the $S$- and $D$-wave mixing scheme of the charmonium states for solving the ``$\\rhopi$ puzzle'' between $\\jpsi$ and $\\psp$ decays.

  4. Loe-ära-loe! Eesti lastekirjandus 2007 / Jaanika Palm

    Index Scriptorium Estoniae

    Palm, Jaanika

    2008-01-01

    Hainsalu, Lehte. Rõõmuratas (TEA Kirjastus) ; Vilep, Heiki. Katus sõidab (Vilep & Vallik) ; Vaiksoo, Jaanus. Onu Heino eksis ära (Koolibri) ; Vallik, Aidi. Tirtsti ja turtsti (TEA Kirjastus) ; Trull, Ilmar. Järvevaht ja joogivesi (Eesti Ekspressi Kirjastus) ; Kassel, Riina. Kalliralli (Ilo) ; Kumberg, Krista. Autopõnn Anto lemmiktoit (Koolibri) ; Ojar, Triinu. Suur must koer = Suur must pini (Päike ja Pilv) ; Pervik, Aino. Suleline, Puhuja ja must Munk (Tänapäev) ; Tomusk, Ilmar. Tere, Volli! (Tänapäev) ; Ausman, Piia. Tähtsad asjad (Haus Galerii) ; Ulman, Mihkel. Võlur taskust (Elmatar) ; Tangsoo, Jaan. Kotermann Juko imeline reis läbi Eestimaa (Varrak) ; Made, Reet. Tuhin tiibades (Koolibri) ; Vallik, Aidi. Mis sinuga juhtus, Ann? (Tänapäev)

  5. An implanted $^{228}$Ra source for response characterization of bolometers

    CERN Multimedia

    TeO$_{2}$ crystals are used as bolometers in experiments searching for Double $\\beta$ Decay without emission of neutrinos. One of the most important issues in this extremely delicate kind of experiments is the discrimination of the background from the real signal. A deep knowledge of the bolometric response to $\\alpha$-particles is therefore needed to recognize and discard them, since it has been proven that $\\alpha$ surface contamination could be a major contribution in our background budget. We would like to use ISOLDE’s capability of implanting $^{228}$Ra to make a long-lived source feeding several monochromatic $\\alpha$- and recoiling nuclei, with little or no $\\alpha$-peak broadening due to the source itself, for tests of our detectors in Milano and Gran Sasso INFN National Lab.

  6. Raíces griegas: tan lejanas y tan cercanas

    Directory of Open Access Journals (Sweden)

    Ana María Gispert-Sauch Colls

    2011-05-01

    Full Text Available Isidoro de Sevilla en su obra maestra Etimologías, supo unir el “origen”, o sea, de dónde viene un vocablo y la “etimología”, que sería el “por qué” se aplica este vocablo a una realidad concreta. Hizo, pues, una distinción entre etimologías ex causa (según lo que es y etimologías ex origine (según de dónde viene. Y, como de lo que se trataba era decaptar el valor esencial de una palabra, dice Isidoro, “cuando se ha visto de dónde viene un nombre, se comprende más rápidamente su valor, porque el estudio de las realidades es más fácil una vez conocida la etimología” (Etimologías, I, 19, 2. Siguiendo en parte esta orientación, presentamos algunas raíces de verbos griegos, lejanos en referencia al tiempo de su origen, pero presentes en nuestro tiempo a través de sus derivaciones. Y, sobre todo persistentes, porque nos transmiten la esencia de significado, ladensidad semántica, a la que he aludido en varias ocasiones1.De esta forma, el hoy de muchas de nuestras palabras está impregnado de este pasado clásico que nos invita a recuperar permanentemente su esencia. No en vano y refiriéndonos a Sócrates, podríamos decir que la etimología tiene una función “mayéutica”, la de sacar a la luz el núcleofecundo de las palabras. Veamos algunas de dichas raíces.

  7. Estrutura populacional da raça Nelore Mocho

    Directory of Open Access Journals (Sweden)

    Faria F.J.C.

    2002-01-01

    Full Text Available Descreveu-se a estrutura populacional da raça Nelore Mocho utilizando dados do registro genealógico de animais nascidos entre 1969 e 1998. O banco de dados foi separado em quatro períodos de 1979-1983, 1984-1988, 1989-1993 e 1994-1998. Calcularam-se as estatísticas descritivas do número de criadores, de reprodutores e de reprodutrizes. A endogamia total aumentou de 0,55% para 0,98%, a esperada sob acasalamento ao acaso aumentou de 0,11% para 0,56% e a endogamia devido à subdivisão populacional permaneceu constante, ao redor de 0,45%, indicando que a subdivisão genética da raça Nelore Mocho é próxima a zero e praticamente inexistente. O tamanho efetivo populacional foi estimado pelo coeficiente total de endogamia e permaneceu ao redor de 120. A inclusão de animais no livro genealógico aumentou de 4.630 para 13.907, entretanto, esta ação não foi suficiente para incrementar o tamanho efetivo. Baseado na probabilidade de origem do gene foram calculados o número efetivo de fundadores, de ancestrais e de genomas remanescentes. Esses parâmetros decresceram ao longo do período, atingindo valores de 144, 98 e 64. Todas as estimativas foram análogas na descrição da estrutura genética populacional e devem ser consideradas no futuro para o desenvolvimento de programas de seleção.

  8. 230Th, 226Ra and 222Rn in abyssal sediments

    Science.gov (United States)

    Kadko, David

    1980-09-01

    A model that predicts the flux of 222Rn out of deep-sea sediment is presented. The radon is ultimately generated by 230Th which is stripped from the overlying water into the sediment. Data from many authors are compared with the model predictions. It is shown that the continental contribution of ionium is not significant, and that at low sedimentation rates, biological mixing and erosional processes strongly affect the surface concentration of the ionium. Two cores from areas of slow sediment accumulation, one from a manganese nodule region of the central Pacific and one from the Rio Grande Rise in the Atlantic were analyzed at closely spaced intervals for 230Th, 226Ra, and 210Pb. The Pacific core displayed evidence of biological mixing down to 12 cm and had a sedimentation rate of only 0.04 cm/kyr. The Atlantic core seemed to be mixed to 8 cm and had a sedimentation rate of 0.07 cm/kyr. Both cores had less total excess 230Th than predicted. Radium sediment profiles are generated from the 230Th model. Adsorbed, dissolved, and solid-phase radium is considered. According to the model, diffusional losses of radium are especially important at low sedimentation rates. Any particulate, or excess radium input is ignored in this model. The model fits the two analyzed cores if the fraction of total radium available for adsorption-desorption is about 0.5-0.7, and if K, the distribution coefficient, is about 1000. Finally, the flux of radon out of the sediments is derived from the model-generated radium profiles. It is shown that the resulting standing crop of 222Rn in the overlying water may be considered as an added constraint in budgeting 230Th and 226Ra in deep-sea sediments.

  9. The theory and methods of diagnosing and treating rheumatoid arthritis (RA) of Dai ;medicine%基于傣医理论诊治类风湿关节炎方法探析

    Institute of Scientific and Technical Information of China (English)

    潘立文; 王晓明; 杨先振

    2016-01-01

    By reviewing documents and learning from the Dai medicine teachers, the papertried to show the theory and methods of Dai medicine on diagnosing and treating Rheumatoid arthritis (RA). Dai medicine took a note that RA was caused by the unbalance of the interal Sita and affected by the external Paya Longgananhuang. Those pathogeny can make the partial joint and muscle's function abnormal, which resulted in the RA. RA can be separated into three types which are Longmengshahoufeixiang. They could be treated by boththe internal and external treatments. The etiology and pathogenesis of RA and its diagnosis and treatment methods of traditional Dai medicine were profound, unique and useful. It`s worth of clinical application and further researches.%本文总结、分析傣医诊治类风湿关节炎(rheumatoid arthritis, RA)的理论与方法。傣医认为 RA 的病因病机是体内四塔失衡,加之外感风寒湿热诸邪,内外合邪引起关节肌肉局部四塔功能失常而发病。RA在傣医学中辨证分为拢蒙沙喉菲想、噶想与喃想3型,采用内、外验方治之疗效显著。

  10. Chemokines and Chemokine Receptors as Novel Therapeutic Targets in Rheumatoid Arthritis (RA): Inhibitory Effects of Traditional Chinese Medicinal Components

    Institute of Scientific and Technical Information of China (English)

    Xin Chen; Joost J. Oppenheim; O.M.Zack Howard

    2004-01-01

    Chemokines belong to a large family of inflammatory cytokines responsible for migration and accumulation of leukocytes at inflammatory sites. Over the past decade, accumulating evidence indicated a crucial role for chemokines and chemokine receptors in the pathophysiology of rheumatoid arthritis (RA). RA is a chronic autoimmune disease in which the synovial tissue is heavily infiltrated by leukocytes. Chemokines play an important role in the infiltration, localization, retention of infiltrating leukocytes and generation of ectopic germinal centers in the inflamed synovium. Recent evidence also suggests that identification of inhibitors directly targeting chemokines or their receptors may provide a novel therapeutic strategy in RA. Traditional Chinese medicinals (TCMs) have a long history in the treatment of inflammatory joint disease. The basis for the clinical benefits of TCM remains largely unclear. Our studies have led to the identification of numerous novel chemokine/chemokine receptor inhibitors present in anti-inflammatory TCMs. All of these inhibitors were previously reported by other researchers to have anti-arthritic effect, which may be attributable, at least in part, to their inhibitory effect on chemokine and/or chemokine receptor. Therefore, identification of agents capable of targeting chemokine/chemokine receptor interactions has suggested a mechanism of action for several TCM components and provided a means of identifying additional anti-RA TCM. Thus, this approach may lead to the discovery of new inhibitors of chemokines or chemokine receptors that can be used to treat diseases associated with inappropriately overactive chemokine mediated inflammatory reactions. Cellular & Molecular Immunology. 2004;1(5):336-342.

  11. Development of a liquid scintillation method for in vitro determination of {sup 226}Ra and {sup 228} Ra in bioassay samples

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Paulo Cesar P.; Sousa, Wanderson O.; Juliao, Ligia M.Q.C.; Dantas, Bernardo M., E-mail: pcesar@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. The intake of {sup 226}Ra and {sup 228}Ra in humans can occur by inhalation and ingestion and the risk of internal exposure are related to their long half-lives, characteristics of the emission and biokinetics of the isotopes in the human body. The goal of this work is to develop a methodology for the analysis of {sup 226}Ra and {sup 228}Ra in excreta samples (urine and feces), using liquid scintillation technique. Excreta samples were provided by non-exposed humans for the purpose of standardizing the methodology and the establishment of a background level of radium excretion. Radium isotopes were concentrated and separated from the constituents of the sample by co-precipitation with barium sulphate. The precipitate of Ba(Ra)SO{sub 4} was filtrated and weighted for the determination of the chemical yield. The filter containing the precipitate was transferred to a scintillation vial. In the scintillation vial, 8 mL of water, 8 mL of Instagel XF and 4 mL of UltimaGold were added, forming a gel suspension, after stirring the solution. The {sup 226}Ra and {sup 228}Ra activities were determined 21 days after the precipitation of samples. The samples were counted in a liquid scintillation spectrometer. The technique presented adequate sensitivity and reproducibility for the analysis of urine and feces. The activities of {sup 226}Ra and {sup 228}Ra in excreta samples provide useful information for the identification of the main route of intake and for the assessment of the internal exposure of occupationally exposed workers and inhabitants of high background areas. (author)

  12. Evaluation of Lama5 as a candidate for the mouse ragged (Ra) mutation

    DEFF Research Database (Denmark)

    Durkin, M E; Albrechtsen, R; Chambers, D M;

    1998-01-01

    The laminin alpha5 chain is a component of the basement membranes of many developing and adult tissues. The mouse laminin alpha5 chain gene (Lama5) has been mapped close to the locus of the semidominant ragged (Ra) mutation on distal chromosome 2. The cause of the Ra mutation, which is usually...... lethal in the homozygous state, has not been determined. We have investigated whether a defect in Lama5 is responsible for the ragged mutation, using the RaJ strain. No differences in the level of the laminin alpha5 chain transcript were found in placental RNA from homozygous RaJ mutant embryos compared...... to normal littermates. Antiserum raised against a recombinant laminin alpha5 chain polypeptide stained the basement membranes of both normal and homozygous mutant embryos to a similar extent. More precise mapping of Lama5 on an interspecific Ra backcross indicated that Lama5 is proximal to the Ra locus...

  13. EXPRESSION OF IL-13Ra2 GENE IN HUMAN BRAIN TUMORS

    Institute of Scientific and Technical Information of China (English)

    WU An-hua; TIE Xin-xin; WANG Yun-jie; YANG Guo-rui

    2005-01-01

    Objective: To investigate the expression of IL-13Ra2 gene in brain tumors. Methods: Seventy-nine human brain tumors were obtained from the department of Neurosurgery of China Medical University. Human IL-13Ra2 expression was evaluated by reverse transcriptase polymerase chain reaction and immunohistochemical analysis. Results: IL-13Ra2 gene was highly expressed in glioblastoma, medulloblastoma, malignant meningioma and benign meningioma. Conclusion:Human IL-13Ra2 gene is expressed in brain tumors in addition to gliomas, and our result indicates that the IL-13Ra2 gene promoter based gene therapy method can be used to treat brain tumors in addition to gliomas. Further studies involving larger numbers of samples are necessary to fully understand the expression profile of IL-13Ra2 gene in the brain tumors.

  14. Radium-223: From Radiochemical Development to Clinical Applications in Targeted Cancer Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Bruland, Oyvind S.; Jonasdottir, Thora J.; Fisher, Darrell R.; Larsen, Roy H.

    2008-09-15

    The radiochemical properties of radium-223 (223Ra, T1/2 = 11.4 d) render this alpha-emitting radionuclide promising for targeted cancer therapy. Together with its short-lived daughters, each 223Ra decay produces four alpha-particle emissions—which enhance therapy effectiveness at the cellular level. In this paper, we review the recently published data reported for pre-clinical and clinical use of 223Ra in cancer treatment. We have evaluated two distinct chemical forms of 223Ra in vivo: 1) cationic 223Ra as dissolved RaCl2, and 2) liposome-encapsulated 223Ra. Cationic 223Ra seeks metabolically active osteoblastic bone and tumor lesions with high uptake and strong binding affinity based on its similarities to calcium. Based on these properties, we have advanced the clinical use of 223Ra for treating bone metastases from late-stage breast and prostate cancer. The results show impressive anti-tumor activity and improved overall survival in hormone-refractory prostate cancer patients with bone metastases. In other studies, we have evaluated the biodistribution and tumor uptake of liposomally encapsulated 223Ra in mice with human osteosarcoma xenografts, and in dogs with spontaneous osteosarcoma and associated soft tissue metastases. Results indicate excellent biodistributions in both species. In dogs, we found considerable uptake of liposomal 223Ra in cancer metastases in multiple organs, resulting in favorable tumor-to-normal soft tissue ratios. Collectively, these findings show an outstanding potential for 223Ra as a therapeutic agent.

  15. Ionizable (Thia)calix[4]crowns as Highly Selective 226Ra2+ Ionophores

    NARCIS (Netherlands)

    Leeuwen, van Fijs W.B.; Beijleveld, Hans; Miermans, Cornelis J.H.; Huskens, Jurriaan; Verboom, Willem; Reinhoudt, David N.

    2005-01-01

    The 226Ra2+ selectivity of the ionizable (thia)calix[4]crowns 1-4 was determined in the presence of a large excess of the most common alkali and alkaline earth cations. Selective 226Ra2+ (2.9 × 10-8 M) extraction occurs even at extremely high Mn+/226Ra2+ ratios of 3.5 × 107 [Mn+ = Na+, K+, Rb+, Cs+,

  16. Cell therapy centered on IL-1Ra is neuroprotective in experimental stroke

    DEFF Research Database (Denmark)

    Clausen, Bettina Hjelm; Lambertsen, Kate Lykke; Dagnæs-Hansen, Frederik;

    2016-01-01

    Cell-based therapies are emerging as new promising treatments in stroke. However, their functional mechanism and therapeutic potential during early infarct maturation has so far received little attention. Here, we asked if cell-based delivery of the interleukin-1 receptor antagonist (IL-1Ra...... production of IL-1Ra and IL-1α/β identifies microglia, not infiltrating leukocytes, as the major sources of IL-1Ra after experimental stroke, and shows IL-1Ra and IL-1β to be produced by segregated subsets of microglia with a small proportion of these cells co-expressing IL-1α. Reconstitution of whole body...

  17. First Measurement of the Atomic Electric Dipole Moment of (225)Ra.

    Science.gov (United States)

    Parker, R H; Dietrich, M R; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M; Greene, J P; Holt, R J; Korsch, W; Lu, Z-T; Mueller, P; O'Connor, T P; Singh, J T

    2015-06-12

    The radioactive radium-225 ((225)Ra) atom is a favorable case to search for a permanent electric dipole moment. Because of its strong nuclear octupole deformation and large atomic mass, (225)Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of (225)Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic electric dipole moment, reaching an upper limit of |d((225)Ra)|<5.0×10(-22)  e cm (95% confidence).

  18. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  19. First Measurement of the Atomic Electric Dipole Moment of $^{225}$Ra

    CERN Document Server

    Parker, R H; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M N; Greene, J P; Holt, R J; Korsch, W; Lu, Z -T; Mueller, P; O'Connor, T P; Singh, J T

    2015-01-01

    The radioactive radium-225 ($^{225}$Ra) atom is a favorable case to search for a permanent electric dipole moment (EDM). Due to its strong nuclear octupole deformation and large atomic mass, $^{225}$Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of $^{225}$Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic EDM, reaching an upper limit of $|$$d$($^{225}$Ra)$|$ $<$ $5.0\\!\\times\\!10^{-22}$ $e \\cdot$cm (95$\\%$ confidence).

  20. Neuroprotective actions of endogenous interleukin-1 receptor antagonist (IL-1ra) are mediated by glia.

    Science.gov (United States)

    Pinteaux, Emmanuel; Rothwell, Nancy J; Boutin, Herve

    2006-04-01

    The pro-inflammatory cytokine interleukin-1 (IL-1), contributes to neuronal inflammation and cell death induced by ischemia, excitotoxicity, or trauma, while administration of IL-1 receptor antagonist (IL-1ra) reduces neuronal injury. The aim of the present study was to test the hypothesis that endogenous IL-1ra is neuroprotective in vivo and in vitro, and to identify its mechanism of actions. Mice lacking IL-1ra (IL-1ra knock-out (KO]) exhibited a dramatic increase in neuronal injury (3.6-fold increase in infarct size) induced by transient cerebral ischemia compared to wild-type (WT) animals. Basal cell death of cultured cortical neurons from WT and IL-1ra KO was identical, and treatment with NMDA or AMPA (20 microM) increased cell death to the same extent in WT and IL-1ra KO neurons. However, basal and NMDA- or AMPA-induced cells death was significantly higher in glial-neuronal co-cultures from IL-1ra KO than from WT mice. We further showed that pure microglial cultures, but not pure astrocytes cultures, released IL-1ra in response to treatment with conditioned medium from NMDA- or AMPA-treated primary neurons. These results demonstrate that endogenous IL-1ra produced by microglia is neuroprotective in cerebral ischemia or excitotoxicity.

  1. Dosimetry of bone metastases in targeted radionuclide therapy with alpha-emitting {sup 223}Ra-dichloride

    Energy Technology Data Exchange (ETDEWEB)

    Pacilio, Massimiliano [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Medical Physics; Ventroni, Guido; Mango, Lucio [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Nuclear Medicin; De Vincentis, Giuseppe; Di Castro, Elisabetta; Frantellizzi, Viviana; Follacchio, Giulia Anna; Garkavaya, Tatiana [Rome Univ. (Italy). Dept. of Radiological, Oncological and Anatomo Pathological Sciences; Cassano, Bartolomeo; Lorenzon, Leda [Rome Univ. (Italy). Postgraduate School of Medical Physics; Pellegrini, Rosanna; Pani, Roberto [Rome Univ. (Italy). Dept. of Molecular Medicine; Ialongo, Pasquale [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Radiology

    2016-01-15

    percent uptake of {sup 99m}Tc and {sup 223}Ra (activity extrapolated to t = 0) were significantly correlated. The feasibility of in vivo quantitative imaging in {sup 223}Ra therapy was confirmed. The lesion uptake of {sup 223}Ra-dichloride was significantly correlated with that of {sup 99m}Tc-MDP. The D{sub RBE} to lesions per unit administered activity was much higher than that of other bone-seeking radiopharmaceuticals, but considering a standard administration of 21 MBq (six injections of 50 kBq/kg to a 70-kg patient), the mean cumulative value of D{sub RBE} was about 19 Gy, and was therefore in the range of those of other radiopharmaceuticals. The macrodosimetry of bone metastases in treatments with {sup 223}Ra-dichloride is feasible, but more work is needed to demonstrate its helpfulness in predicting clinical outcomes. (orig.)

  2. Synovitis and osteitis are very frequent in rheumatoid arthritis clinical remission: results from an MRI study of 294 patients in clinical remission or low disease activity state

    DEFF Research Database (Denmark)

    Gandjbakhch, Frédérique; Conaghan, Philip G; Ejbjerg, Bo;

    2011-01-01

    In rheumatoid arthritis (RA), radiographic progression may occur despite clinical remission. This may be explained by subclinical inflammation. Magnetic resonance imaging (MRI) provides a greater sensitivity than clinical examination and radiography for assessing disease activity. Our objective w...... was to determine the MRI characteristics of RA patients in clinical remission or low disease activity (LDA) state....

  3. Addition of the Neurokinin-1-Receptor Antagonist (RA) Aprepitant to a 5-Hydroxytryptamine-RA and Dexamethasone in the Prophylaxis of Nausea and Vomiting Due to Radiation Therapy With Concomitant Cisplatin

    Energy Technology Data Exchange (ETDEWEB)

    Jahn, Franziska, E-mail: franziska.jahn@uk-halle.de [Department of Hematology/Oncology, Martin-Luther-University Halle-Wittenberg, Halle (Saale) (Germany); Riesner, Anica [Department of Gastroenterology, Martin-Luther-University Halle-Wittenberg, Halle (Saale) (Germany); Jahn, Patrick [Nursing Research Unit, Martin-Luther-University Halle-Wittenberg, Halle (Saale) (Germany); Sieker, Frank; Vordermark, Dirk [Department of Radiation Oncology, Martin-Luther-University Halle-Wittenberg, Halle (Saale) (Germany); Jordan, Karin [Department of Hematology/Oncology, Martin-Luther-University Halle-Wittenberg, Halle (Saale) (Germany)

    2015-08-01

    Purpose: To assess, in a prospective, observational study, the safety and efficacy of the addition of the neurokinin-1-receptor antagonist (NK1-RA) aprepitant to concomitant radiochemotherapy, for the prophylaxis of radiation therapy–induced nausea and vomiting. Patients and Methods: This prospective observational study compared the antiemetic efficacy of an NK1-RA (aprepitant), a 5-hydroxytryptamine-RA, and dexamethasone (aprepitant regimen) versus a 5-hydroxytryptamine-RA and dexamethasone (control regimen) in patients receiving concomitant radiochemotherapy with cisplatin at the Department of Radiation Oncology, University Hospital Halle (Saale), Germany. The primary endpoint was complete response in the overall phase, defined as no vomiting and no use of rescue therapy in this period. Results: Fifty-nine patients treated with concomitant radiochemotherapy with cisplatin were included in this study. Thirty-one patients received the aprepitant regimen and 29 the control regimen. The overall complete response rates for cycles 1 and 2 were 75.9% and 64.5% for the aprepitant group and 60.7% and 54.2% for the control group, respectively. Although a 15.2% absolute difference was reached in cycle 1, a statistical significance was not detected (P=.22). Furthermore maximum nausea was 1.58 ± 1.91 in the control group and 0.73 ± 1.79 in the aprepitant group (P=.084); for the head-and-neck subset, 2.23 ± 2.13 in the control group and 0.64 ± 1.77 in the aprepitant group, respectively (P=.03). Conclusion: This is the first study of an NK1-RA–containing antiemetic prophylaxis regimen in patients receiving concomitant radiochemotherapy. Although the primary endpoint was not obtained, the absolute difference of 10% in efficacy was reached, which is defined as clinically meaningful for patients by international guidelines groups. Randomized phase 3 studies are necessary to further define the potential role of an NK1-RA in this setting.

  4. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty Bay region

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Tamires de A.; Oliveira, Joselene de, E-mail: tamires.mora@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    In this study, we performed the radiochemical characterization of a sedimentary record (1B profile), collected in the vicinity of Admiralty Bay, King George Island in Antarctic Operation XXXI (January/2013). The activities of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by the counting of gross alpha and gross beta activities in the precipitates of Ba(Ra)SO{sub 4} and PbCrO{sub 4}. Those measurements were carried out in a low background gas flow proportional detector. The {sup 226}Ra and {sup 228}Ra were measured after 21 days of the final precipitation. The {sup 210}Pb activity was determined after 10 days of the precipitation date by gross beta counting of its {sup 210}Bi decay product. The activity concentration of {sup 226}Ra ranged from 11±1 (mBq g-1) to 54±3 (mBq g{sup -1}), and the {sup 228}Ra ranged from 48±5 (mBq g{sup -1}) to 155±16 (mBq g{sup -1}). The activity concentration of {sup 210}Pb varied from 8±1 (mBq g{sup -1}) to 458±46 (mBq g{sup -1}), while unsupported {sup 210}Pb ranged from 6±1 (mBq g{sup -1}) to 434±65 (mBq g{sup -1}). The {sup 210}Pb concentrations in sediments have often been used to dating events like deposition and accumulation in various marine environments. Taking into account the results of {sup 210}Pb and {sup 226}Ra activities obtained in testimony-1B it was estimated the unsupported {sup 210}Pb activity which was applied to the CIC geochronological dating model (Constant Initial Concentration). Based in these data, the sedimentation rate obtained was 0.63±0.02 cm year{sup -1}. (author)

  5. Factors Controlling the Groundwater Transport of U, Th, Ra, and Rn

    Indian Academy of Sciences (India)

    A Tricca; D Porcelli; G J Wasserburg

    2000-03-01

    A model for the groundwater transport of naturally occurring U, Th, Ra, and Rn nuclides in the 238U and 232Th decay series is discussed. The model developed here takes into account transport by advection and the physico-chemical processes of weathering, decay, -recoil, and sorption at the water-rock interface. It describes the evolution along a flowline of the activities of the 238U and 232Th decay series nuclides in groundwater. Simple sets of relationships governing the activities of the various species in solution are derived, and these can be used both to calculate effective retardation factors and to interpret groundwater data. For the activities of each nuclide, a general solution to the transport equation has been obtained, which shows that the activities reach a constant value after a distance $\\bar{x}_i$, characteristic of each nuclide. Where $\\bar{x}_i$ is much longer than the aquifer length, (for 238U, 234U, and 232Th), the activities grow linearly with distance. Where $\\bar{x}_i$ is short compared to the aquifer length, (for 234Th, 230Th, 228Th, 228Ra, and 224Ra), the activities rapidly reach a constant or quasi-constant activity value. For 226Ra and 222Rn, the limiting activity is reached after 1 km. High 234U values (proportional to the ratio 234Th/W238U) can be obtained through high recoil fraction and/or low weathering rates. The activity ratios 230Th/232Th, 228Ra/226Ra and 224Ra/226Ra have been considered in the cases where either weathering or recoil is the predominant process of input from the mineral grain. Typical values for weathering rates and recoil fractions for a sandy aquifer indicate that recoil is the dominant process for Th isotopic ratios in the water. Measured data for Ra isotope activity ratios indicate that recoil is the process generally controlling the Ra isotopic composition in water. Higher isotopic ratios can be explained by different desorption kinetics of Ra. However, the model does not provide an explanation for 228Ra

  6. Impossible cartographies: approaching Raúl Ruiz’s cinema

    Directory of Open Access Journals (Sweden)

    Michael Goddard

    2013-06-01

    Full Text Available Raúl Ruiz (1931-2011, while considered one of the world’s most significant filmmakers by several film critics, is yet to be the subject of any thorough academic engagement with his work in English. My book Impossible Cartographies sets out on this task by mapping, as fully as possible, Ruiz’s cinematic trajectory across more than five decades of prolific work ranging from his earliest work in Chile to high budget ‘European’ costume dramas culminating in the recent Mysteries of Lisbon (2010. It does this by treating Ruiz’s work, with its surrealist, magic realist, popular cultural and neo-Baroque sources, as a type of ‘impossible’ cinematic cartography, mapping real, imaginary and virtual spaces, and crossing between different cultural contexts, aesthetic strategies, and technical media. In argues that across the different phases of Ruiz’s work identified, there are key continuities such as the invention of singular cinematic images and the interrogation of their possible and impossible combinations. This article will present some of the key themes of Ruiz’s cinema and use ideas of virtual cartography, tableaux vivants and the neo-baroque to illuminate a range of Ruiz’s films from the Hypothesis of the Stolen Painting (1978 to Mysteries of Lisbon, his last major project.

  7. Specificities of anti-neutrophil autoantibodies in patients with rheumatoid arthritis (RA)

    DEFF Research Database (Denmark)

    Brimnes, J; Halberg, P; Jacobsen, Søren;

    1997-01-01

    The objective of this study was to characterize antigens recognized by neutrophil-specific autoantibodies from patients with RA. Sera from 62 RA patients were screened by indirect immunofluorescence (IIF). Positive sera were further tested by ELISAs for antibodies against various granule proteins...

  8. Role of CCR5 Delta 32 bp deletion in RA and SLE

    NARCIS (Netherlands)

    Martens, H. A.; Kallenberg, C. G. M.; Bijl, M.

    2009-01-01

    CCR5 and its ligands play important roles in rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE). A deletion of 32 bp in its gene leads to the production of a non-functional receptor. Although a protective effect of CCR5 Delta 32 for the development of RA has been suggested, future stud

  9. Towards a Precise Measurement of Atomic Parity Violation in a Single Ra+ Ion

    NARCIS (Netherlands)

    Jungmann, K.; Giri, G. S.; Versolato, O. O.; Steadman, SG; Stephans, GSF; Taylor, FE

    2012-01-01

    In the singly charged Ra+ ion the contributions of the weak interactions to the atomic level energies are some 50 times larger than in the Cs atom. We report the results of laser spectroscopy experiments on Ra-209-214(+) isotopes in preparation of a precision atomic parity violation experiment. Expe

  10. Data of evolutionary structure change: 1EOTA-2RA4B [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EOTA-2RA4B 1EOT 2RA4 A B GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAV...ine>PRO CA 148 1EOT A 1EOTA...23633 0.1720000058412552 -0.8870000243186951 0.42500001192092896...05 0.460999995470047 0.7990000247955322 0.38499999046325684

  11. Data of evolutionary structure change: 1EOTA-2RA4A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EOTA-2RA4A 1EOT 2RA4 A A GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAV...ine> PRO CA 155 1EOT A 1EOTA...0198364258 21.238000869750977 tion> 0.04600000008940697 0.976999998092...7935 -0.8989999890327454 -0.05000000074505806 -0.4350000023841858

  12. Comparative Genre Analysis on RA Introductions of Computer Science Using CARS Model

    Institute of Scientific and Technical Information of China (English)

    杨文静

    2013-01-01

    Using Swales’CARS model, the present study combines the methods of quantitative analysis and qualitative analysis and makes a comparative analysis on the moves and steps of RA introductions between Chinese English journals and international English journals, which will benefit researchers in RA writing and publishing in core English journals.

  13. 76 FR 63701 - Culturally Significant Objects Imported for Exhibition Determinations: “Johan Zoffany RA: Society...

    Science.gov (United States)

    2011-10-13

    ... Culturally Significant Objects Imported for Exhibition Determinations: ``Johan Zoffany RA: Society Observed... determine that the objects to be included in the exhibition ``Johan Zoffany RA: Society Observed,'' imported... that the exhibition or display of the exhibit objects at the Yale Center for British Art, New...

  14. Persistence of octupole correlations in sup 2 sup 3 sup 1 Ra

    CERN Document Server

    Fraile-Prieto, L M; Mach, H; Boutami, R; Aas, A J; Fogelberg, B; García-Raffi, L M; Grant, I S; Gulda, K; Hageboe, E; Kurcewicz, W; Kvasil, J; López, M J; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2001-01-01

    The structure of sup 2 sup 3 sup 1 Ra, the heaviest odd Ra nucleus currently accessible for detailed spectroscopic investigation, has been studied in the beta sup - decay of sup 2 sup 3 sup 1 Fr. The main purpose has been to verify whether fast B(E1) rates and significant octupole correlations recently established in sup 2 sup 2 sup 9 Ra persist in sup 2 sup 3 sup 1 Ra. The excited states in sup 2 sup 3 sup 1 Ra have been determined for the first time. Spins and parities have been deduced from conversion electron measurements, while level half-lives in the ps and ns ranges have been measured with the Advanced Time Delayed beta gamma gamma(t) method. The moderately fast B(E1) rates found for transitions connecting the lowest-lying K suppi=5/2 sup+- and K suppi=1/2 sup+- bands, reveal the persistence of octupole collective effects in sup 2 sup 3 sup 1 Ra, although the B(E1) rates are lower than in sup 2 sup 2 sup 9 Ra. These findings reinforce the differences in the B(E1) systematics between isotonic Ra and Th ...

  15. Determination of {sup 226}Ra Isotope in the Leachate around Phosphogypsum Stack Using Ethylenediaminetetraacetic Acid (EDTA)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geun Ho; Kim, Yong Jae; Chang, Byung Uck [University of Science and Tecknology, Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2011-12-15

    Ba is the most useful element to get the Ba(Ra)SO{sub 4} precipitate. However, when the high concentrations of ions such as sulfate, calcium are existed in the leachate of phosphogypsum stack, it is difficult to get the Ba(Ra)SO{sub 4} precipitate. Since this reason, the developed method for the Ba coprecipitate using EDTA was performed to determine the {sup 226}Ra concentration in the high sulfate sample. The average concentration of {sup 226}Ra in a leachate of phosphogypsum using this method was 0.102 Bq{center_dot}kg{sup -1} and the minimal detectable activity is 3.4 mBq{center_dot}kg{sup -1}. The mBq{center_dot}kg{sup -1} method was 0.102 Bq{center_dot}kg{sup -1} and the minimal detectable activity is 3.4 mBq{center_dot}kg{sup -1}. The {sup 226}Ra stock solution and the CRM (Certified Reference Material) were analyzed to verify this method. In analyzed {sup 226}Ra stock solution, bias with added concentration was approximately 1% and the correlation curve between {sup 226}Ra concentration in simulated standard sample and measured {sup 226}Ra concentration showed good agreement with a correlation coefficient (R{sup 2}) of 0.99. In analyzed CRM, maximum bias with reference value was 5.8% (k=1) and the analytical results were in good agreement with the reference value.

  16. Isolated EWiRaC: A New Low-Stress Single-Stage Isolated PFC Converter

    DEFF Research Database (Denmark)

    Schneider, Henrik; Bergendorff, Stefan Pihl; Petersen, Lars;

    2007-01-01

    A new PFC-family of Efficient Wide Range Converters named EWiRaC was recently introduced. EWiRaC has a major advantage in terms of efficiency at low-line and handles challenges like inrush current limiting as an integrated part of the conversion scheme. The main objective of this paper...

  17. Gender, body mass index and rheumatoid arthritis disease activity: results from the QUEST-RA Study

    DEFF Research Database (Denmark)

    Jawaheer, D; Olsen, J; Lahiff, M

    2010-01-01

    To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner.......To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner....

  18. Leachable 226Ra in Philippine phosphogypsum and its implication in groundwater contamination in Isabel, Leyte, Philippines.

    Science.gov (United States)

    Cañete, Socrates Jose P; Palad, Lorna Jean H; Enriquez, Eliza B; Garcia, Teofilo Y; Yulo-Nazarea, Teresa

    2008-07-01

    Phosphogypsum (PG), the major waste material in phosphate fertilizer processing, has been known to contain enhanced levels of naturally-occurring radionuclides especially (226)Ra. The lack of radioactivity data regarding Philippine phosphogypsum and its environmental behavior in the Philippine setting has brought concern on possible contamination of groundwater beneath the phosphogypsum ponds in Isabel, Leyte, Philippines. The radioactivity of Philippine phosphogypsum was determined and the leaching of (226)Ra from phosphogypsum and through local soil was quantified. Level of (226)Ra in groundwater samples in Isabel, Leyte, Philippines was also quantified to address the primary concern. It was found that the (226)Ra activity in Philippine phosphogypsum is distributed in a wide range from 91.5 to 935 Bq/kg. As much as 5% of (226)Ra can be leached from Philippine PG with deionized water. In vitro soil leach experiments suggest that the soil in the phosphate fertilizer plant area would be able to deter the intrusion of (226)Ra into the water table. Compared to reported values of natural groundwater levels of (226)Ra, the concentration of this radionuclide in Isabel, Leyte groundwater suggest that there is no (226)Ra intrusion brought about by the presence of phosphogypsum ponds in the area.

  19. Ion neutralisation mass-spectrometry route to radium monofluoride (RaF)

    CERN Document Server

    Isaev, T A; Willmann, L; Berger, R

    2013-01-01

    The diatomic molecule radium monofluoride (RaF) has recently been proposed as a versatile probe for physics beyond the current standard model. Herein, a route towards production of a RaF molecular beam via radium ions is proposed. It takes advantage of the special electronic structure expected for group 2 halides and group 2 hydrides: The electronic ground state of neutral RaF and its monocation differ in occupation of a non-bonding orbital of $\\sigma$ symmetry. This implies similar equilibrium distances and harmonic vibrational wavenumbers in the two charge states and thus favourable Franck--Condon factors for neutralisation without dissociation in neutralising collisions. According to the calculated ionisation energy of RaF, charge exchange collisions of RaF$^+$ with sodium atoms are almost iso-enthalpic, resulting in large cross-sections for the production of neutral radium monofluoride.

  20. Systematic study of heavy cluster emission from {210-226}^Ra isotopes

    CERN Document Server

    Santhosh, K P; Priyanka, B; Unnikrishnan, M S

    2012-01-01

    The half lives for various clusters lying in the cold reaction valleys of {210-226}^Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of 4^He and 14^C clusters from {210-226}^Ra isotopes are in good agreement with experimental data. Half lives are also computed using the Universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic 208^Pb daughter in cluster decay process. Geiger - Nuttall plots for all clusters up to 62^Fe are studied and are found to be linear with different slopes and intercepts. {12,14}^C emission from 220^Ra; 14^C emission from {222,224}^Ra; 14^C and 20^O emission from 226^Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  1. Adenovirus-mediated transfer of RA538 gene and its antitumor effect

    Institute of Scientific and Technical Information of China (English)

    程金科; 林晨; 隗玥; 张雪艳; 邢嵘; 牟巨伟; 王秀琴; 吴旻

    1999-01-01

    The RA538 cDNA was transferred into human ovarian cancer cell line SK-OV-3 and human melanoma cell line WM-983A by its recombinant adenoviral vector constructed through homologous recombination. It was demonstrated that the recombinant adenovirus could transfer RA538 gene with high efficiency, and could obviously inhibit tumor growth, with the inhibiting rates of 85% and 73% respectively, at the same time greatly repress the colony forming ability of the cells. The therapeutic experiments on transplanted subcutaneous tumor model in nude mice demonstrated that RA538 could significantly inhibit tumor growth. Flow cytometry and DNA fragmentation analysis indicated that RA538 could induce the cell cycle G1 arrest/apoptosis of the tumor cells. The expression of cmyc gene was found pronouncedly reduced by Western blot analysis. These results suggest that the RA538 recombinant adenovirus could be a promising drug in cancer gene therapy.

  2. Distribution of 226Ra Radionuclide in Upwelling Event Off Ulsan, Gampo and Pohang, Korea

    Directory of Open Access Journals (Sweden)

    Muslim

    2009-07-01

    Full Text Available Upwelling is an important event in the sea for it makes the area to become more productive. The objective of this study is to determine the distribution of radium-226 as radiotoxic in the upwelling area in the summer season. Measurements of the horizontal and vertical activities of 226Ra in the Ulsan, Gampo and Pohang waters were conducted in June, August 1999 and June 2000 when the upwelling event was expected to occur. Water temperature, salinity and dissolved oxygen (DO were also measured concurrently. The thermocline layer or the layer where the temperature decreased drastically occurred at a depth between 30 m to 100 m for samples dated June 1999 and 30 m to more than 100 m for samples dated August 1999 and June 2000. The salinity decreased with depth but the DO concentration increased in this layer. The condition affected the vertical distribution of 226Ra in the study area, where the 226Ra activities showed to be relatively homogeneous vertically in each station. This indicates that the upwelling which occurred in the study area was capable to distribute the 226Ra activities from the bottom to the surface. Thus, the 226Ra distribution at that time did not increase with depth, opposite to what usually occurs in the ocean at normal condition. The 226Ra activities also did not decrease after elapsed time of one year, in fact, it increased. However, horizontally the 226Ra activities decreased with increasing distance from the coastal zone. Based on these results, it can be concluded that the upwelling event in the Ulsan, Gampo and Pohang was effective for increasing the 226Ra activities and was capable to create homogeneous 226Ra activities from the bottom to the surface in the water column, and the source of 226Ra was likely to originate from outside area (i.e. coastal zone and bottom area.

  3. The CpxRA two-component system is essential for Citrobacter rodentium virulence.

    Science.gov (United States)

    Thomassin, Jenny-Lee; Giannakopoulou, Natalia; Zhu, Lei; Gross, Jeremy; Salmon, Kristiana; Leclerc, Jean-Mathieu; Daigle, France; Le Moual, Hervé; Gruenheid, Samantha

    2015-05-01

    Citrobacter rodentium is a murine intestinal pathogen used as a model for the foodborne human pathogens enterohemorrhagic Escherichia coli and enteropathogenic E. coli. During infection, these pathogens use two-component signal transduction systems to detect and adapt to changing environmental conditions. In E. coli, the CpxRA two-component signal transduction system responds to envelope stress by modulating the expression of a myriad of genes. Quantitative real-time PCR showed that cpxRA was expressed in the colon of C57BL/6J mice infected with C. rodentium. To determine whether CpxRA plays a role during C. rodentium infection, a cpxRA deletion strain was generated and found to have a colonization defect during infection. This defect was independent of an altered growth rate or a defective type III secretion system, and single-copy chromosomal complementation of cpxRA restored virulence. The C. rodentium strains were then tested in C3H/HeJ mice, a lethal intestinal infection model. Mice infected with the ΔcpxRA strain survived infection, whereas mice infected with the wild-type or complemented strains succumbed to infection. Furthermore, we found that the cpxRA expression level was higher during early infection than at a later time point. Taken together, these data demonstrate that the CpxRA two-component signal transduction system is essential for the in vivo virulence of C. rodentium. In addition, these data suggest that fine-tuned cpxRA expression is important for infection. This is the first study that identifies a C. rodentium two-component transduction system required for pathogenesis. This study further indicates that CpxRA is an interesting target for therapeutics against enteric pathogens.

  4. Dosimetric influence of filtered and flattening filter free photon beam on rapid arc (RA) radiotherapy planning in case of cervix carcinoma.

    Science.gov (United States)

    Kumar, Lalit; Yadav, Girigesh; Samuvel, Kothanda Raman; Bhushan, Manindra; Kumar, Pawan; Suhail, Mahammood; Pal, Manoj

    2017-01-01

    To investigate the dosimetric influence of filtered and flattening filter free (FFF) photon beam of 6 and 10 MV energies on cervix RA radiotherapy planning and to find possibilities to develop the clinically acceptable RA plans with FFFB photon beam and explore their potential benefits to cervix cancer patients. FFF photon beams enhances the treatment delivery by increased dose rate which results in shorter treatment time, this shorter treatment time reduces intrafraction motion and enhance comfort to the patients. RA plans were generated for filtered and flattening filter free photon beams of 6 and 10 MV energies using same dose-volumes constraints. RA plans were generated to deliver a dose of 50.4 Gy in 28 fractions, for a cohort of eleven patients reported with cervix carcinoma. RA plans were evaluated in terms of PTV coverage, dose to OAR's, CI, HI, total no. of monitor units (MUs) and NTID and low dose volume of normal tissues. Clinically acceptable and similar plans were generated for filtered and flattening filter free photon beams. FFFB delivered slightly higher mean target dose (52.28 Gy vs. 52.0 Gy, p = 0.000 for 6 MV and 52.42 Gy vs. 52.0 Gy, p = 0.000 for 10 MV) less homogeneous (1.062 vs. 1.052, p = 0.000 for 6 MV and 1.066 vs. 1.051, p = 0.000 for 10 MV) and less conformal (1.007 vs. 1.004, p = 0.104 for 6 MV and 1.012 vs. 1.003, p = 0.010 for 10 MV) RA plans compared to FB. FFFB delivered more doses to the bladder and rectum, also required more numbers of MUs in comparison to FB. This study concludes that FB is more beneficial for cervix RA planning in comparison to FFFB, as FB generates more conformal and homogenous rapid arc plans and offers better OAR's sparing.

  5. POLITIK ETIS KEPAHLAWANAN RA KARTINI: MENGUAK SPIRITUALISME KARTINI YANG DIGELAPKAN

    Directory of Open Access Journals (Sweden)

    Nur Said

    2016-03-01

    Full Text Available Artikel ini membahas tiga isu utama terkait kepahlawanan RA Kartini di Indonesia: (1 Apa saja pertimbangan politikpemerintah dalam menetapkan Kartini sebagai pahlawanannasional?; (2 Bagaimana arkeologi pemikiran Kartiniterbentuk sehingga dikenal sebagai tokoh emansipasiwanita di Indonesia?, (3 Mengapa spiritualisme Kartinicenderung tersembunyi?, Makalah ini ditulis berdasarkanpenelitian perpustakaan dengan pendekatan filosofis.Kesimpulan dari artikel ini adalah: (1 Penentuan Kartinisebagai pahlawan tak lepas dari kepentingan politik. (2Telah terjadi intervensi dari orientalis yang mengesankanKartini sebagai seorang sekuler dan penganut feminis Barat.(3 Kartini adalah seorang Muslim yang kritis bahkan diatidak ragu-ragu untuk memberikan gugatan dan kritik tajamdari fenomena keagamaan yang kurang mendidik, termasukdalam pembelajaran dari Al-Qur’an. Hal ini telah benar benar mencapai tingkat tertinggi kesadaran Kartini sebagai “hambaAllah” yang anti-feodalisme dan kolonialisme. kata kunci: Kepahlawanan Kartini, Spiritualisme, kolonialisme, politik etis   This article discusses three focus issues: (1 What kindsof political interest in deciding behind the heroism ofKartini?; (2 What is the archaeological thought of  Kartinidespite his heroic figure?, (3 Why does the spiritualismof Kartini inclined hidden behind the frenzied heroismKartini that tends to make it as an object of ethical politics of dutch colonialism? This paper was writtenbased on library research with philosophical approaches.Conclusions of this article are: (1 the determinationof Kartini as an hero could not be separated from thepolitical intrigues. (2 Due to the intervention of theOrientalist writer has impressed Kartini be secular andWestern feminist adherents. (3 Kartini is a Muslimcritical even she did not hesitate to give the lawsuit andsharp criticism of the religious phenomenon which doesnot educate, including the learning of the Qur’an. It hasactually reached the

  6. High sensitivity measurement of 224Ra and 226Ra in water with an improved hydrous titanium oxide technique at the Sudbury Neutrino Observatory

    CERN Document Server

    Aharmim, B; Dai, X; Doucas, G; Farine, J; Fergani, H; Ford, R; Hahn, R L; Hallman, E D; Jelley, N A; Lange, R; Majerus, S; Mifflin, C; Noble, A J; O'Keeffe, H M; Rodriguez-Jimenez, R; Sinclair, D; Yeh, M

    2008-01-01

    The existing hydrous titanium oxide (HTiO) technique for the measurement of 224Ra and 226Ra in the water at the Sudbury Neutrino Observatory (SNO) has been changed to make it faster and less sensitive to trace impurities in the HTiO eluate. Using HTiO-loaded filters followed by cation exchange adsorption and HTiO co-precipitation, Ra isotopes from 200-450 tonnes of heavy water can be extracted and concentrated into a single sample of a few millilitres with a total chemical efficiency of 50%. Combined with beta-alpha coincidence counting, this method is capable of measuring 2.0x10^3 uBq/kg of 224Ra and 3.7x10^3 uBq/kg of 226Ra from the 232Th and 238U decay chains, respectively, for a 275 tonne D2O assay, which are equivalent to 5x10^16 g Th/g and 3x10^16 g U/g in heavy water.

  7. Ra-228, Ra-226, Pb-210 and Po-210 variations in the water columns and the surface water plankton in the Luzon Strait and northern South China Sea

    Science.gov (United States)

    Chung, Y.; Lin, C.; Wang, P.; Su, Y.

    2006-12-01

    Profiles of Ra-228, Ra-226, Pb-210 and Po-210 were measured in the Luzon Strait (LS) and northern South China Sea (SCS) areas to delineate the exchanges between the western Philippine Sea (WPS) and the northern SCS waters across the LS. Plankton samples were also collected for Po-210 and Pb-210 measurements to assess the balance between the Po-210 excess over Pb-210 in the plankton and the deficit in the surface water. Profiles of Ra-228 and Ra-226 seem to indicate the out flow of the SCS water below the salinity minimum and above around 1500m depth, below which the WPS water flows into the SCS through the LS above a sill depth of about 2600m. This is consistent with previous studies conducted in the area. All the Pb-210 profiles show a strong subsurface maximum with higher activity in the LS area. This maximum is in large excess over its parent, Ra-226 due to atmospheric input. Po-210 profiles generally follow the associated Pb-210 profiles but with lower activities, showing Po-210 deficiency. Po-210 is strongly enriched over Pb-210 in the plankton samples with an activity ratio generally over 10 and up to 40. Both nuclides in the plankton are higher in the LS area, a trend similar to the surface water. The Po-210 excess in the plankton can account for at least 70 percent of the surface water deficit, part of which may be removed by sinking particles.

  8. 226Ra and 228Ra tracer study on material transport in the east coast of Hainan Island, China: a case of nutrients

    Directory of Open Access Journals (Sweden)

    Ni SU

    2011-06-01

    Full Text Available Material fluxes (e.g. nutrients from coast to offshore play an important role in controlling the water quality in the concerned adjacent sea not only by the increase of nutrient concentration but by the change of nutrient structure. In the present work, naturally occurring isotopes (226Ra and 228Ra had been measured by alpha spectrometry in Wenjiao/Wenchang and Wanquan river estuaries and adjacent sea water of the east coast of Hainan Island. The excess dissolved 226Ra and 228Ra activities were observed in comparison with the values expected from the conservative mixing of freshwater and seawater end-members in both estuaries. Using 1-Dimensional Diffusion model, the estimated horizontal eddy diffusion coefficients (Kh derived from 228Ra activities away from its sources was 3.16?105 cm2 s-1. Furthermore, the corresponding nutrient fluxes into the coastal area were assessed. The results can provide useful information for the processes of mixing and exchange of coastal water as well as the transportation of dissoluble pollutants in this sea area.

  9. De-repression of RaRF-mediated RAR repression by adenovirus E1A in the nucleolus.

    Science.gov (United States)

    Um, Soo-Jong; Youn, Hye Sook; Kim, Eun-Joo

    2014-02-21

    Transcriptional activity of the retinoic acid receptor (RAR) is regulated by diverse binding partners, including classical corepressors and coactivators, in response to its ligand retinoic acid (RA). Recently, we identified a novel corepressor of RAR called the retinoic acid resistance factor (RaRF) (manuscript submitted). Here, we report how adenovirus E1A stimulates RAR activity by associating with RaRF. Based on immunoprecipitation (IP) assays, E1A interacts with RaRF through the conserved region 2 (CR2), which is also responsible for pRb binding. The first coiled-coil domain of RaRF was sufficient for this interaction. An in vitro glutathione-S-transferase (GST) pull-down assay was used to confirm the direct interaction between E1A and RaRF. Further fluorescence microscopy indicated that E1A and RaRF were located in the nucleoplasm and nucleolus, respectively. However, RaRF overexpression promoted nucleolar translocation of E1A from the nucleoplasm. Both the RA-dependent interaction of RAR with RaRF and RAR translocation to the nucleolus were disrupted by E1A. RaRF-mediated RAR repression was impaired by wild-type E1A, but not by the RaRF binding-defective E1A mutant. Taken together, our data suggest that E1A is sequestered to the nucleolus by RaRF through a specific interaction, thereby leaving RAR in the nucleoplasm for transcriptional activation.

  10. Studies on sup(226) Ra and sup(210) Pb activities and the concentration factors of sup(226) Ra in the surface organic layers of the estuarine sediments of Mindola and Purna rivers in India

    Digital Repository Service at National Institute of Oceanography (India)

    Joshi, L.U.; Zingde, M.D.; Desai, B.N.

    consumed by humans The sampling techniques, experimental procedures and the distribution of the isotopes of sup(226) Ra and sup(210) Pb in the estuarine regions and the concentration factors of sup(226) Ra in the region are detailed....

  11. Early administration of IL-6RA does not prevent radiation-induced lung injury in mice

    Directory of Open Access Journals (Sweden)

    Inoue Takehiro

    2010-04-01

    Full Text Available Abstract Background Radiation pneumonia and subsequent radiation lung fibrosis are major dose-limiting complications for patients undergoing thoracic radiotherapy. Interleukin-6 (IL-6 is a pleiotropic cytokine and plays important roles in the regulation of immune response and inflammation. The purpose of this study was to investigate whether anti-IL-6 monoclonal receptor antibody (IL-6RA could ameliorate radiation-induced lung injury in mice. Methods BALB/cAnNCrj mice having received thoracic irradiation of 21 Gy were injected intraperitoneally with IL-6RA (MR16-1 or control rat IgG twice, immediately and seven days after irradiation. Enzyme-linked immunosorbent assay was used to examine the plasma level of IL-6 and serum amyloid A (SAA. Lung injury was assessed by histological staining with haematoxylin and eosin or Azan, measuring lung weight, and hydroxyproline. Results The mice treated with IL-6RA did not survive significantly longer than the rat IgG control. We observed marked up-regulation of IL-6 in mice treated with IL-6RA 150 days after irradiation, whereas IL-6RA temporarily suppressed early radiation-induced increase in the IL-6 release level. Histopathologic assessment showed no differences in lung section or lung weight between mice treated with IL-6RA and control. Conclusions Our findings suggest that early treatment with IL-6RA after irradiation alone does not protect against radiation-induced lung injury.

  12. Early administration of IL-6RA does not prevent radiation-induced lung injury in mice.

    Science.gov (United States)

    Ogata, Toshiyuki; Yamazaki, Hideya; Teshima, Teruki; Kihara, Ayaka; Suzumoto, Yuko; Inoue, Takehiro; Nishimoto, Norihiro; Matsuura, Nariaki

    2010-04-07

    Radiation pneumonia and subsequent radiation lung fibrosis are major dose-limiting complications for patients undergoing thoracic radiotherapy. Interleukin-6 (IL-6) is a pleiotropic cytokine and plays important roles in the regulation of immune response and inflammation. The purpose of this study was to investigate whether anti-IL-6 monoclonal receptor antibody (IL-6RA) could ameliorate radiation-induced lung injury in mice. BALB/cAnNCrj mice having received thoracic irradiation of 21 Gy were injected intraperitoneally with IL-6RA (MR16-1) or control rat IgG twice, immediately and seven days after irradiation. Enzyme-linked immunosorbent assay was used to examine the plasma level of IL-6 and serum amyloid A (SAA). Lung injury was assessed by histological staining with haematoxylin and eosin or Azan, measuring lung weight, and hydroxyproline. The mice treated with IL-6RA did not survive significantly longer than the rat IgG control. We observed marked up-regulation of IL-6 in mice treated with IL-6RA 150 days after irradiation, whereas IL-6RA temporarily suppressed early radiation-induced increase in the IL-6 release level. Histopathologic assessment showed no differences in lung section or lung weight between mice treated with IL-6RA and control. Our findings suggest that early treatment with IL-6RA after irradiation alone does not protect against radiation-induced lung injury.

  13. U-238 - Th-230 - Ra-226 disequilibria in volcanics: A new insight into melting conditions

    Science.gov (United States)

    Chabaux, Francois; Allegre, Claude J.

    1994-08-01

    Using new mass spectrometry techniques developed for the analysis of Ra isotopes, we present U-238 - Th-230 - Ra-226 disequilibria data from a variety of volcanic settings, and compare them with previously published data. Two correlations are observed with alkali volcanic data, one between (Th-230/U-238) and (Th-230/Ra-226) and another between the intensity of the disequilibria and the buoyancy flux of the underlying plume. These two correlations prove that partial melting is the major cause of U-Th-Ra fractionations in this volcanic context. The U-238 - Th-230 - Ra-226 disequilibria then place new constraints on some parameters of the classical melting models (batch melting and dynamic melting). The comparison of U-238 - Th-230 - Ra-226 disequilibria in alkali volcanics, carbonatites and subduction zones shows a clear parallel between the disequilibria value and the type of volcanic context. Such a parallel reflects the diversity of the conditions of magma generation, and shows that the U-238 - Th-230 - Ra-226 disequilibria systematics are very dependent on the chemical composition of liquids produced during magmatic processes. A systematic difference is observed between disequilibria in MORB and in alkali volcanics, which could indicate that the melting processes in these two volcanic contexts are very different.

  14. Sanshool on The Fingertip Interferes with Vibration Detection in a Rapidly-Adapting (RA) Tactile Channel

    Science.gov (United States)

    Kuroki, Scinob; Hagura, Nobuhiro; Nishida, Shin’ya; Haggard, Patrick; Watanabe, Junji

    2016-01-01

    An Asian spice, Szechuan pepper (sanshool), is well known for the tingling sensation it induces on the mouth and on the lips. Electrophysiological studies have revealed that its active ingredient can induce firing of mechanoreceptor fibres that typically respond to mechanical vibration. Moreover, a human behavioral study has reported that the perceived frequency of sanshool-induced tingling matches with the preferred frequency range of the tactile rapidly adapting (RA) channel, suggesting the contribution of sanshool-induced RA channel firing to its unique perceptual experience. However, since the RA channel may not be the only channel activated by sanshool, there could be a possibility that the sanshool tingling percept may be caused in whole or in part by other sensory channels. Here, by using a perceptual interference paradigm, we show that the sanshool-induced RA input indeed contributes to the human tactile processing. The absolute detection thresholds for vibrotactile input were measured with and without sanshool application on the fingertip. Sanshool significantly impaired detection of vibrations at 30 Hz (RA channel dominant frequency), but did not impair detection of higher frequency vibrations at 240 Hz (Pacinian-corpuscle (PC) channel dominant frequency) or lower frequency vibrations at 1 Hz (slowly adapting 1 (SA1) channel dominant frequency). These results show that the sanshool induces a peripheral RA channel activation that is relevant for tactile perception. This anomalous activation of RA channels may contribute to the unique tingling experience of sanshool. PMID:27935970

  15. Antibodies to Infliximab and Adalimumab in Patients with Rheumatoid Arthritis in Clinical Remission

    DEFF Research Database (Denmark)

    Eng, Grith P; Bendtzen, Klaus; Bliddal, Henning;

    2015-01-01

    Objective. To investigate if antibodies towards biological TNF-α inhibitors (anti-TNFi Abs) are present in patients with rheumatoid arthritis (RA) in clinical remission and to relate any anti-TNFi Abs to circulating level of TNF-α inhibitor (TNFi). Methods. Patients with RA, treated with infliximab....... These data suggest that continued infliximab treatment may be redundant in a proportion of RA patients treated with infliximab and in clinical remission....

  16. Agressividade de três raças de Cercospora sojina em folhas de soja

    Directory of Open Access Journals (Sweden)

    Juliane Nicolodi Camera

    2014-06-01

    Full Text Available Este trabalho teve como objetivo avaliar a patogenicidade e a agressividade de três raças de Cercospora sojina, em dois cultivares de soja, BMX Magna e Bragg. Para isso, preparou-se suspensão, na concentração de 40 x 10³ conídio mL-1, para inoculação das plantas. Quinze dias após a inoculação com o fungo, verificou-se que a severidade e o número de lesões por folíolo, para a raça 23, não apresentaram diferenças estatísticas entre os cultivares. Para as raças 24 e 25, o cultivar BMX Magna apresentou maior valor do grau de infecção, diferindo estatisticamente daquele do cultivar Bragg. Com relação ao diâmetro das lesões, para a raça 23, o cultivar Bragg apresentou maior valor, para a raça 24, o maior valor ocorreu em BMX Magna e para a raça 25, não houve diferença estatística entre os cultivares. Portanto, as raças de C. sojina são patogênicas para os dois cultivares de soja e há diferença de agressividade entre elas, sendo as raças 24 e 25 mais agressivas do que a raça 23.

  17. Clinical measures in rheumatoid arthritis and ankylosing spondylitis.

    Science.gov (United States)

    Fendler, C; Braun, J

    2009-01-01

    Except for morning stiffness, the clinical symptoms and the history of patients with rheumatoid arthritis (RA) and ankylosing spondylitis (AS) usually differ: the location in RA is mostly the hands and feet, and in AS rather the back. Patients with RA tend to be older (>50 years) and female, while in AS there are somewhat more often male and younger (physical examens, a reduction of lateral spinal flexion and chest expansion are often the earliest signs which are also sensitive to change on therapy with biologics. The cervical spine may be affected in RA and AS - more frequently in advanced disease stages but rather early cases have been reported.

  18. Guayaquil au temps du choléra

    Directory of Open Access Journals (Sweden)

    1996-01-01

    Full Text Available L’épidémie de choléra survenue en 1991 en Équateur a frappé certaines villes et régions plus que d’autres sur la Côte. Guayaquil, la première ville du pays par le nombre de ses habitants (1 600 000 habitants, a connu le record de cas. L’analyse de la répartition des malades hospitalisés dans la ville montre que les quartiers pauvres, récents et, de surcroît, bâtis sur les eaux polluées du delta ne sont pas les plus frappés alors que la zone centrale taudifiée a concentré un nombre de cas élevé. Les pratiques sociales sont-elles davantage responsables de cette situation que les facteurs pourtant très contraignants ici de l’environnement ? GUAYAQUIL EN LOS TIEMPOS DEL CÓLERA. La epidemia del cólera, ocurrida en 1991 en Ecuador, ha golpeado mucho más algunas ciudades y regiones de la Costa. Guayaquil, la primera ciudad del país con 1 600 000 habitantes, ha conocido un número de casos record. El análisis de la distribución de los enfermos hospitalizados en la ciudad revela que los barrios pobres, recientes y además construidos sobre las aguas contaminadas del delta no son los más afectados por esta epidemia en relación con la parte central tugurizada. Las prácticas sociales tal vez tienen más responsabilidad en esta situación que las condiciones particularmente difíciles del medio ambiente. GUAYAQUIL DURING THE CHOLERA. The cholera epidemic, which occured in 1991, impacted some cities and regions of the coast much more than others. Guayaquil, inhabitants Ecuador's largest city with a population of some 1, 6000 000 inhabitants, experienced a record number of cases. An analysis of the sick hospitalized in this city reveals that the poor urban sections, which were built recently and moreover were constructed upon the contaminated waters of the delta, were not the most affected by this epidemic, particularly when compared to the congested central part of the city. This suggests that social practices were more

  19. Localization of powdery mildew resistance gene Ml-ra on barley chromosome 5

    DEFF Research Database (Denmark)

    Doll, Hans; Jensen, Hans Peter

    1986-01-01

    Evidence is presented that the powdery mildew resistance gene called Ml-(41/145) represents a unique, unnamed locus, which we suggest to be designated Ml-ra with reference to variety 'Ragusa b' [Hordeum vulgare]. Ml-ra is located on the short arm of chormosome 5 near powdery mildew resistance locus...... Ml-a and the seed storage protein loci Hor1 and Hor2. The most likely order of the loci is Hor1, Ml-a, Ml-ra, and Hor2....

  20. A shared HLA-DRB1 sequence confers RA susceptibility in Greeks.

    Science.gov (United States)

    Carthy, D; Ollier, W; Papasteriades, C; Pappas, H; Thomson, W

    1993-10-01

    Previous serological studies of Greek rheumatoid arthritis (RA) patients have failed to demonstrate an association with DR4. Using sequence specific oligonucleotide typing we have identified the DRB1 alleles in panels of Greek RA patients and controls. When patient and control HLA-DRB1 frequencies were compared, significantly higher frequencies of DRB1*0101 (23.3% vs. 7.0%, odds ratio [OR] 4.0, 95% confidence intervals [CI] 1.4-12.0) and DRB1*1001 (20.9% vs. 5.8%, OR 4.3, 95% CI 1.3-13.7) were found in RA patients compared with controls. No association of DRB1*04 with RA was observed (20.9% vs. 14.0% in controls) confirming earlier reports. However DRB1*04 subtyping demonstrated a small but significant increase of DRB1*0405 in patients (14.0% vs. 3.5%, OR 4.5, 95% CI 1.1-18.9). When the frequency of individuals carrying the shared RA susceptibility epitope was compared between patients and controls it was found to be significantly higher in RA patients (60.5% vs. 22.1%, OR 5.4, 95% CI 2.4-12.0). We conclude that the shared epitope is significantly associated with RA in this population, but that it is predominantly accounted for by DRB1*0101 and DRB1*1001. Previous studies of UK RA patients have demonstrated a negative association of DR2 with disease and articular erosions. HLA-DR2 variants, DRB1*1501 and *1502 are not at reduced frequency in Greek RA patients (DRB1*1501, 14.0% in patients vs. 7.0% in controls; DRB1*1502, 7.0% in patients vs. 7.0% in controls). Genes conferring RA resistance may be in linkage disequilibrium with DR2 in UK patients. This does not appear to be the case in Greek RA patients. No association was seen between RA and HLA-DPB1 type.

  1. Gamma spectrometry used for analysis of {sup 228}Ra in water; Utilizacao de espectrometria gama para analise de {sup 228} Ra nas aguas

    Energy Technology Data Exchange (ETDEWEB)

    Mancini, Luis Henrique [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas; Bonotto, Daniel Marcos [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas. Dept. de Petrologia e Metalogenia

    1998-07-01

    A methodology for determination of the natural isotope {sup 228}Ra in water by using the characterization of the underground and superficial waters from thorium an rare earths mineralization at Morro do Ferro, Pocos de Caldas, state of Minas Gerais, Brazil. The values determined for the {sup 228}Ra in water from 5 logging holes ranged from 0.5 to 391.2 pCi/l and the superficial waters presented a variation of 1.0 to 13.9 pCi/l.

  2. 210Pb- 226Ra and 228Ra- 232Th systematics in young arc lavas: implications for magma degassing and ascent rates

    Science.gov (United States)

    Turner, Simon; Black, Stuart; Berlo, Kim

    2004-10-01

    New data show that island arc rocks have ( 210Pb/ 226Ra) o ratios which range from as low as 0.24 up to 2.88. In contrast, ( 228Ra/ 232Th) appears always within error of 1 suggesting that the large 226Ra-excesses observed in arc rocks were generated more than 30 years ago. This places a maximum estimate on melt ascent velocities of around 4000 m/year and provides further confidence that the 226Ra excesses reflect deep (source) processes rather than shallow level alteration or seawater contamination. Conversely, partial melting must have occurred more than 30 years prior to eruption. The 210Pb deficits are most readily explained by protracted magma degassing. Using published numerical models, the data suggest that degassing occurred continuously for periods up to several decades just prior to eruption but no link with eruption periodicity was found. Longer periods are required if degassing is discontinuous, less than 100% efficient or if magma is recharged or stored after degassing. The long durations suggest much of this degassing occurs at depth with implications for the formation of hydrothermal and copper-porphyry systems. A suite of lavas erupted in 1985-1986 from Sangeang Api volcano in the Sunda arc are characterised by deficits of 210Pb relative to 226Ra from which 6-8 years of continuous 222Rn degassing would be inferred from recent numerical models. These data also form a linear ( 210Pb)/Pb-( 226Ra)/Pb array which might be interpreted as a 71-year isochron. However, the array passes through the origin suggesting displacement downwards from the equiline in response to degassing and so the slope of the array is inferred not to have any age significance. Simple modelling shows that the range of ( 226Ra)/Pb ratios requires thousands of years to develop consistent with differentiation occurring in response to cooling at the base of the crust. Thus, degassing post-dated, and was not responsible for magma differentiation. The formation, migration and extraction

  3. ScaRaB (Scanner for Radiation Budget). Final report; Das Strahlungsbilanzradiometer ScaRaB (Scanner for Radiation Budget). Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, J. [VEGA Informations-Technologien GmbH, Darmstadt (Germany); Hollmann, R.; Stuhlmann, R.; Raschke, E. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Atmosphaerenphysik

    2000-07-01

    A new radiometer for radiation budget measurements (scanner for radiation budget, (ScaRaB)) was developed within a German-French-Russian framework. In 1994/1995 the first instrument was launched on the METEOR satellite. The 2{sup nd} instrument was then launched in 1998 on the sunsynchronous Resurs satellite. The report describes the work done at GKSS within the ScaRaB project: calibration and validation. It gives an overview of related international and national research programmes and the future usefulness of the derived products to the scientific community. The work was funded by DLR under the contract number: FKZ 50-EE-9218. (orig.)

  4. SU-E-T-588: Optimization of Imaging Following 223Ra Administration in Targeted Alpha-Emitting Radionuclide Therapy of Bone Metastases

    Energy Technology Data Exchange (ETDEWEB)

    Benabdallah, N; Bernardini, M [Hopital Europeen George Pompidou, Paris, Ile de France (France); Desbree, A [Institut de Radioprotection et de Surete Nucleaire, Fontenay-aux-roses, Ile-de-France (France); Labriolle-Vaylet, C de [Hopital Trousseau, Paris, Ile de France (France); Franck, D [Institut de Radioprotection et de Suretu Nucleaire, Fontenay Aux Roses, Ile de France (France)

    2015-06-15

    Purpose: With a growing demand of alpha-emitting radiopharmaceuticals, especially Xofigo ({sup 223}RaCl{sub 2}) which is used in the treatment of metastatic bone disease, the optimization of dosimetry becomes necessary. Indeed, in Europe, as stated on the council directive 2013/59/euratom, exposures of target volumes for radiotherapeutic purposes shall be individually planned taking into account that doses to non-target volumes and tissues shall be as low as reasonably achievable. To that aim, the possibility of imaging {sup 223}Ra was first investigated. Methods: The experiments were conducted at the Hopital Europeen Georges Pompidou with an Infinia Hawkeye 4 gamma camera, equipped with a medium-energy collimator. Imaging parameters, such as sensibility, spatial resolution and energy spectrum, were determined using several physical phantoms with a source of 6 MBq of {sup 223}Ra. Bone metastases were modeled with a NEMA Body Phantom to investigate image degradation based on the concentration of {sup 223}Ra. Results: The acquired energy spectrum allowed to visualize several photon peaks: at 85, 154 and 270 keV. Camera sensitivity measured from the phantom study was 102.3 cps/MBq for the 85 keV ± 20 %, 89.9 cps/MBq for the 154 ± 20 % window and 65.4 cps/MBq for the 270 ± 10 % window. The spatial resolution (full-width at half-maximum) was respectively 1.7, 1.9 and 1.8 cm for the three energy windows. SPECT/CT images of NEMA Body Phantom without and with attenuation have permitted to determine the best reconstruction parameters. Conclusion: This study has demonstrated that it is possible to obtain clinically relevant information from images of {sup 223}Ra. All these results will be valuable to analyze biodistribution imaging of the radiopharmaceutical in the patient body and go further in the reconstruction of patient images in order to personalize the dosimetry.

  5. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  6. Püha Birgitta keskus : Merivälja tee 18, Tallinn / Ra Luhse

    Index Scriptorium Estoniae

    Luhse, Ra, 1964-

    2001-01-01

    Arhitektuur ja sisekujundus: Arhitektibüroo Luhse & Tuhal. Arhitektid Ra Luhse, Tanel Tuhal. Konstruktsioonid: Teinos OÜ. Ehitaja: AS FKSM. Projekt 1997-1999, klooster valmis 2001. 2 ill.: välisvaated

  7. Towards a precise measurement of atomic parity violation in a single Ra{sup +} ion

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, M., E-mail: nunez@kvi.nl; Berg, J. E. van den; Bekker, H.; Boell, O.; Dijck, E. A.; Giri, G. S.; Hoekstra, S.; Jungmann, K.; Mohanty, A.; Onderwater, C. J. G.; Santra, B.; Schlesser, S.; Timmermans, R. G. E.; Versolato, O. O.; Wansbeek, L. W.; Willmann, L.; Wilschut, H. W. [Kernfysisch Versneller Instituut (KVI) (Netherlands)

    2013-03-15

    A single trapped Ra{sup + } (Z = 88) ion provides a very promising route towards a most precise measurement of Atomic Parity Violation (APV), since APV effects grow faster than Z{sup 3}. This experiment promises the best determination of the electroweak coupling constant at the lowest accessible energies. Such a measurement provides a sensitive test of the Standard Model in particle physics. At the present stage of the experiment, we focus on trapping and laser cooling stable Ba{sup + } ions as a precursor for radioactive Ra{sup + }. Online laser spectroscopy of the isotopes {sup 209 - 214}Ra{sup + } in a linear Paul trap has provided information on transition wavelengths, fine and hyperfine structures and excited state lifetimes as test of atomic structure calculations. Additionaly, a single trapped Ra{sup + } ion could function as a very stable clock.

  8. Ajakohatu küsimine kunsti algupära järele / Leo Luks

    Index Scriptorium Estoniae

    Luks, Leo, 1976-

    2002-01-01

    Rets.: Martin Heidegger. Kunstiteose algupära. Saksa keelest tõlkinud Ülo Matjus. Tartu, 2002 (Avatud Eesti Raamat). Konkreetse Heideggeri teose mõistmiseks vajalikust taustast. Kogumikust - Kaasaegne poliitiline filosoofia

  9. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  10. Ajakohatu küsimine kunsti algupära järele / Leo Luks

    Index Scriptorium Estoniae

    Luks, Leo, 1976-

    2002-01-01

    Rets.: Martin Heidegger. Kunstiteose algupära. Saksa keelest tõlkinud Ülo Matjus. Tartu, 2002 (Avatud Eesti Raamat). Konkreetse Heideggeri teose mõistmiseks vajalikust taustast. Kogumikust - Kaasaegne poliitiline filosoofia

  11. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  12. Activity concentrations of Rn-222, Ra-226, Ra-228, U-238 and Cs-137 in water samples of Styria/Austria; Aktivitaetskonzentrationen von Rn-222, Ra-226, Ra-228, U-238 und Cs-137 in Wasserproben aus der Steiermark/Oesterreich

    Energy Technology Data Exchange (ETDEWEB)

    Pichl, E. [Verein zur Foerderung der Strahlenforschung Oesterreich, Graz (Austria). Strahlenmesstechnik Graz; Rauch, P. [Land Steiermark (Austria). Abt. 15 - Energie, Wohnbau, Technik

    2015-07-01

    Activity concentrations of radon (Rn-222), radium (Ra-226, Ra-228), uranium (U-238), and radiocesium (Cs-137), were determined in 50 water samples from different geogenic regions of Styria/Austria. Samples were collected in the years 2010, 2011 and 2012, by experts of the Styrian government. For measuring activities of U-238 we used a low energy-semiconductor detector, and a high purity-semiconductor detector to analyze the activities of all the other radionuclides. More than 90% of the activity concentrations of Rn-222 in all water samples were lower than 50 Bq/l. All activity concentrations observed for radium and uranium were lower than the detection limits of the corresponding radionuclides (Ra-226: 0,02 Bq/l, Ra-228: 0,03 Bq/l, U-238: 0,06 Bq/l). None of the water samples were contaminated by Cs-137.

  13. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  14. Release of 226Ra from uranium mill tailings by microbial Fe(III) reduction

    Science.gov (United States)

    Landa, E.R.; Phillips, E.J.P.; Lovley, D.R.

    1991-01-01

    Uranium mill tailings were anaerobically incubated in the presence of H2 with Alteromonas putrefaciens, a bacterium known to couple the oxidation of H2 and organic compounds to the reduction of Fe(III) oxides. There was a direct correlation between the extent of Fe(III) reduction and the accumulation of dissolved 226Ra. In sterile tailings in which Fe(III) was not reduced, there was negligible leaching of 226Ra. The behavior of Ba was similar to that of Ra in inoculated and sterile systems. These results demonstrate that under anaerobic conditions, microbial reduction of Fe(III) may result in the release of dissolved 226Ra from uranium mill tailings. ?? 1991.

  15. I-RaCM: A Fully Integrated Risk and Lifecycle Cost Model Project

    Data.gov (United States)

    National Aeronautics and Space Administration — SpaceWorks Engineering, Inc. (SEI) proposes development of the Integrated Risk and Cost Model I-RaCM, as the innovation to meet the need for integrated cost and risk...

  16. Study of natural radionuclides - {sup 226}Ra, {sup 228}Ra and {sup 210}PB - in marine sediment cores from Southwest Atlantic during the Holocene; Estudo dos radionuclideos naturais - Ra226, Ra-228 e Pb-210 - em alguns registros sedimentares do Atlantico sudoeste ao longo do holoceno

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Alice Miranda Ribeiro

    2016-07-01

    Natural radionuclides from {sup 238}U and {sup 232}Th series have been successfully applied as tracers of environmental process and climate changes. The {sup 210}Pb (half-life of 22.2 years) is used in the geochronological dating technique of sediment cores of the last 100-150 years, and its respective sedimentation rate determination. The study of {sup 226}Ra and {sup 228}Ra concentrations (half-lives of 1,600 years and 5.75 years, respectively) helps calculate the activity of {sup 210}Pb in excess in the environment, besides being important tracers of marine processes, as ground water discharge. In this work it was determined the activity concentrations of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in four short marine cores collected since the continental platform to upper slope of Southwest Atlantic Ocean. Taking into account the results obtained, sedimentation rates and the ages of each sediment layer were determined using the geochronological dating method with {sup 210}Pb. All sediment samples were total acid digested in microwave. The sequential radiochemical separation of {sup 226}Ra, {sup 228}Ra, {sup 210}Pb were performed, obtaining in the end the precipitation of Ba(Ra)SO{sub 4} and PbCrO{sub 4}. The gross α measurements of {sup 226}Ra and gross β measurements of {sup 228}Ra and {sup 210}Pb from the precipitates were carried out in a gas-flow low background proportional counter. Concerning all cores analyzed, the activities concentrations of {sup 226}Ra ranged from 14 Bq.kg{sup -1} to 154 Bq.kg{sup -1}; the concentrations of {sup 228}Ra ranged from 17 Bq.kg{sup -1} to 45 Bq.kg{sup -1}; and the concentrations of {sup 210}Pb ranged from 20 Bq.kg{sup -1} to 2,073 Bq.kg{sup -1}. High values of {sup 210}Pb were observed on the top of all the cores studied, mainly related to atmospheric deposition. The results obtained in this work were of the same order of magnitude of those reported in the literature available on non contaminated areas of Southeast

  17. Contrasting genetic association of IL2RA with SLE and ANCA – associated vasculitis

    Directory of Open Access Journals (Sweden)

    Todd John A

    2009-03-01

    Full Text Available Abstract Background Autoimmune diseases are complex and have genetic and environmental susceptibility factors. The objective was to test the genetic association of systemic lupus erythematosus (SLE and anti-neutrophil cytoplasmic antibody (ANCA – associated systemic vasculitis (AAV with SNPs in the IL2RA region and to correlate genotype with serum levels of IL-2RA. Methods Using a cohort of over 700 AAV patients, two SLE case-control studies and an SLE trio collection (totalling over 1000 SLE patients, and a TaqMan genotyping approach, we tested 3 SNPs in the IL2RA locus, rs11594656, rs2104286 & rs41295061, each with a prior association with autoimmune disease; rs11594656 and rs41295061 with type 1 diabetes (T1D and rs2104286 with multiple sclerosis (MS and T1D. Results We show that SLE is associated with rs11594656 (P = 3.87 × 10-7 and there is some evidence of association of rs41295061 with AAV (P = 0.0122, which both have prior association with T1D. rs2104286, an MS and T1D – associated SNP in the IL2RA locus, is not associated with either SLE or AAV. Conclusion We have confirmed a previous suggestion that the IL2RA locus is associated with SLE and showed some evidence of association with AAV. Soluble IL-2RA concentrations correlate with rs11594656 genotype in quiescent disease in both AAV and SLE. Differential association of autoimmune diseases and SNPs within the IL2RA locus suggests that the IL2RA pathway may prove to play differing, as yet undefined, roles in each disease.

  18. Ra isotopes in trees: Their application to the estimation of heartwood growth rates and tree ages

    Science.gov (United States)

    Hancock, Gary J.; Murray, Andrew S.; Brunskill, Gregg J.; Argent, Robert M.

    2006-12-01

    The difficulty in estimating growth rates and ages of tropical and warm-temperate tree species is well known. However, this information has many important environmental applications, including the proper management of native forests and calculating uptake and release of atmospheric carbon. We report the activities of Ra isotopes in the heartwood, sapwood and leaves of six tree species, and use the radial distribution of the 228Ra/226Ra activity ratio in the stem of the tree to estimate the rate of accretion of heartwood. A model is presented in which dissolved Ra in groundwater is taken up by tree roots, translocated to sapwood in a chemically mobile (ion-exchangeable) form, and rendered immobile as it is transferred to heartwood. Uptake of 232Th and 230Th (the parents of 228Ra and 226Ra) is negligible. The rate of heartwood accretion is determined from the radioactive decay of 228Ra (half-life 5.8 years) relative to long-lived 226Ra (half-life 1600 years), and is relevant to growth periods of up to 50 years. By extrapolating the heartwood accretion rate to the entire tree ring record the method also appears to provide realistic estimates of tree age. Eight trees were studied (three of known age, 72, 66 and 35 years), including three Australian hardwood eucalypt species, two mangrove species, and a softwood pine (P. radiata). The method indicates that the rate of growth ring formation is species and climate dependent, varying from 0.7 rings yr-1 for a river red gum (E. camaldulensis) to around 3 rings yr-1 for a tropical mangrove (X. mekongensis).

  19. Bioavailability of radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in the brazilian phosphate fertilizers and phosphogypsum; Avaliacao da biodisponibilidade dos radionuclideos {sup 226}Ra, {sup 228}Ra e {sup 210}Pb presentes nos fertilizantes fosfatados e no fosfogesso de procedencia nacional

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Ana Carolina

    2013-08-01

    Phosphogypsum, also called gypsum, by-product of the phosphate fertilizer industry, can be used as soil conditioner since it provides improvements in the soil-plant system. However, this by-product concentrates radionuclides of the U and Th series, present in the phosphate rock used as raw material, which can impact the environment. In order to study the bioavailability of radionuclides, samples of phosphogypsum and phosphate fertilizers (monoammonium phosphate and triple superphosphate) were analyzed. The concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by gamma spectrometry. The samples were leached with a mild EDTA solution and the radionuclides present in the final solution were determined by total alpha and beta counting on a gas flow proportional counter. The percentage of extraction varied from 1.6% to 1.7% for {sup 210}Pb, from 0.5% to 1.4% for {sup 226}Ra and from 0.1% to 1.0% for the {sup 228}Ra in phosphogypsum samples. The low percentage of extraction obtained for the radionuclides can be partly explained by the low solubility of phosphogypsum, which ranged from 7.7% to 16%. For the monoammonium phosphate samples the percentage of extraction were less than 26% for {sup 226}Ra, less than 10% for '2{sup 28}Ra and less than 10% for {sup 210}Pb. In spite of the high solubility of 77% of monoammonium phosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. For the triple superphosphate samples, the percentage of extraction was 2.3% for {sup 226}Ra, 1.2% for {sup 228}Ra and 11.3% for {sup 210}Pb. In spite of the high solubility of 66% of triple superphosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. (author)

  20. The space (reorganization in Guaíra after the end of “Sete Quedas”

    Directory of Open Access Journals (Sweden)

    Edson Belo Clemente de Souza

    2007-12-01

    Full Text Available This article analyses the space (re organization in themunicipality of Guaíra – PR after the formation of Itaipu Lakewith consequent immersions of the “Sete Quedas”. Due tothe socio-environmental impact caused by the flood, a newphase of development is going to be implemented in Guaírabased on the Directory Plans of 1980 and 1992, reorganizingthe geographic area of Guaíra in a corollary way.

  1. 226Ra bioavailability to plants at the Urgeiriça uranium mill tailings site.

    Science.gov (United States)

    Madruga, M J; Brogueira, A; Alberto, G; Cardoso, F

    2001-01-01

    Large amounts of solid wastes (tailings) resulting from the exploitation and treatment of uranium ore at the Urgeiriça mine (north of Portugal) have been accumulated in dams (tailing ponds). To reduce the dispersion of natural radionuclides into the environment, some dams were revegetated with eucalyptus (Eucalyptus globolus) and pines (Pinus pinea). Besides these plants, some shrubs (Cytisus spp.) are growing in some of the dams. The objective of this study is to determine the 226Ra bioavailability from uranium mill tailings by quantifying the total and available fraction of radium in the tailings and to estimate its transfer to plants growing on the tailing piles. Plant and tailing samples were randomly collected and the activity concentration of 226Ra in plants (aerial part and roots) and tailings was measured by gamma-spectrometry. The exchangeable fraction of radium in tailings was quantified using one single step extraction with 1 mol dm-3 ammonium acetate (pH = 7) or 1 mol dm-3 calcium chloride solutions. The results obtained for 226Ra uptake by plants show that 226Ra concentration ratios for eucalyptus and pines decrease at low 226Ra concentrations in the tailings and appear relatively constant at higher radium concentrations. For shrubs, the concentration ratios increase at higher 226Ra solid waste concentrations approaching a saturation value. Percentage values of 16.0 +/- 8.3 and 12.9 +/- 8.9, for the fraction of radium extracted from the tailings, using 1 mol dm-3 ammonium acetate or calcium chloride solutions, respectively, were obtained. The 226Ra concentration ratios determined on the basis of exchangeable radium are one order of magnitude higher than those based on total radium. It can be concluded that, at a 95% confidence level, more consistent 226Ra concentration ratios were obtained when calculated on the basis of available radium than when total radium was considered, for all the dams.

  2. Assessing Medication Adherence in Patients with Rheumatoid Arthritis (RA)

    Science.gov (United States)

    2017-03-24

    they cannot fund your publication, the 59th Clinical Research Division may pay for your basic journal publishing charges (to include costs for tables...S9 MOW CRD Graduate Health Sciences Education (GHSE) (SGS O&M); SGS R&D; Tri-Service Nursing Research Program (TSNRP); Defense Medical Research

  3. Ra{sup +} ion trapping - atomic parity violation measurement and an optical clock

    Energy Technology Data Exchange (ETDEWEB)

    Mohanty, Amita; Dijck, Elwin A.; Nunez Portela, Mayerlin; Valappol, Nivedya; Boell, Oliver; Jungmann, Klaus; Onderwater, Cornelis G. G.; Schlesser, Sophie; Timmermans, Rob G.E.; Willmann, Lorenz; Wilschut, Hans W. [University of Groningen, FWN, Groningen (Netherlands)

    2014-07-01

    A single trapped Ra{sup +} ion has an excellent potential for a precision measurement of the Weinberg mixing angle at low momentum transfer and testing thereby the electroweak running. The absolute frequencies of the transition 7s {sup 2}S{sub 1/2}-7d{sup 2}D{sub 3/2} at wavelength 828 nm have been determined in {sup 212*214}Ra{sup +} to better than 19 MHz with laser spectroscopy on small samples of ions trapped in a linear Paul trap at the online facility TRIμP of KVI. The measurement of the Weinberg angle requires the localization of the ion within a fraction of an optical wavelength. The current experiments are focused on trapping and laser spectroscopy on a single Ba{sup +} as a precursor for Ra{sup +}. Work towards single ion trapping of Ra{sup +}, including the preparation of an offline {sup 223}Ra source is in progress. Most elements of the setup for single Ra+ ion parity measurement are also well suited for realizing a most stable optical clock.

  4. Opium addiction increases interleukin 1 receptor antagonist (IL-1Ra in the coronary artery disease patients.

    Directory of Open Access Journals (Sweden)

    Habibollah Saadat

    Full Text Available BACKGROUND: There is evidence that opium addiction has immunosuppressant effects. Coronary artery disease (CAD is a condition resulted from atherosclerosis which is dependent on the immune response. PURPOSE: To evaluate plasma levels of interleukin-6 and interleukin-1Ra in 30 patients with three-vessel coronary artery disease, ejection fraction of more than 35% and to evaluate their changes after prognostic treadmill test in 15 opium addicted and 15 non-addicted patients. METHODS: The participants underwent prognostic treadmill test and plasma levels of interleukin-6 (IL-6 and interleukin-1Ra (IL-1Ra were evaluated with ELISA method before, just after and 4 hours after the test. RESULTS: IL-1Ra (2183 pg/ml tended to decrease over time in the opium addicted group (1372 pg/ml after prognostic treadmill test and 1034 pg/ml 4 hours after that, although such decrease did not reach the statistical significance. IL-1Ra levels were significantly higher in opium addicted than in non addicted patients. Opium addiction had no significant effect on IL-6 changes. CONCLUSION: Consumption of opium in CAD patients is associated with higher IL-1Ra levels.

  5. Functionalized NaA nanozeolites labeled with {sup 224,225}Ra for targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Piotrowska, Agata, E-mail: a.kasperek@ichtj.waw.pl; Leszczuk, Edyta [Institute of Nuclear Chemistry and Technology (Poland); Bruchertseifer, Frank; Morgenstern, Alfred [Joint Research Centre – European Commission, Institute for Transuranium Elements (Germany); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology (Poland)

    2013-11-15

    The {sup 223}Ra, {sup 224}Ra, and {sup 225}Ra radioisotopes exhibit very attractive nuclear properties for application in radionuclide therapy. Unfortunately the lack of appropriate bifunctional ligand for radium is the reason why these radionuclides have not found application in receptor-targeted therapy. In the present work, the potential usefulness of the NaA nanozeolite as a carrier for radium radionuclides has been studied. {sup 224}Ra and {sup 225}Ra, α-particle emitting radionuclides, have been absorbed in the nanometer-sized NaA zeolite (30–70 nm) through simple ion exchange. {sup 224,225}Ra-nanozeolites exhibited very high stability in solutions containing physiological salt, EDTA, amino acids, and human serum. To make NaA nanozeolite particles dispersed in water their surface was modified with a silane coupling agent containing poly(ethylene glycol) molecules. This functionalization approach let us covalently attach a biomolecule to the NaA nanozeolite surface.

  6. Molecular characterization of RA68 related potentially to rice flower development

    Institute of Scientific and Technical Information of China (English)

    WU Xiaohuai; WANG Tai

    2004-01-01

    One cDNA whose corresponding mRNA was preferentially accumulated in rice flowers was isolated by PCR-mediated RNA subtraction hybridization and RACE strategy. This gene, termed RA68, consists of three exons and two introns, the putative RA68 protein contained 219amino acid residues with a putative signal peptide and two domains. The N-terminal domain is hydrophilic and rich in proline and threonine embedded in PTPTSYG motifs. The C-terminal domain is hydrophobic. Southern blot and sequence analysis reveal that RA68 exists as one copy in the rice genome and localizes in chromosome 2. Northern hybridization indicates that RA68 is expressed preferentially in buds and flowers, but not in roots and leaves. Furthermore,in situ hybridization indicates that RA68 transcripts are present in pollen mother cells (PMCs), dyad cells, uninucleate pollens and macrospore sacs. Possible functions of RA68 during the flower development are discussed based on its expression and protein structure characteristics.

  7. An easy method for Ra-226 determination in river waters by liquid-scintillation counting

    Science.gov (United States)

    Moreno, H. P.; Vioque, I.; Manjón, G.; García-Tenorio, R.

    1999-01-01

    226Ra activity concentration in river water was determined using a low background liquid scintillation counter. Radium was extracted from the samples as Ra-BaSO4 precipitate which, afterwards, was dissolved with EDTA in ammonia medium. Solution was transferred into a low potassium glass vial and then mixed with a scintillation cocktail. Two different scintillation cocktails were selected for comparison. Efficiency, recovery yield and α/β separation were studied with both liquid scintillation cocktails. One single measurement, made one month after radium separation, allows to calculate the226Ra concentration as well as to assess the presence of alpha contamination of the sample. In the case of negligible interferences,224Ra concentrations can be subsequently evaluated in the same sample by the measurement made just after chemical separation of radium. This method has been applied for the determination of226Ra and224Ra activity concentrations in river water collected from different locations along the Odiel river estuary area (South-west of Spain). The presence of chemical industry, the wastes of which are released into the river, could be connected with radium activity concentration enhancements in the water.

  8. Overview of the Radiation Dosimetry Experiment (RaD-X) flight mission

    Science.gov (United States)

    Mertens, Christopher J.

    2016-11-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission addresses the need to reduce the uncertainty in predicting human exposure to cosmic radiation in the aircraft environment. Measurements were taken that characterize the dosimetric properties of cosmic ray primaries, the ultimate source of aviation radiation exposure, and the cosmic ray secondary radiations that are produced and transported to aviation altitudes. In addition, radiation detectors were flown to assess their potential application to long-term, continuous monitoring of the aircraft radiation environment. RaD-X was successfully launched from Fort Sumner, New Mexico (34.5°N, 104.2°W), on 25 September 2015. Over 18 h of science data were obtained from a total of four different type dosimeters at altitudes above 20 km. The RaD-X flight mission was supported by laboratory radiation exposure testing of the balloon flight dosimeters and also by coordinated radiation measurements taken on ER-2 and commercial aircraft. This paper provides the science background and motivation for the RaD-X flight mission, a brief description of the balloon flight profile and the supporting aircraft flights, and a summary of the articles included in the RaD-X special collection and their contributions to the science goals of the RaD-X mission.

  9. Predictors of response to anti-TNF therapy according to ACR and EULAR criteria in patients with established RA: results from the South Swedish Arthritis Treatment Group Register.

    Science.gov (United States)

    Kristensen, L E; Kapetanovic, M C; Gülfe, A; Söderlin, M; Saxne, T; Geborek, P

    2008-04-01

    To identify factors predicting response to first TNF blocking treatment course in patients with established RA with a special focus on gender differences. Patients with active RA initiating their first treatment course of TNF-blocking therapy were enrolled. The study period was March 1999 through September 2006. The prospective protocol included information on demographics, clinical characteristics of patients and response measures. Fulfilment of ACR 50-70% improvement and European League Against Rheumatism (EULAR) good response or remission [28-joint disease activity score (DAS28) EULAR remission, EULAR good response, ACR50 response and ACR70 response with odds ratios (ORs) 1.97, 2.13, 2.10 and 1.75, respectively. Concurrent treatment with other DMARDs was also significantly associated with EULAR remission, EULAR good response and ACR50 response (OR: 1.96, 2.24 and 1.94, respectively). Likewise, low HAQ at baseline consistently predicted good clinical outcome. Disease activity at baseline was directly associated with favourable response when measured by ACR50 and ACR70 (OR: 1.59 and 1.60, respectively), whereas DAS28 score at baseline was inversely associated with EULAR remission (OR: 0.78). In this observational study of patients with established RA, gender did not predict response to anti-TNF therapy, whereas treatment with concomitant DMARDs, especially MTX and low disability were associated with good response. Choice of outcome measures may influence the predictive value of baseline features.

  10. CD49d- Treg Cells with High Suppressive Capacity are Remarkably Less Efficient on Activated CD45RA- than on Naive CD45RA+ Teff Cells

    Directory of Open Access Journals (Sweden)

    Britta Kraczyk

    2014-07-01

    Full Text Available Background: Impairment of regulatory T cells (Tregs in common autoimmune diseases seems likely. However, the extent of Treg deficiency (number, function or differential susceptibility of T effector cells (Teffs to suppression is not completely understood. We hypothesize that even in healthy individuals both cell populations are heterogeneous and differ in their suppressive capability and their susceptibility to suppression. Material and Methods: Lymphocytes were enriched by MACS for CD4+CD25+ Tregs or CD4+CD25- Teffs. After multicolour staining (anti-CD25, anti-CD127, anti-CD49d or anti-CD45RA highly purified Treg and Teff subpopulations were collected by FACS. Functional capacity of Tregs or suppressive susceptibility of Teffs was analyzed in an in vitro assay. Results: When CD4+CD25highCD127-/low CD49d- Tregs were tested on naive CD4+CD127+CD25-CD45RA+ Teffs (93.8 % suppression was almost complete, while the suppressive capacity of CD4+CD25highCD127-/low CD49d+ Tregs was significantly less (71.8 %. Suppressive activity was low when CD4+CD25highCD127-/low CD49d+ Tregs were analyzed on CD4+CD127+CD25-CD45RA- Teffs (48.7%. Conclusion: Although CD49d+ Tregs are functional, the suppressive capacity is significantly lower compared to CD49d- Tregs. CD45RA+ Teffs can be completely suppressed, while CD45RA- Teffs display relative resistance. Phenotypic and functional heterogeneity of Tregs as well as Teffs has to be considered when analyzing deficiencies in immune regulation.

  11. Validation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb measurements in soil and sediment samples through high resolution gamma ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dias, Danila Carrijo da Silva; Silva, Nivaldo Carlos da; Bonifacio, Rodrigo Leandro; Guerrero, Eder Tadeu Zenun [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas

    2013-07-01

    Radionuclides found in ore extraction waste materials are a great source of concern regarding public health and environmental safety. One technique to determine the concentration of substances is high resolution gamma ray spectrometry using HPGe. Validating a measurement technique is essential to warrant high levels of quality to any scientific work. The Laboratory of Pocos de Caldas of the Brazilian Commission for Nuclear Energy partakes into a Quality Management System project, seeking Accreditation under ISO/IEC 17025 through the validation of techniques of chemical and radiometric analysis of environmental samples from water, soil and sediment. The focus of the Radon Laboratory at LAPOC is validation of Ra-226, Ra-228 and Pb-210 concentration determinations in soil and sediment through a gamma spectrometer system. The stages of this validation process included sample reception and preparation, detector calibration and sample analyses. Dried samples were sealed in metallic containers and analyzed after radioactive equilibrium between Ra-226 and daughters Pb-214 and Bi-214. Gamma spectrometry was performed using CANBERRA HPGe detector and gamma spectrum software Genie 2000. The photo peaks used for Ra-226 determination were 609 keV and 1020 keV of Bi-214 and 351 keV of Pb-214. For the Ra-228 determination a photopeak of 911 keV was used from its short half-life daughter Ac-228 (T1/2 = 6.12 h). For Pb-210, the photopeak of 46.5 keV was used, which, due to the low energy, self-absorption correction was needed. Parameters such as precision, bias/accuracy, linearity, detection limit and uncertainty were evaluated for that purpose. The results have pointed to satisfying results. (author)

  12. Common variants in IL-17A/IL-17RA axis contribute to predisposition to and progression of congestive heart failure

    Institute of Scientific and Technical Information of China (English)

    CHAUGAI Sandip; TAN Lun; HUANG Jin; LI Qing; NI Li; Katherine CIANFLONE; WANG Dao-wen

    2016-01-01

    AIM:Heart failure is characterized by immune activation leading to production and release of proinflammatory cytokines .Inter-leukin 17A (IL-17A) is a proinflammatory cytokine and multiple lines of evidence from animal and human studies suggest crucial roles of IL-17A in heart failure.Therefore, we investigated whether common polymorphisms of genes IL17A and IL17RA (coding interleukin 17 receptor A) gene contribute to genetic predisposition to heart failure and adverse clinical outcomes associated with it .METHODS AND RESULTS:A total of 1713 adults patients with congestive heart failure and 1713 age-and sex-matched controls were genotyped for promoter SNPs, rs2275913 and rs8193037 in IL17A and rs4819554 in IL17RA, to assess the relationship between individual SNPs and the risk of congestive heart failure .Results showed that rs8193037 in IL17A was associated with the risk of congestive heart failure (P<0.01) after adjustment for multiple cardiovascular risk factors including age , sex, smoking status, diabetes, hypertension and dyslipidemia.This association was evident in both ischemic and non-ischemic heart failure (P<0.05).Furthermore, prospective fol-low-up of 12.7 months for the occurrence of adverse clinical outcomes showed that rs 4819554 in IL17RA was significantly associated with cardiovascular mortality (P<0.05) after adjustments for multiple cardiovascular risk factors and New York Heart Association functional class.CONCLUSION:This study demonstrated associations of rs8193037 in the promoter of IL17A with the risk of conges-tive heart failure, and of rs4819554 in the promoter of IL17RA with the risk of cardiovascular mortality in patients with congestive heart failure.These data lend further support to the notion that immune activation and genetic polymorphisms contribute to heart failure path -ogenesis and progression .

  13. SB-RA-2001 inhibits bacterial proliferation by targeting FtsZ assembly.

    Science.gov (United States)

    Singh, Dipty; Bhattacharya, Anusri; Rai, Ankit; Dhaked, Hemendra Pal Singh; Awasthi, Divya; Ojima, Iwao; Panda, Dulal

    2014-05-13

    FtsZ has been recognized as a promising antimicrobial drug target because of its vital role in bacterial cell division. In this work, we found that a taxane SB-RA-2001 inhibited the proliferation of Bacillus subtilis 168 and Mycobacterium smegmatis cells with minimal inhibitory concentrations of 38 and 60 μM, respectively. Cell lengths of these microorganisms increased remarkably in the presence of SB-RA-2001, indicating that it inhibits bacterial cytokinesis. SB-RA-2001 perturbed the formation of the FtsZ ring in B. subtilis 168 cells and also affected the localization of the late cell division protein, DivIVA, at the midcell position. Flow cytometric analysis of the SB-RA-2001-treated cells indicated that the compound did not affect the duplication of DNA in B. subtilis 168 cells. Further, SB-RA-2001 treatment did not affect the localization of the chromosomal partitioning protein, Spo0J, along the two ends of the nucleoids and also had no discernible effect on the nucleoid segregation in B. subtilis 168 cells. The agent also did not appear to perturb the membrane potential of B. subtilis 168 cells. In vitro, SB-RA-2001 bound to FtsZ with modest affinity, promoted the assembly and bundling of FtsZ protofilaments, and reduced the GTPase activity of FtsZ. GTP did not inhibit the binding of SB-RA-2001 to FtsZ, suggesting that it does not bind to the GTP binding site on FtsZ. A computational analysis indicated that SB-RA-2001 binds to FtsZ in the cleft region between the C-terminal domain and helix H7, and the binding site of SB-RA-2001 on FtsZ resembled that of PC190723, a well-characterized inhibitor of FtsZ. The findings collectively suggested that SB-RA-2001 inhibits bacterial proliferation by targeting the assembly dynamics of FtsZ, and this can be exploited further to develop potent FtsZ-targeted antimicrobials.

  14. Hand bone loss in early rheumatoid arthritis during a methotrexate-based treat-to-target strategy with or without adalimumab-a substudy of the optimized treatment algorithm in early RA (OPERA) trial

    DEFF Research Database (Denmark)

    Ørnbjerg, L M; Østergaard, M; Jensen, T

    2017-01-01

    This study aims to investigate 1-year hand bone loss (HBL1-year) in early rheumatoid arthritis (RA) patients treated with a methotrexate (MTX) and intra-articular triamcinolone treat-to-target strategy +/- adalimumab and to determine if HBL6months is associated with radiographic progression after 2...... years. In a clinical trial (OPERA) of 180 treatment-naive early RA patients, bone mineral density (BMD) was estimated from hand radiographs with digital X-ray radiogrammetry (DXR) at baseline, after 6 (n = 90) and 12 months (n = 70) of follow-up. Baseline and 2-year radiographs were scored according...

  15. Investigations on the activity concentrations of 238U, 226RA, 228RA, 210PB and 40K in Jordan phosphogypsum and fertilizers.

    Science.gov (United States)

    Al-Jundi, J; Al-Ahmad, N; Shehadeh, H; Afaneh, F; Maghrabi, M; Gerstmann, U; Höllriegl, V; Oeh, U

    2008-01-01

    The activity concentrations of naturally occurring radionuclides ((238)U, (226)Ra, (228)Ra, (210)Pb and (40)K) in Jordanian phosphate ore, fertilizer material and phosphogypsum piles were investigated. The results show the partitioning of radionuclides in fertilizer products and phosphogypsum piles. The outcome of this study will enrich the Jordanian radiological map database, and will be useful for an estimation of the radiological impact of this industrial complex on the immediate environment. The activity concentration of (210)Pb was found to vary from 95 +/- 8 to 129 +/- 8 Bq kg(-1) with a mean value of 111 +/- 14 Bq kg(-1) in fertilizer samples, and from 364 +/- 8 to 428 +/- 10 Bq kg(-1) with a mean value of 391 +/- 30 Bq kg(-1) in phosphogypsum samples; while in phosphate wet rock samples, it was found to vary between 621 +/- 9 and 637 +/- 10 Bq kg(-1), with a mean value of 628 +/- 7 Bq kg(-1). The activity concentration of (226)Ra in fertilizer samples (between 31 +/- 4 and 42 +/- 5 Bq kg(-1) with a mean value of 37 +/- 6 Bq kg(-1)) was found to be much smaller than the activity concentration of (226)Ra in phosphogypsum samples (between 302 +/- 8 and 442 +/- 8 Bq kg(-1) with a mean value of 376 +/- 62 Bq kg(-1)). In contrast, the activity concentration of (238)U in fertilizer samples (between 1011 +/- 13 and 1061 +/- 14 Bq kg(-1) with a mean value of 1033 +/- 22 Bq kg(-1)) was found to be much higher than the activity concentration of (238)U in phosphogypsum samples (between 14 +/- 5 and 37 +/- 7 Bq kg(-1) with a mean value of 22 +/- 11 Bq kg(-1)). This indicates that (210)Pb and (226)Ra show similar behaviour, and are concentrated in phosphogypsum piles. In addition, both isotopes enhanced the activity concentration in phosphogypsum piles, while (238)U enhanced the activity concentration in the fertilizer. Due to the radioactivity released from the phosphate rock processing plants into the environment, the highest collective dose commitment for the lungs

  16. Analytical study of (226)Ra activity concentration in market consuming foodstuffs of Ramsar, Iran.

    Science.gov (United States)

    Gooniband Shooshtari, M; Deevband, M R; Kardan, M R; Fathabadi, N; Salehi, A A; Naddafi, K; Yunesian, M; Nabizadeh Nodehi, R; Karimi, M; Hosseini, S S

    2017-01-01

    Ramsar, a city of Iran located on the coast of the Caspian Sea, has been considered to be enormously important due to its high natural radioactivity levels. People living in High Level Natural Radiation Areas (HLNRAs) have been exposed by several sources, one of which could be foodstuff. However, many studies have been carried out to measure the environmental radioactivity in Ramsar, but no survey has been conducted in all stapled consumed foods yet. This study was dedicated to determine (226)Ra activity concentration in the daily diets of Ramsar residents as a probable exposure. Approximately 70 different market samples were collected during the four seasons based on the daily consumption patterns of residents which have the highest consumption and their availability in the seasons. All samples, after washing, drying and pretreatment, were analyzed for (226)Ra radionuclide determination by α-spectrometry. The mean radioactivity concentration of (226)Ra ranged between 7 ± 1 mBq Kg(-1) wet weight in meat, and 318 ± 118 mBq Kg(-1) for tea dry leaves. The (226)Ra activity concentrations in collected samples varied from below the minimum detectable activity up to 530 ± 30 mBq Kg(-1). To compare the results with United Nations Scientific Committee on Effects of Atomic Radiation (UNSCEAR) reference values, the (226)Ra activity concentrations concluded from the results appear to be higher in milk, chicken and eggs and less in grain products, vegetables, fruits and fish products. These results indicate that no significant (226)Ra contamination is present in market foodstuffs and provide reference values for the foodstuffs in Ramsar. Of the total daily dietary (226)Ra exposure from market consuming foodstuffs for adults in Ramsar, the largest percentage was from wheat. The residents consuming wheat and manufacturing wheat products such as bread, pasta, porridge, crackers, biscuits, pancakes, pies, pastries, cakes, cookies, muffins, rolls, doughnuts, breakfast

  17. Variabilidade isoenzimática em oito raças de milho

    Directory of Open Access Journals (Sweden)

    VALENTE SÉRGIO EMÍLIO DOS SANTOS

    1999-01-01

    Full Text Available Com o objetivo de avaliar a variabilidade genética e as relações de afinidade entre dezenove populações de oito raças de milho (Zea mays L. - as comerciais antigas Cateto Sulino, Cateto Sulino Grosso, Cateto Nortista e Canario de Ocho, e as raças indígenas Moroti, Lenha, Entrelaçado e Caingang - analisaram-se os seguintes sistemas enzimáticos: glutamato oxalacetato transaminase (GOT, esterase (EST e malato desidrogenase (MDH. Observou-se maior semelhança entre as raças pertencentes a um mesmo grupo, mas as populações analisadas não se agruparam de acordo com as raças, classificadas anteriormente segundo caracteres morfológicos. Os sistemas enzimáticos utilizados não permitiram a caracterização individual de cada uma das raças analisadas. As indígenas apresentaram maior variabilidade do que as comerciais antigas quanto ao número de alelos por loco e à porcentagem de locos polimórficos.

  18. RA-RAR-β counteracts myelin-dependent inhibition of neurite outgrowth via Lingo-1 repression.

    Science.gov (United States)

    Puttagunta, Radhika; Schmandke, André; Floriddia, Elisa; Gaub, Perrine; Fomin, Natalie; Ghyselinck, Norbert B; Di Giovanni, Simone

    2011-06-27

    After an acute central nervous system injury, axonal regeneration is limited as the result of a lack of neuronal intrinsic competence and the presence of extrinsic inhibitory signals. The injury fragments the myelin neuronal insulating layer, releasing extrinsic inhibitory molecules to signal through the neuronal membrane-bound Nogo receptor (NgR) complex. In this paper, we show that a neuronal transcriptional pathway can interfere with extrinsic inhibitory myelin-dependent signaling, thereby promoting neurite outgrowth. Specifically, retinoic acid (RA), acting through the RA receptor β (RAR-β), inhibited myelin-activated NgR signaling through the transcriptional repression of the NgR complex member Lingo-1. We show that suppression of Lingo-1 was required for RA-RAR-β to counteract extrinsic inhibition of neurite outgrowth. Furthermore, we confirm in vivo that RA treatment after a dorsal column overhemisection injury inhibited Lingo-1 expression, specifically through RAR-β. Our findings identify a novel link between RA-RAR-β-dependent proaxonal outgrowth and inhibitory NgR complex-dependent signaling, potentially allowing for the development of molecular strategies to enhance axonal regeneration after a central nervous system injury.

  19. Behaviour of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra in rock alterations: study of Morungaba granitoids, SP-Brazil and ground water in its fractures; Comportamento de {sup 238}U, {sup 234}U, {sup 228}Ra e {sup 226}Ra na alteracao de rochas: estudo dos granitoides de Morungaba (SP) e aguas subterraneas de suas fraturas

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Rosana N. dos [Pontificia Univ. Catolica de Sao Paulo, SP (Brazil). Dept. de Fisica]. E-mail: rosana@pucsp.br; Marques, Leila S. [Sao Paulo Univ., SP (Brazil). Inst. de Astronomia, Geofisica e Ciencias Atmosfericas. Dept. de Geofisica]. E-mail: leila@iag.usp.br

    2005-07-01

    This work presents the first results obtained on the investigation of the behavior of uranium and radium radioisotopes in the processes of weathering and rock-water interaction of Morungaba granitoids belonging to Meridional Pluton (Valinhos Town-SP-Brazil). Specific activities of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra were determined in non altered granitoids (Group A), as well as in those affected by different degrees of weathering (Groups B, C and D). The uranium specific activities were determined by alpha spectrometry method, whereas for the determination of radium isotopes high resolution gamma-ray spectrometry technique was employed. The data indicate that {sup 238}U and {sup 234}U are in radioactive equilibrium in the fresh analyzed granitoids, but show a slight depletion of {sup 234}U in relation to {sup 238}U in the weathered rocks. The ({sup 226}Ra/{sup 238}U) and ({sup 226}Ra/{sup 234}U) activity ratios of all investigated rocks are similar, showing a significant {sup 226}Ra depletion, which is probably caused by its preferential leaching. These results indicate that even samples macroscopically classified as fresh rocks, their systems have been opened for some geochemical changes. The high ({sup 234}U/{sup 238}U) activity ratios of groundwaters which are found in the fractures of these granitoids suggest their prolonged residence times in the aquifer and/or their percolation by other rocks presenting different geochemical properties. (author)

  20. Possible cluster preformation in the 14C decay of 223Ra

    Science.gov (United States)

    Hussonnois, M.; Le Du, J. F.; Brillard, L.; Ardisson, G.

    1990-08-01

    A recent experiment on the 14C fine structure has shown that the branching ratio to 209Pb ground state is quite different from the one predicted by the various models of cluster emission. Assuming that the 14C is preformed in the 223Ra nucleus, we have calculated the hindrance factor F14C of the three 14C branches to 209Pb states with a barrier penetrability approximated by a square-well Coulomb potential. The F14C=3.9 and 4.6 values found for the 14C transitions to the two excited states at 779 keV (Iπ=11/2+) and 1423 keV (Iπ=15/2-), respectively, reveal that the cluster formation amplitudes in both transitions are close to those of the 222Ra and 224Ra 14C decays. Such values could be the result of ||nlj> shell-model components common to both the wave functions of the octupole deformed 223Ra nucleus and of the two first excited states of 209Pb spherical nucleus. The high hindrance factor F14C=583 of the 14C branch to the 209Pb ground state (Iπ=9/2+) could reveal the absence of ||1g9/2> shell-model component in the 223Ra wave function.

  1. Isotope shifts and hyperfine structure of {sup 212-214}Ra{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Giri, Gouri S.; Sahoo, Bijaya K.; Versolato, Oscar O.; Wansbeek, Lotje W.; Willmann, Lorenz; Wilschut, Hans W.; Jungmann, Klaus; Timmermans, Rob G.E. [Kernfysisch Versneller Instituut, University of Groningen (Netherlands)

    2010-07-01

    The availability of short lived Ra isotopes at the TRI{mu}P facility of the KVI makes the study of atomic structure of these isotopes possible. {sup 212-214}Ra ions are trapped in a buffer-gas filled Paul trap. Isotope shifts and hyperfine structures of {sup 212-214}Ra{sup +} for several transitions were obtained by laser spectroscopy. Ra{sup +} is of particular interest for a most precise measurement of Atomic Parity Violation (APV), currently underway in our group. Such a measurement will provide a stringent test of the Standard Model of particle physics. However, the interpretation of APV measurements require the determination of the weak matrix elements to better than 1% accuracy in order to extract the weak charge (Weinberg angle). Currently, our calculations are accurate to some 3%. We therefore plan to exploit the fact that radium has a wide range of isotopes by looking at the ratio E1APV/ E1'APV for two -or more- isotopes, and thus canceling atomic uncertainties. Here, nuclear structure effects start to play a role. The extracted isotope shifts and hyperfine interactions provide indispensable information. In addition, the measured hyperfine structure of {sup 213}Ra{sup +} is of particular interest for the proposed Radium single ion clock.

  2. Single Ra{sup +} ion spectroscopy - towards a measurement of atomic parity violation

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, Mayerlin; Mohanti, A.; Dijck, E.A.; Bekker, H.; Boell, O.; Berg, J. van den; Giri, G.S.; Jungmann, K.; Onderwater, C.J.G.; Santra, B.; Timmermans, R.G.E.; Versolato, O.O.; Wansbeek, L.W.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, Groningen (Netherlands)

    2013-07-01

    The sensitivity of the Atomic Parity Violation (APV) signal grows faster than the third power of the atomic number Z. Ra{sup +} (Z=88) is heaviest alkaline earth ion available. A single trapped Ra{sup +} ion opens a very promising path for a measurement atomic parity violation. One of the experimental challenges is the localization of the ion within a fraction of an optical wavelength. For this the current experiments are focused on trapping and laser cooling of Ba{sup +} ions as a precursor for Ra{sup +}. Ba{sup +} ions are trapped and laser cooled in a precision hyperbolic Paul trap. Work towards single Ba{sup +} ion localization and detection is in progress. Recently the hyperfine structure of the 6d{sub 2}D{sub 3/2} states and the isotope shift of the 6d{sub 2}D{sub 3/2}-7p{sub 2}P{sub 1/2} transition in the isotopes {sup 209-214}Ra{sup +} has been measured in online laser spectroscopy experiments at the KVI AGOR/TRIμP facility. These results are essential for the interpretation of an APV measurement in Ra{sup +}.

  3. Systematic study of heavy cluster emission from {sup 210-226}Ra isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P., E-mail: drkpsanthosh@gmail.com [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India); Sahadevan, Sabina; Priyanka, B.; Unnikrishnan, M.S. [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India)

    2012-05-15

    The half lives for various clusters lying in the cold reaction valleys of {sup 210-226}Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of {sup 4}He and {sup 14}C clusters from {sup 210-226}Ra isotopes are in good agreement with experimental data. Half lives are also computed using the universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic {sup 208}Pb daughter in cluster decay process. Geiger-Nuttall plots for all clusters up to {sup 62}Fe are studied and are found to be linear with different slopes and intercepts. {sup 12,14}C emission from {sup 220}Ra; {sup 14}C emission from {sup 222,224}Ra; {sup 14}C and {sup 20}O emission from {sup 226}Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  4. [The effect of the mutant genes Ta, Ra and Sd on early embryogenesis in mice].

    Science.gov (United States)

    Sakharova, N Iu; Malashenko, A M; Mezhevikina, L M; Lepikhov, K A; Fialkovskaia, L A

    1996-01-01

    We studied early embryonic mortality of mice from mutant stocks Tabby (Ta, X-chromosome) and RaSd (RaSd/++, chromosome 2) maintained in the heterozygous state in F1 CBA x C57B1/6 hybrid. Tabby and RaSd mice were reciprocally crossed with F1 mice and examined for the morphological status of embryos washed from the oviduct on the third day of pregnancy, when the stage of eight blastomeres is normally attained. Mortality was evaluated from the number of embryos which did not reach the expected stage by this time. The results have shown that 2-4 cell embryos, which have received gene Ta with the X-chromosome of the female parent, differed from embryos with F1 genotype at the same stage of development by their increased mortality rate, whereas among embryos obtained from RaSd, the mortality was mainly observed before cleavage. Death of embryos receiving the mutant gene from hemizygous Ta males or heterozygous RaSd/++ males was not significantly different from the mortality of embryos without these mutations.

  5. Castration modulates singing patterns and electrophysiological properties of RA projection neurons in adult male zebra finches

    Directory of Open Access Journals (Sweden)

    Songhua Wang

    2014-04-01

    Full Text Available Castration can change levels of plasma testosterone. Androgens such as testosterone play an important role in stabilizing birdsong. The robust nucleus of the arcopallium (RA is an important premotor nucleus critical for singing. In this study, we investigated the effect of castration on singing patterns and electrophysiological properties of projection neurons (PNs in the RA of adult male zebra finches. Adult male zebra finches were castrated and the changes in bird song assessed. We also recorded the electrophysiological changes from RA PNs using patch clamp recording. We found that the plasma levels of testosterone were significantly decreased, song syllable’s entropy was increased and the similarity of motif was decreased after castration. Spontaneous and evoked firing rates, membrane time constants, and membrane capacitance of RA PNs in the castration group were lower than those of the control and the sham groups. Afterhyperpolarization AHP time to peak of spontaneous action potential (AP was prolonged after castration.These findings suggest that castration decreases song stereotypy and excitability of RA PNs in male zebra finches.

  6. La Realidad Aumentada (RA. Recursos y propuestas para la innovación educativa

    Directory of Open Access Journals (Sweden)

    Javier J. Maquilón Sánchez

    2017-01-01

    Full Text Available Este artículo contiene una propuesta de experiencia práctica de enseñanza-­‐aprendizaje, basada en la realidad aumentada (RA como recurso didáctico innovador. RA es tanto un concepto como una tecnología 3D interactiva actualmente en desarrollo. Por este motivo, en primer lugar se ha expuesto, por un lado, qué es la RA y, por otro lado, cuáles son las variantes tecnológicas actuales principales. Seguidamente, se ha hecho un análisis reflexivo de varios aspectos, que el docente ha de considerar respecto a la RA como tecnología aplicada a la educación, destacando la aportación innovadora de la RA como recurso didáctico. Finalmente se presenta el diseño y la elaboración de la actividad, tipo webquest que incluye un blog de aula.

  7. PADI4 Haplotypes in Association with RA Mexican Patients, a New Prospect for Antigen Modulation

    Directory of Open Access Journals (Sweden)

    Maria Guadalupe Zavala-Cerna

    2013-01-01

    Full Text Available Peptidyl arginine deiminase IV (PAD 4 is the responsible enzyme for a posttranslational modification called citrullination, originating the antigenic determinant recognized by anti-cyclic citrullinated peptide antibodies (ACPA. Four SNPs (single nucleotide polymorphisms have been described in PADI4 gene to form a susceptibility haplotype for rheumatoid arthritis (RA; nevertheless, results in association studies appear contradictory in different populations. The aim of the study was to analyze if the presence of three SNPs in PADI4 gene susceptibility haplotype (GTG is associated with ACPA positivity in patients with RA. This was a cross-sectional study that included 86 RA patients and 98 healthy controls. Polymorphisms PADI4_89, PADI4_90, and PADI4_92 in the PADI4 gene were genotyped. The susceptibility haplotype (GTG was more frequent in RA patients; interestingly, we found a new haplotype associated with RA with a higher frequency (GTC. There were no associations between polymorphisms and high scores in Spanish HAQ-DI and DAS-28, but we did find an association between RARBIS index and PADI4_89, PADI4_90 polymorphisms. We could not confirm an association between susceptibility haplotype presence and ACPA positivity. Further evidence about proteomic expression of this gene will determine its participation in antigenic generation and autoimmunity.

  8. Sobre o uso da variável raça-cor em estudos quantitativos

    Directory of Open Access Journals (Sweden)

    Jerônimo Oliveira Muniz

    2010-06-01

    Full Text Available A crescente inclusão da raça no debate público brasileiro, o aumento da sua disponibilidade em pesquisas de opinião e monitoramento e a facilidade de inclusão da variável em modelos estatísticos tem provocado um paradoxo na importância da raça. Ao mesmo tempo em que a cor da pele vem ganhando relevância no debate político, ela também vem perdendo a sua importância substantiva como um construto social complexo e dinâmico por ser utilizada de modo superficial, como uma categoria permanente e imutável em estudos quantitativos. Este ensaio bibliográfico discorre sobre os fatores que contribuem para essa tendência levando em conta a literatura nacional e internacional produzida nos últimos dez anos. Questiona-se o uso da raça em políticas públicas atentando-se para a sua confiabilidade, variabilidade e validade e discutem-se as limitações e possibilidades de uso da raça como um demarcador de diferenças. O ensaio conclui-se sugerindo uma agenda de pesquisa para aprimorar o entendimento e reduzir as incertezas associadas ao uso da variável "raça" em estudos quantitativos.

  9. Knock-down of IL-1Ra in obese mice decreases liver inflammation and improves insulin sensitivity.

    Directory of Open Access Journals (Sweden)

    Niclas Franck

    Full Text Available Interleukin 1 Receptor antagonist (IL-1Ra is highly elevated in obesity and is widely recognized as an anti-inflammatory cytokine. While the anti-inflammatory role of IL-1Ra in the pancreas is well established, the role of IL-1Ra in other insulin target tissues and the contribution of systemic IL-1Ra levels to the development of insulin resistance remains to be defined. Using antisense knock down of IL-1Ra in vivo, we show that normalization of IL-1Ra improved insulin sensitivity due to decreased inflammation in the liver and improved hepatic insulin sensitivity and these effects were independent of changes in body weight. A similar effect was observed in IL1-R1 KO mice, suggesting that at high concentrations of IL-1Ra typically observed in obesity, IL-1Ra can contribute to the development of insulin resistance in a mechanism independent of IL-1Ra binding to IL-1R1. These results demonstrate that normalization of plasma IL-1Ra concentration improves insulin sensitivity in diet- induced obese mice.

  10. Safety and biodistribution assessment of sc-rAAV2.5IL-1Ra administered via intra-articular injection in a mono-iodoacetate-induced osteoarthritis rat model

    Directory of Open Access Journals (Sweden)

    Gensheng Wang

    2016-01-01

    Full Text Available Interleukin-1 (IL-1 plays an important role in the pathophysiology of osteoarthritis (OA, and gene transfer of IL-1 receptor antagonist (IL-1Ra holds promise for OA treatment. A preclinical safety and biodistribution study evaluated a self-complementary adeno-associated viral vector carrying rat IL-1Ra transgene (sc-rAAV2.5rIL-1Ra at 5 × 108, 5 × 109, or 5 × 1010 vg/knee, or human IL-1Ra transgene (sc-rAAV2.5hIL-1Ra at 5 × 1010 vg/knee, in Wistar rats with mono-iodoacetate (MIA–induced OA at days 7, 26, 91, 180, and 364 following intra-articular injection. The MIA-induced OA lesions were consistent with the published data on this model. The vector genomes persisted in the injected knees for up to a year with only limited vector leakage to systemic circulation and uptake in tissues outside the knee. Low levels of IL-1Ra expression and mitigation of OA lesions were observed in the vector-injected knees, albeit inconsistently. Neutralizing antibodies against the vector capsid developed in a dose-dependent manner, but only the human vector induced a small splenic T-cell immune response to the vector capsid. No local or systemic toxicity attributable to vector administration was identified in the rats as indicated by clinical signs, body weight, feed consumption, clinical pathology, and gross and microscopic pathology through day 364. Taken together, the gene therapy vector demonstrated a favorable safety profile.

  11. Minimal clinically important difference in radiological progression of joint damage. A definition based on patient perspective.

    NARCIS (Netherlands)

    Welsing, P.M.J.; Borm, G.F.; Riel, P.L.C.M. van

    2006-01-01

    OBJECTIVE: To estimate a threshold for minimal clinically important radiological progression of joint damage using its longitudinal relation with functional disability in patients with rheumatoid arthritis (RA). To validate existing estimates of minimal clinically important difference (MCID) using

  12. CLINICAL AND FUNCTIONAL FEATURES OF PANCREAS STATE IN RHEUMATOID ARTHRITIS

    Directory of Open Access Journals (Sweden)

    O. O. Basieva

    2000-01-01

    Full Text Available Aim of study: complex pancreas study in rheumatoid arthritis (RA. Material and methods: 120 RA pts were examined clinically Pancreas US-and biochemical study (level of a-amylase and lipase of blood serum by kinetic-calorimetric method was performed in this grouh. Results: 50.8% of pts demonstrated increase of pancreas echo, in 23.3%- widened Wirsung s duct, in 45%- single small focal indurations, more often in the body and cauda pancreatis. Decrease of lipolitic and amylolytic pancreas activity is characteristic for RA, especially in systemic process and long-term disease. Clinical and functional disturbances are connected with morphological changes.

  13. Altered expression of retinoic acid (RA) receptor mRNAs in the fetal mouse secondary palate by all-trans and 13-cis RAs: implications for RA-induced teratogenesis.

    Science.gov (United States)

    Naitoh, H; Mori, C; Nishimura, Y; Shiota, K

    1998-01-01

    Retinoic acid (RA) is mandatory for various biological processes and normal embryonic development but is teratogenic at high concentrations. In rodents, one of the major malformations induced by RA is cleft palate (CP). RA mediates its effects by RA receptors (RARs), but the expression patterns of RARs in the developing palate are still unclear. We investigated the normal expression of RAR alpha, beta, and gamma messenger RNAs (mRNAs) in the fetal mouse secondary palate and the effects of all-trans and 13-cis RAs on the expression of RAR mRNAs by Northern blot analysis. RAR alpha (2.8, 3.8 kb), RAR beta (3.3 kb), and RAR gamma (3.7 kb) mRNAs were detected in the fetal palate on gestational days (GD) 12.5-14.5. The expression of RAR alpha and gamma mRNAs did not show apparent sequential changes, but that of RAR beta mRNA increased at GD 13.5. Treatment of pregnant mice with 100 mg/kg all-trans RA induced CP in 94% of the fetuses and elevated the levels of RAR beta and gamma mRNAs in the fetal palate. The up-regulation of RAR beta mRNA by all-trans RA was more marked than that of RAR gamma mRNA. Treatment with 100 mg/kg 13-cis RA induced CP in only 19% of the fetuses. Although 13-cis RA elevated the RAR beta and gamma mRNA levels in fetal palates, its up-regulation was slower and less marked than that induced by all-trans RA. These findings indicate that the induction of RAR beta mRNA in the fetal palate correlates well with the tissue concentration of all-trans RA after RA treatment, and RAR beta may be one of the most influential candidate molecules for RA-induced teratogenesis.

  14. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things.

    Science.gov (United States)

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-09-09

    LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  15. On-line Excited-State Laser Spectroscopy of Trapped Short-Lived Ra$^+$ Ions

    CERN Document Server

    Versolato, O O; Wansbeek, L W; Berg, J E van den; van der Hoek, D J; Jungmann, K; Kruithof, W L; Onderwater, C J G; Sahoo, B K; Santra, B; Shidling, P D; Timmermans, R G E; Willmann, L; Wilschut, H W

    2010-01-01

    As an important step towards an atomic parity violation experiment in one single trapped Ra$^+$ ion, laser spectroscopy experiments were performed with on-line produced short-lived $^{212,213,214}$Ra$^+$ ions. The isotope shift of the $6\\,^2$D$_{3/2}$\\,-\\,$7\\,^2$P$_{1/2}$ and $6\\,^2$D$_{3/2}$\\,-\\,$7\\,^2$P$_{3/2}$ transitions and the hyperfine structure constant of the $7\\,^2$S$_{1/2}$ and $6\\,^2$D$_{3/2}$ states in $^{213}$Ra$^+$ were measured. These values provide a benchmark for the required atomic theory. A lower limit of $232(4)$ ms for the lifetime of the metastable $6\\,^2$D$_{5/2}$ state was measured by optical shelving.

  16. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    Science.gov (United States)

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-01-01

    LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed. PMID:27618064

  17. Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

    2007-09-01

    The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

  18. Feasibility and Domain Validation of Rheumatoid Arthritis (RA) Flare Core Domain Set

    DEFF Research Database (Denmark)

    Bartlett, Susan J; Bykerk, Vivian P; Cooksey, Roxanne

    2015-01-01

    OBJECTIVE: The Outcome Measures in Rheumatology (OMERACT) Rheumatoid Arthritis (RA) Flare Group was established to develop an approach to identify and measure RA flares. An overview of our OMERACT 2014 plenary is provided. METHODS: Feasibility and validity of flare domains endorsed at OMERACT 11...... (2012) were described based on initial data from 3 international studies collected using a common set of questions specific to RA flare. Mean flare frequency, severity, and duration data were presented, and domain scores were compared by flare status to examine known-groups validity. Breakout groups......, and stiffness scores averaged ≥ 2 times higher (2 of 11 points) in flaring individuals. Correlations between flare domains and corresponding legacy instruments were obtained: r = 0.46 to 0.93. A combined definition (patient report of flare and 28-joint Disease Activity Score increase) was evaluated in 2 other...

  19. A survey on LPWA technology: LoRa and NB-IoT

    Directory of Open Access Journals (Sweden)

    Rashmi Sharan Sinha

    2017-03-01

    Full Text Available By 2020, more than twenty five billion devices would be connected through wireless communications. In accordance with the rapid growth of the internet of things (IoT market, low power wide area (LPWA technologies have become popular. In various LPWA technologies, narrowband (NB-IoT and long range (LoRa are two leading technologies. In this paper, we provide a comprehensive survey on NB-IoT and LoRa as efficient solutions connecting the devices. It is shown that unlicensed LoRa has advantages in terms of battery lifetime, capacity, and cost. Meanwhile, licensed NB-IoT offers benefits in terms of QoS, latency, reliability, and range.

  20. Diatom species composition in the Raška river (Southwestern Serbia

    Directory of Open Access Journals (Sweden)

    Vidaković Danijela P.

    2015-01-01

    Full Text Available The paper presents data on the composition of epilithic diatoms in the Raška River. Samples were collected by scraping stone surfaces with a brush from 5 localities along the Raška River in April, June, August and November 2011 and March and May 2012. Diatom frustules were cleaned using cold acid method, and mounted on permanent slides. An investigation of the Raška River resulted in description of 106 diatom taxa. The most species rich genera are Navicula (10, Gomphonema (10 and Nitzschia (9, while other genera are presented with one or more species. Detailed floristic analysis of the benthic diatom flora in this river has not been conducted before. Therefore, this paper provides a groundwork for future researches. [Projekat Ministarstva nauke Republike Srbije, br. TR 037009

  1. Low-level measurements of Ra-226/Rn-222 by pulse ionization chambers

    Science.gov (United States)

    El-Daoushy, Fand; Garcia-Tenorio, Rafael

    1988-10-01

    Characteristics of two ionization chambers have been studied and the chambers utilized for 226Ra/ 222Rn measurements for more than ten years. The results obtained show that coating of internal surfaces with a pure and thin Ag-layer enhances the background of ionization chambers in spite of some improvements at the early stages of operation. In addition to previously known parameters influencing the accuracy in routine measurements, new correction factors are suggested. 226Ra impurities in the body of ionization chambers are found to act not only as a permanent, but also as a temperature-dependent source of background. Earlier accuracies of 226Ra/ 222Rn measurements have been considerably improved by assuring long-term mechanical and thermal stability of the ionization chambers.

  2. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    Directory of Open Access Journals (Sweden)

    Aloÿs Augustin

    2016-09-01

    Full Text Available LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s, connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  3. Recommendations for an update of 2003 European regulatory requirements for registration of drugs to be used in the treatment of RA.

    Science.gov (United States)

    Smolen, Josef S; Boers, Maarten; Abadie, Eric C; Breedveld, Ferdinand C; Emery, Paul; Bardin, Thomas; Goel, Niti; Ethgen, Dominique J; Avouac, Bernard P; Dere, Willard H; Durez, Patrick; Matucci-Cerinic, Marco; Flamion, Bruno; Laslop, Andrea; Lekkerkerker, Frits J; Miossec, Pierre; Mitlak, Bruce H; Ormarsdóttir, Sif; Paolozzi, Laurence; Rao, Ravi; Reiter, Susan; Tsouderos, Yannis; Reginster, Jean-Yves

    2011-02-01

    Since 2003, the European Medicines Agency (EMA) document, 'Points to consider on clinical investigation of medicinal products other than NSAIDs (nonsteroidal anti-inflammatory drugs) for the treatment of rheumatoid arthritis' has provided guidance for the clinical development of both biologic and non-biologic disease-modifying antirheumatic drugs (DMARDs). In the last few years, several new products have been developed or are in development for the treatment of RA, which offer significant efficacy with regard to disease control, including prevention of structural damage and disability. Concurrently, novel insights have been gained with respect to the assessment of disease activity, joint damage and disability. New treatment strategies have been established which relate to early therapy, tight control and rapid switching of medication. Accordingly, several new EULAR/ACR recommendations have been or are being developed. Several important additions and changes are needed in the 2003 guidance to incorporate the current scientific knowledge into clinical trial design for the development of future products. Under the auspices of the Group for the Respect of Ethics and Excellence in Science (GREES), a group of experts in the field of RA and clinical trial design met to provide a consensus recommendation for an update to the 2003 EMA guidance document.

  4. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty bay region; Avaliacao da concentracao de atividade de Ra-226, Ra-228 e Pb-210 em sedimentos provenientes da Antartica na regiao da baia do Almirantado

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Tamires de Araujo

    2015-07-01

    The natural radionuclides from radioactive series of {sup 238}U, {sup 235}U and {sup 232}Th have been applied as tracers in environmental studies for understanding the dynamics that occur in both marine and terrestrial environment, as for example, in research of oceanic processes and management of the coastal region. In the marine environment, these radionuclides can be used to estimate biogeochemical fluxes of marine particles and nutrients that occur in the water column as well as in the sediment. Several research works applied the distribution and the respective disequilibrium degree of natural radionuclides in the environment, including geochronological models for obtaining historical information on samples of certain sediment profile. In this study we performed a radiochemical characterization of the distribution of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb from a sedimentary column called 1B (248 cm long) collected in the Admiralty Bay, Antarctic Peninsula region. The methodology used included the acid leaching of sediment samples followed by the radiochemical sequential separation of {sup 226}Ra and {sup 228}Ra by co-precipitation with Ba(Ra)SO{sub 4} and {sup 210}Pb by co-precipitation with PbCrO{sub 4}. All measurements were carried out by counting of gross alpha and gross beta measures in a low background gas flow proportional detector. The activity concentrations of {sup 226}Ra and {sup 210}Pb were used to estimate the unsupported {sup 210}Pb activities present in sediment profile 1 B. Based on unsupported {sup 210}Pb data and the application of the CIC model (Constant Initial Concentration), it was possible to determine the sedimentation rate of 0.59 ± 0.05 cm /year. (author)

  5. Utility of the new rheumatoid arthritis 2010 ACR/EULAR classification criteria in routine clinical care

    Science.gov (United States)

    Kennish, Lauren; Labitigan, Monalyn; Budoff, Sam; Filopoulos, Maria T; McCracken, W Andrew; Swearingen, Christopher J; Yazici, Yusuf

    2012-01-01

    Objectives The new 2010 American College of Rheumatology/European League Against Rheumatism (ACR/EULAR) criteria for rheumatoid arthritis (RA) have been designed to classify early onset RA, but has not been studied to identify RA in patients with arthritis seen in routine clinical care where correct ‘classification’ of patients, when they are not selected for having RA would be important. Design Prospective, consecutive patients cohort. Setting Outpatient clinic of a university rheumatology centre. Participants A total of 126 patients with joint symptoms were consecutively recruited. Interventions The ACR/EULAR RA criteria were applied, with questions followed by a targeted musculoskeletal exam. The gold standard for the diagnosis of RA was the primary rheumatologist's diagnosis. Primary outcome measure Number of patients with non-RA diagnosis who were classified as having RA by the new classification criteria. Results The sensitivity and specificity of the 2010 criteria in classifying RA were 97% and 55%, respectively, compared with the 1987 RA criteria which were 93% and 76%, respectively. The 2010 criteria as applied to this group of patients had a poorer positive predictive (44% vs 61%) and a similar negative predictive value (98% vs 97%) compared with the 1987 criteria. More specifically, 66.7% of systemic lupus erythematosus patients, 50% of osteoarthritis, 37.5% of psoriatic arthritis and 27.2% of others fulfilled the new criteria and could have been classified as RA. Conclusions In this, we believe, the first study to examine the new 2010 ACR/EULAR RA criteria among consecutive patients seen in routine care, we found the criteria to have low specificity, and therefore incorrectly label those as having RA when, in fact, they may have a different type of inflammatory arthritis. Physicians need to be aware of this when applying the new criteria for classifying their patients for any purpose. PMID:23035013

  6. CLINICAL-SIGNIFICANCE OF INTERLEUKIN-6 MEASUREMENT IN EARLY RHEUMATOID-ARTHRITIS - RELATION WITH LABORATORY AND CLINICAL-VARIABLES AND RADIOLOGICAL PROGRESSION IN A 3 YEAR PROSPECTIVE-STUDY

    NARCIS (Netherlands)

    VANLEEUWEN, MA; WESTRA, J; LIMBURG, PC; VANRIEL, PLCM; VANRIJSWIJK, MH

    1995-01-01

    Objective-To evaluate the clinical significance of interleukin-6 (IL-6) measurements in relation to laboratory and clinical measures of disease activity and radiological progression in early rheumatoid arthritis (RA). Methods-A Irrespective study was performed in 51 patients with early RA during the

  7. A theoretical model for the production of Ac-225 for cancer therapy by neutron capture transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Melville, P

    2013-02-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation by bombarding Ra-226 with high-energy neutrons from a neutron source to produce Ra-225 and hence Ac-225, which can be used as a generator to produce Bi-213 for use in 'Targeted Alpha Therapy' for cancer. This paper examines the possibility of producing Ac-225 by neutron capture using a theoretical model in which neutron energy is convoluted with the corresponding neutron cross sections of Ra-226. The total integrated yield can then be obtained. This study shows that an intense beam of high-energy neutrons could initiate neutron capture on Ra-226 to produce Ra-225 and hence practical amounts of Ac-225 and a useful reduction of Ra-226. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. Človeški vidik varnosti računalništva v oblaku

    OpenAIRE

    Maraž, Nataša

    2016-01-01

    Magistrska naloga obravnava človeške aspekte varnosti računalništva v oblaku. Predstavljen je pregled literature na področju oblačnih storitev oziroma računalništva v oblaku. Podan je tudi pregled uporabe oblačnih storitev z vidika posameznika in organizacij, še posebej pri storitvah v bančništvu. Zaradi čedalje večje uporabe oblačnih storitev v bančništvu je opredeljen pristop ohranjanja informacijske varnosti, ki jih zagotavljajo tri glavne dimenzije. Navedene so tudi trenutno veljavne regu...

  9. {sup 226} Ra committed effective dose assessment for osteoporosis treatment with `Gran-White` dolomite

    Energy Technology Data Exchange (ETDEWEB)

    Pecequilo, Brigitte R.S.; Campos, Marcia P. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1997-12-01

    A total of 6 dolomite samples were prepared for activity concentration measurement by using high resolution gamma-ray spectrometry. The calculated average specific activity of {sup 226} Ra was 4.34 Bq/kg. The committed effective dose due to the Ra-226 specific activity in dolomite was performed following the ICRP 30 and ICRP 61 procedures and dose conversion factors. Values of 1.95 x 10{sup -6} Sv were obtained for committed effective dose and 5.93 x 10{sup -5} Sv for committed dose equivalent in the bone surface. (author). 9 refs., 2 tabs.

  10. Determination of specific activities of U-238, Ra-226, Ra-228 e Th-228 in samples of mineral fertilizers with phosphorus; Determinacao das atividades especificas de U-238, Ra-226, Ra-228 e Th-228 em amostras de fertilizantes minerais com fosforo

    Energy Technology Data Exchange (ETDEWEB)

    Garcez, R.W.D.; Lopes, J.M.; Silva, A.X. da, E-mail: rgarcez@nuclear.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharoa (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Domingues, A.M.; Lima, M.A.F. [Universidade Federal Fluminense (UFF),Niteroi, RJ (Brazil)

    2016-07-01

    Samples were analyzed by gamma spectrometry mineral fertilizers with the HPGe detector and aid LabSOCS software for calculating the detection efficiency curve. Specific activities found for Pa-234m, Ra-226, Ra-228 and Th-228 in samples of phosphate fertilizers were 505 Bq.kg{sup -1}, 458 Bq.kg{sup -1}, 450 Bq.kg{sup -1} and 394 Bq.kg{sup -1}, respectively. And for the NPK fertilizer samples were found average values of 390 Bq.kg{sup -1}, 252 Bq.kg{sup -1}, 280 Bq.kg{sup -1} and 268 Bq.kg{sup -1}, respectively. (author)

  11. Initial Results from the Radiation Dosimetry Experiment (RaD-X) Balloon Flight Mission

    Science.gov (United States)

    Mertens, Christopher J.

    2015-01-01

    The NASA Radiation Dosimetry Experiment (RaD-X) high-altitude balloon mission was successfully launched from Fort Sumner, New Mexico USA on 25 September, 2015. Over 15 hours of science data were obtained from four dosimeters at altitudes above about 25 km. The four dosimeters flown on the RaD-X science payload are a Hawk version 3.0 Tissue Equivalent Proportional Counter (TEPC) manufactured by Far West Technologies, a Liulin dosimeter-spectrometer produced by the Solar Research and Technology Institute, Bulgarian Academy of Sciences, a total ionizing dose detector manufactured by Teledyne Microelectronic Technologies, and the RaySure detector provided by the University of Surrey.

  12. THE RELATION BETWEEN CHANT AND MYTY ON THE AIKEWÁRA RITE

    Directory of Open Access Journals (Sweden)

    Gilmar Matta da Silva

    2009-12-01

    Full Text Available In the group of tradicional knowledges that include the most varied fields of the knowledge of the indigenous people the song (music doesn't present a status differentiated as it happens in our society, but it is associated to other practices as the construction of the musical instruments, the narration of the myths, the performance of the dances and rituals. Based in the oral tradition of Aikewára the article emphases the relationship between song and myth to analize the integration and interaction and the Sapurahái of Karuára.

  13. Respuesta del tomate para proceso al riego parcial de la raíz

    OpenAIRE

    2007-01-01

    La escasez de agua para riego es un factor que limita la producción mundial. Prácticas orientadas al ahorro del agua para la agricultura son necesarias. El riego parcial de la raíz (RPR) podría ser una opción. Para valorar esta práctica, se estudiaron dos factores. El primer factor fue el sistema de riego de dos tipos: riego por gravedad (RG) y riego por goteo (RGo). El segundo factor fue la forma de aplicar el riego con dos niveles: el riego completo de la raíz (RCR) y el RPR. Este último co...

  14. Marguerite Yourcenar et le projet d'opéra de Wells Hively

    Directory of Open Access Journals (Sweden)

    Rémy Poignault

    2008-07-01

    Full Text Available L’étude de la correspondance de Marguerite Yourcenar avec Wells Hively croisée avec l’examen de deux versions du livret d’opéra proposées par le compositeur américain révèle comment Yourcenar, d’abord bien intentionnée, se montre critique à l’égard de cette tentative de réécriture pour l’opéra de l’épisode d’Antinoüs.

  15. Kus sündis Louis Kahn? / Olavi Pesti

    Index Scriptorium Estoniae

    Pesti, Olavi, 1950-

    2006-01-01

    Eesti päritolu ameerika arhitekti Louis Kahni (sünd. Itze-Leib Schmuilowsky) perekonnalugu. 6.-7. okt. 2006. a. Kuressaares toimuvatest Kahni päevadest, küsimustele vastab peakorraldaja Ingrid Mald-Villand

  16. Kus sündis Louis Kahn? / Olavi Pesti

    Index Scriptorium Estoniae

    Pesti, Olavi, 1950-

    2006-01-01

    Eesti päritolu ameerika arhitekti Louis Kahni (sünd. Itze-Leib Schmuilowsky) perekonnalugu. 6.-7. okt. 2006. a. Kuressaares toimuvatest Kahni päevadest, küsimustele vastab peakorraldaja Ingrid Mald-Villand

  17. Töötervishoid laias maailmas / refereerinud Hubert Kahn

    Index Scriptorium Estoniae

    2010-01-01

    Töötervishoiu uudiseid Hiinast, Jaapanist, Aafrikast ja Euroopast ajakirjadest Asian-Pasific Newsletter on Occupational Health and Safety ja African Newsletter on Occupational Health and Safety (2009) nr. 3

  18. The Kodaikanal Experience: Chapter I. Kahn-Wikramaratne Interview

    Science.gov (United States)

    NAMTA Journal, 2013

    2013-01-01

    The Kodaikanal years were from late 1942 to March, 1944, a period of internment for Maria Montessori against her will in India. Yet in these remote hills, a fanfare and training course emerged, and so did the inspiration for an in-depth unification principle for the elementary program which we now loosely call Cosmic Education. These two…

  19. Töötervishoid laias maailmas / refereerinud Hubert Kahn

    Index Scriptorium Estoniae

    2010-01-01

    Töötervishoiu uudiseid Hiinast, Jaapanist, Aafrikast ja Euroopast ajakirjadest Asian-Pasific Newsletter on Occupational Health and Safety ja African Newsletter on Occupational Health and Safety (2009) nr. 3

  20. Automation of [(18) F]fluoroacetaldehyde synthesis: application to a recombinant human interleukin-1 receptor antagonist (rhIL-1RA).

    Science.gov (United States)

    Morris, Olivia; McMahon, Adam; Boutin, Herve; Grigg, Julian; Prenant, Christian

    2016-06-15

    [(18) F]Fluoroacetaldehyde is a biocompatible prosthetic group that has been implemented pre-clinically using a semi-automated remotely controlled system. Automation of radiosyntheses permits use of higher levels of [(18) F]fluoride whilst minimising radiochemist exposure and enhancing reproducibility. In order to achieve full-automation of [(18) F]fluoroacetaldehyde peptide radiolabelling, a customised GE Tracerlab FX-FN with fully programmed automated synthesis was developed. The automated synthesis of [(18) F]fluoroacetaldehyde is carried out using a commercially available precursor, with reproducible yields of 26% ± 3 (decay-corrected, n = 10) within 45 min. Fully automated radiolabelling of a protein, recombinant human interleukin-1 receptor antagonist (rhIL-1RA), with [(18) F]fluoroacetaldehyde was achieved within 2 h. Radiolabelling efficiency of rhIL-1RA with [(18) F]fluoroacetaldehyde was confirmed using HPLC and reached 20% ± 10 (n = 5). Overall RCY of [(18) F]rhIL-1RA was 5% ± 2 (decay-corrected, n = 5) within 2 h starting from 35 to 40 GBq of [(18) F]fluoride. Specific activity measurements of 8.11-13.5 GBq/µmol were attained (n = 5), a near three-fold improvement of those achieved using the semi-automated approach. The strategy can be applied to radiolabelling a range of peptides and proteins with [(18) F]fluoroacetaldehyde analogous to other aldehyde-bearing prosthetic groups, yet automation of the method provides reproducibility thereby aiding translation to Good Manufacturing Practice manufacture and the transformation from pre-clinical to clinical production.

  1. Ultrasound-detected joint inflammation and B cell count: related variables for rituximab-treated RA patients?

    Science.gov (United States)

    Valor, Lara; Martínez-Estupiñán, Lina; Janta, Iustina; Nieto, Juan Carlos; Ovalles-Bonilla, Juan Gabriel; González-Fernández, Carlos; Del Rio, Tamara; Hernández-Flórez, Diana; Monteagudo, Indalecio; López-Longo, Francisco Javier; Naredo, Esperanza

    2016-06-01

    This cross-sectional observational study aimed to explore the relationship between B cell count and ultrasound (US)-detected synovitis, in patients with rheumatoid arthritis treated with rituximab. Thirty-seven consecutive RA patients treated with RTX were recruited for the study. The patients underwent clinical [i.e., Disease Activity Score 28 joints (DAS28)], laboratory, and US assessment of 12 joints. Each joint was semiquantitatively (0-3) scored on B-mode and power Doppler mode. The scores were summed, and a global index was created for BM (BMS) and PD scores (PDI) synovitis. BM subclinical synovitis was evident in all patients, with PD synovial signal detected in 16 patients (43.2 %). No correlation was found between DAS28 and US scores. B cells were detected in 27 (72.9 %) patients, but there was no association in the mean B cell count and disease activity as measured by DAS28 (DAS28  2.6 = 49.45, p = 0.52) and PDI score (PDI  1 = 35.44, p = 0.54). There was no correlation between the B cell count and DAS28, BMS, and PDI (r = 0.020, p = 0.907; r = -0.151, p = 0.371; r = -0.099, p = 0.558, respectively). In RTX-treated RA patients, no relationship could be established between US-detected synovitis and peripheral blood B cell count.

  2. Clinical and immunological features of early rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    N A Shostak

    2004-01-01

    Full Text Available Objective. To study clinical and immunological features of rheumatoid arthritis (RA early stage. Material and Methods. 130 RA pts aged 16 to 80 years (mean age 52,5 years, 105 female and 25 male were examined. 55 pts had disease duration up to 1 year, 34 - between 1 and 3 years and 41 - more than 3 years. Standard clinical, laboratory and radiological examination was performed in all pts. In 43 pts with earlv RA T and В cell receptors were studied with monoclonal antibodies against CD3, CD72, CD4, CD8, CDI6. Results. The most frequent initial symptoms preceding characteristic RA picture were arthralgia (39,2%, fever (34,6% and body weight loss (24,6%. Mono- or oligoarticuiar onset with subsequent quick transformation into polyarthritis within one year revealed in 61,5% of pts was the usual feature of early RA. The most frequent false diagnoses in early RA were osteoarthritis (in 25,1%, reactive arthritis (in 24,9% and gout (in 4,6%. Male pts had longer morning stiffness, higher levels of C-reactive protein, more pronounced functional disability, T and В cell immunity activation than female. Conclusion. Understanding of essential clinical and immunologic features of early RA will allow to diagnose the disease in time.

  3. Active phagocytosis of Mycobacterium tuberculosis (H37Ra) by T lymphocytes (Jurkat cells).

    Science.gov (United States)

    Zhang, Min; Zhu, Qi; Shi, Ming; Liu, Yang; Ma, Lei; Yang, Yining; Feng, Dongyun; Dai, Wen; Zhang, Lin; Kang, Tao; Chen, Ping; He, Ying; Liu, Tingting; Zhao, Qing; Wang, Wenjing; Zhi, Jin; Feng, Guodong; Zhao, Gang

    2015-08-01

    This study aimed to co-culture Jurkat T lymphocytes with inactivated Mycobacterium tuberculosis (Mtb H37Ra), explore whether T lymphocytes could phagocytose H37Ra cells, and determine the underlying mechanism. Jurkat T lymphocytes were co-cultured with H37Ra cells, and confocal laser scanning microscopy, electron microscopy, and flow cytometry techniques were used to identify phagocytosis and elucidate its mechanism. After Jurkat T lymphocytes phagocytosed H37Ra cells, the cell body became larger, with abundant cytoplasm, the portion of the nucleus closest to the bacterium deformed, long and short pseudopodia were extended, and the folds of the cell membrane formed depressions that created phagocytic vesicles surrounding the bacterium. The macropinocytosis inhibitor amiloride and the cytoskeletal inhibitor cytochalasin D were found to inhibit phagocytic efficacy; serum complements might enhance phagocytosis through opsonization. Jurkat T lymphocytes could actively phagocytose inactivated Mtb via the macropinocytotic mechanism. Actin remodeling played an important role in the macropinocytotic process. Serum complements may regulate phagocytosis.

  4. The Societal Dimension of Art: On Mara Raţiu’s Art as Social Activity

    Directory of Open Access Journals (Sweden)

    Cristian Hainic

    2012-05-01

    Full Text Available REVIEW OF Raţiu, Mara. Arta ca activitate socială: avatarurile discursului filosofic asupra artei contemporane (Art as Social Activity: The Avatars of Philosophical Discourse on Contemporary Art. Cluj-Napoca: Casa Cărţii de Ştiinţă, 2011.

  5. Fatigue as experienced by patients with rheumatoid arthritis (RA): a qualitative study.

    NARCIS (Netherlands)

    Repping-Wuts, H.; Uitterhoeve, R.; Riel, P.L.C.M. van; Achterberg, T. van

    2008-01-01

    OBJECTIVE: Interest in fatigue research has grown since the finding that fatigue is, besides pain, the symptom most frequently reported by patients with rheumatoid arthritis (RA). The aim of this study was to explore the experience of fatigue from the patients' perspective. METHODS: Twenty-nine pati

  6. GPS-free Geolocation using LoRa in Low-Power WANs

    DEFF Research Database (Denmark)

    Petersen, Martin Nordal; Fargas, Bernat Carbonés

    2017-01-01

    Internet of Things (IoT) has been growing over the last few years in multiple applications and due to the high need GPS for tracking capabilities, an innovative opportunity arises. This paper reports on a design and implementation of a LoRaWAN tracking system which is capable exploiting transmitted...

  7. Cosmic radiation dose measurements from the RaD-X flight campaign

    Science.gov (United States)

    Mertens, Christopher J.; Gronoff, Guillaume P.; Norman, Ryan B.; Hayes, Bryan M.; Lusby, Terry C.; Straume, Tore; Tobiska, W. Kent; Hands, Alex; Ryden, Keith; Benton, Eric; Wiley, Scott; Gersey, Brad; Wilkins, Richard; Xu, Xiaojing

    2016-10-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission obtained measurements for improving the understanding of cosmic radiation transport in the atmosphere and human exposure to this ionizing radiation field in the aircraft environment. The value of dosimetric measurements from the balloon platform is that they can be used to characterize cosmic ray primaries, the ultimate source of aviation radiation exposure. In addition, radiation detectors were flown to assess their potential application to long-term, continuous monitoring of the aircraft radiation environment. The RaD-X balloon was successfully launched from Fort Sumner, New Mexico (34.5°N, 104.2°W) on 25 September 2015. Over 18 h of flight data were obtained from each of the four different science instruments at altitudes above 20 km. The RaD-X balloon flight was supplemented by contemporaneous aircraft measurements. Flight-averaged dosimetric quantities are reported at seven altitudes to provide benchmark measurements for improving aviation radiation models. The altitude range of the flight data extends from commercial aircraft altitudes to above the Pfotzer maximum where the dosimetric quantities are influenced by cosmic ray primaries. The RaD-X balloon flight observed an absence of the Pfotzer maximum in the measurements of dose equivalent rate.

  8. Evaluation of the Psychometric Properties of SOGS-RA in the Polish Version

    Directory of Open Access Journals (Sweden)

    Jolanta Jarczyńska

    2016-09-01

    Full Text Available Objective: The objective was to adapt the American pathological gambling screening tool /SOGS-RA The South Oaks Gambling Screen - Revised for Adolescent/ by K. Winters, R. Stinchfield and J. Fulkerson (1993 and to evaluate its psychometric properties. Method: The adapted tool was used in research on a randomly selected sample of 2,617 adolescents aged 13-20 years in the 2012/2013 school year. Results: On the SOGS-RA scale, 2.6% of the trial participants achieved a score indicating past year problem gambling before the survey, 4.1% were classified as problem gamblers, whereas 17.3% of adolescents engaged in social gambling that did not pose a problem gambling risk at the time. The SOGS-RA demonstrated satisfactory internal consistency (Cronbach's alpha = 0.78. Conclusions: The Polish adaptation of the SOGS-RA scale is reliable and accurate, which is why it is worth recommending it for use in further research on Polish adolescents.

  9. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the characteristi

  10. Spreading of water masses and regeneration of silica and sup(226)Ra in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    DileepKumar, M.; Yuan-Hui, Li

    Ra in the Indian Ocean 93 OEOSECS STATION NUYDER V. A40W INDIAN _ ____ 6 I I I ‘6’ I I I I I 0 I 2 I L l&l 0 4 5 6 GEOSECS STATION NUMBER 203 IQ EQ 209 IO. EQ LATITUDE Fig. 6. (b) Spreading of water masses (%) in the central Indian...

  11. Association of IL-2RA/CD25 with type 1 diabetes in the Belgian population

    NARCIS (Netherlands)

    Aminkeng, Folefac; Weets, Ilse; Van Autreve, Jan E.; Koeleman, Bobby P. C.; Quartier, Erik; Van Schravendijk, Chris; Gorus, Frans K.; Van der Auwera, Bart J. R.

    2010-01-01

    Our goals were to study the proposed association of IL-2RA /CD25 with type 1 diabetes in the Belgian population over a broad age range and to explore possible correlations with disease phenotypes immune markers HLA DQ INS and PTPN22 Patients (n = 1954) healthy controls (n = 2082) and families (n = 4

  12. Pseudomonas fluorescens Tn5-B20 mutant RA92 responds to carbon limitation in soil

    NARCIS (Netherlands)

    Overbeek, van L.S.; Elsas, van J.D.; Veen, van J.A.

    1997-01-01

    Tn5-B20 (lacZ as reporter gene) transcriptional fusion mutants of Pseudomonas fluorescens R2f Rpr were screened for their response to carbon limitation. Reporter gene expression was specifically induced by this stress factor in one mutant, designated RA92, and to a lower extent by phosphorus and nit

  13. Selective removal of 226Ra2+ from gas-field-produced waters

    NARCIS (Netherlands)

    Leeuwen, van Fijs W.B.; Miermans, Cornelis J.H.; Beijleveld, Hans; Tomasberger, Tanja; Davis, Jeffery T.; Verboom, Willem; Reinhoudt, David N.

    2005-01-01

    The 226Ra2+ selectivity of both the self-assembled (iso)guanosine-based systems and ionizable thiacalix[4]crown dicarboxylic acids was determined in gas-field-produced water and a metal ion-containing model solution (simulant). Seven gas-field-produced water samples have been analyzed. From a sample

  14. Social Metaphorical Mapping of the Concept of Force "CHI-KA-RA" in Japanese

    Science.gov (United States)

    Suzuki, Mariko

    2005-01-01

    This research focused on the concept of "force" ("CHI-KA-RA" in Japanese) in Newtonian mechanics. The primary objective was to develop a tool, based on metaphor, to interpret student thinking in learning scientific topics. The study provides an example of using the tool to trace the process of mutual changes in thinking during a dialog among…

  15. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the

  16. NetRaVE: constructing dependency networks using sparse linear regression

    DEFF Research Database (Denmark)

    Phatak, A.; Kiiveri, H.; Clemmensen, Line Katrine Harder;

    2010-01-01

    NetRaVE is a small suite of R functions for generating dependency networks using sparse regression methods. Such networks provide an alternative to interpreting 'top n lists' of genes arising out of an analysis of microarray data, and they provide a means of organizing and visualizing the resulting...

  17. Teater annab ära tuleviku / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2003-01-01

    Rakvere Teatris esineb 8. ja 9. aug. rahvusvaheline performance'i trupp Insightout Company, kus teeb kaasa ka Mari Mägi. Lavastus kannab pealkirja "Ära anda tulevik" ja see on inspireeritud trupi liikmete mälupiltidest ja I. Allende romaanist "Paula"

  18. Towards a precise measurement of atomic parity violation in a single Ra+ ion

    NARCIS (Netherlands)

    Nunez Portela, M.; van den Berg, J. E.; Bekker, H.; Giri, G.S.; Hoekstra, S.; Jungmann, K.; Mohanty, A.; Onderwater, G.J.C.; Santra, B.; Schlesser, S.; Timmermans, R.G.E.; Versolato, O.O.; Wansbeek, L.W.; Willmann, L.; Wilschut, H.W.

    2013-01-01

    A single trapped Ra+(Z= 88) ion provides a very promising route towards a most precise measurement of Atomic Parity Violation (APV), since APV effects grow faster than Z 3. This experiment promises the best determination of the electroweak coupling constant at the lowest accessible energies. Such a

  19. Teater annab ära tuleviku / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2003-01-01

    Rakvere Teatris esineb 8. ja 9. aug. rahvusvaheline performance'i trupp Insightout Company, kus teeb kaasa ka Mari Mägi. Lavastus kannab pealkirja "Ära anda tulevik" ja see on inspireeritud trupi liikmete mälupiltidest ja I. Allende romaanist "Paula"

  20. 226Ra activity in the mullet species Liza aurata and South Adriatic Sea marine.

    Science.gov (United States)

    Antovic, N M; Antovic, I; Svrkota, N

    2010-08-01

    (226)Ra activity in the South Adriatic Sea-water, surface sediment, mud with detritus, seagrass (Posidonia oceanica) samples and the mullet (Mugilidae) species Liza aurata, as well as soil and sand from the Montenegrin Coast-was measured using the six-crystal gamma-coincidence spectrometer PRIPYAT-2M. The results are used for calculation of the absorbed (and annual effective) dose rates in air due to the (226)Ra gamma radiation. The absorbed dose rates ranged from 5.94 to 97.16 nGy h(-1) (soil) and from 0.65 to 7.65 nGy h(-1) (sand). In seawater (226)Ra activity is found to be from 0.08 to 0.15 Bq l(-1), while in whole L. aurata individuals from 0.58 to 1.97 Bq kg(-1). Annual intake of (226)Ra by human consumers of this fish species has been estimated to provide an effective dose of 0.006 mSv y(-1).

  1. RaPAL Bulletin, Numbers 5-13, 1988-1990.

    Science.gov (United States)

    RaPAL Bulletin, 1988

    1988-01-01

    This document consists of a 3-year compilation (9 issues) of the RaPAL (Research and Practice in Adult Literacy) Bulletin. Typical articles are: "Student Involvement in Research" (a report of a workshop by Alex Golightly, Nick Nicola, and Marilyn Stone); part of a dialogue between Paolo Freire and Ira Shor, writer/educators of Brazil and the…

  2. Tartu Ülikooli Pärnu kolledž / Ra Luhse

    Index Scriptorium Estoniae

    Luhse, Ra, 1964-

    1999-01-01

    Endise vabrikuhoone rekonstrueerimine ja uue õppehoone juurdeehitus. Uue kaasaegse vormikeelega hoone kavandamisel on arvestatud etapiviisilise väljaehitamisega. Projekteerija Arhitektuuribüroo Luhse & Tuhal, arhitektid Ra Luhse, Tanel Tuhal, Leles Luhse. Ehitus: AS Eston Ehitus. Projekt 1997-1998, valminud on uus õppehoone. 13 illustratsiooni. Luhse & Tuhal (arhitektibüroo). Eston Ehitus (ehitusettevõte)

  3. Data of evolutionary structure change: 1C2RA-1COTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C2RA-1COTA 1C2R 1COT A A -GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLY... THR CA 278 1COT A 1COTA...9563 20.21500015258789 -19.988000869750977 tion> 0.286000013351440430.7390000224113464 tion> 1.702983021736145 3.216418981552124 ...

  4. USA pastor trotsib soovitusi koraanipõletamine ära jätta / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2010-01-01

    Florida pastori Terry Jonesi plaan 11. septembril panna põlema 200 koraani on pälvinud kriitikat ja tal on palutud üritus ära jätta. Mitmes riigis on toimunud meeleavaldused Jonesi aktsiooni vastu

  5. Assessment of {sup 226}Ra age-dependent dose from water intake

    Energy Technology Data Exchange (ETDEWEB)

    Porntepkasemsan, Boonsom [Research and Development Group, Thailand Institute of Nuclear Technology, Vibhavadi Rangsit Road, Bangkok 10900 (Thailand)], E-mail: boonsom@oaep.go.th; Srisuksawad, Kanitha [Research and Development Group, Thailand Institute of Nuclear Technology, Vibhavadi Rangsit Road, Bangkok 10900 (Thailand)

    2008-11-15

    The radioactivity in canal and ground waters collected in a 2-year long observation from the vicinity of the Rare Earth Research and Development Center (RRDC), Phathumthani Province, Thailand, was measured in order to determine the concentration of {sup 226}Ra and to estimate the age-dependent effective dose to humans due to consumption. {sup 226}Ra activities in both canal and ground waters were well below the WHO guidance level for drinking water quality of 1 Bq L{sup -1}. The highest {sup 226}Ra effective doses per year were found for infants and teens. However, the observed levels of calculated {sup 226}Ra effective doses for all age groups in both canal and ground waters show satisfactory low values (less than 15 {mu}Sv yr{sup -1}). These values are acceptable in accordance with the WHO recommended reference dose level of 100 {mu}Sv yr{sup -1} from water intake of 2 L day{sup -1}.

  6. Analysis of Latency and MAC-layer Performance for Class A LoRaWAN

    DEFF Research Database (Denmark)

    Sørensen, René Brandborg; Kim, Dong Min; Nielsen, Jimmy Jessen

    2017-01-01

    We propose analytical models that allow to investigate the performance of Long Range Wide Area Network (LoRaWAN) uplink in terms of latency, collision rate, and throughput under the constraints of the regulatory duty cycling, when assuming exponential inter-arrival times. Our models take into acc...

  7. Data of evolutionary structure change: 2B9RA-2BPMD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B9RA-2BPMD 2B9R 2BPM A D -VKDIYAYLRQLEAAQAVRPKYLLGR-EVTGNMRAILID...line>THR CA 261 GLY CA 332 ASN CA 307 2BPM... D 2BPMD YMKKQPDITNS .../line> ASP CA 206 VAL CA 247 GLU CA 298 2BPM... D 2BPMD

  8. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the characteristi

  9. Tussenrapportage over fase 1 en 2 van het vervolgonderzoek naar Ra-226 in havenspeciepoldergronden

    NARCIS (Netherlands)

    Stoop P; Pennders RMJ; Lembrechts JFMM; LSO

    1994-01-01

    De ook in Nederland belangrijk toegenomen aandacht voor de risico's van radon (met name Rn-222)in het binnenhuismilieu waren voor VROM aanleiding een onderzoek te laten doen naar de relatie tussen de radonconcentratie in woningen en het gehalte aan radium (Ra-226)in de bodem waarop deze sta

  10. Data of evolutionary structure change: 1C8RA-3CODB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C8RA-3CODB 1C8R 3COD A B TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFY...ne>PHE CA 209 GLY CA 249 PHE CA 274 3COD... B 3CODB YILYVLFFGFTSKA...ne>GLU CA 222 VAL CA 302 3COD B 3CODB TSKAESMRPEV HHGGG

  11. Data of evolutionary structure change: 1C8RA-3CODA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C8RA-3CODA 1C8R 3COD A A TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFY...ne>PHE CA 209 GLY CA 249 PHE CA 274 3COD... A 3CODA YILYVLFFGFTSKA...>GLU CA 222 VAL CA 302 3COD A... 3CODA TSKAESMRPEV HHGGG H

  12. Evolution of the Role of RA and FGF Signals in the Control of Somitogenesis in Chordates.

    Science.gov (United States)

    Bertrand, Stéphanie; Aldea, Daniel; Oulion, Silvan; Subirana, Lucie; de Lera, Angel R; Somorjai, Ildiko; Escriva, Hector

    2015-01-01

    During vertebrate development, the paraxial mesoderm becomes segmented, forming somites that will give rise to dermis, axial skeleton and skeletal muscles. Although recently challenged, the "clock and wavefront" model for somitogenesis explains how interactions between several cell-cell communication pathways, including the FGF, RA, Wnt and Notch signals, control the formation of these bilateral symmetric blocks. In the cephalochordate amphioxus, which belongs to the chordate phylum together with tunicates and vertebrates, the dorsal paraxial mesendoderm also periodically forms somites, although this process is asymmetric and extends along the whole body. It has been previously shown that the formation of the most anterior somites in amphioxus is dependent upon FGF signalling. However, the signals controlling somitogenesis during posterior elongation in amphioxus are still unknown. Here we show that, contrary to vertebrates, RA and FGF signals act independently during posterior elongation and that they are not mandatory for posterior somites to form. Moreover, we show that RA is not able to buffer the left/right asymmetry machinery that is controlled through the asymmetric expression of Nodal pathway actors. Our results give new insights into the evolution of the somitogenesis process in chordates. They suggest that RA and FGF pathways have acquired specific functions in the control of somitogenesis in vertebrates. We propose that the "clock and wavefront" system was selected specifically in vertebrates in parallel to the development of more complex somite-derived structures but that it was not required for somitogenesis in the ancestor of chordates.

  13. Tourism potentials of the Raška region and development of rural tourism

    Directory of Open Access Journals (Sweden)

    Pavlović Mila

    2011-01-01

    Full Text Available In order to find solutions for stopping negative economic processes in the Raška region, as well as land reclamation and depopulation of villages, one of the main activities is adequate restructuration of the economy, according to available resources. In this paper we analyze a place of tourism in the Raška region, as an activity to which is not given appropriate developmental role in the previous development policies, as opposed to diverse and attractive natural and anthropogenic values. In the paper we identify the most significant tourism potentials of the Raška region and their evaluation score. Special attention is given to rural tourism as one of the activities that can have a greater role in future plans for demographic and economic revitalization of this area. We analyze the current state of rural tourism in the Raška region, and indicate main limiting factors that prevent rapid development of this, in many ways, primary form of tourism.

  14. Model for the induction of bone cancer by /sup 224/Ra. [In man

    Energy Technology Data Exchange (ETDEWEB)

    Groer, P.G.; Marshall, J.H.

    1976-01-01

    A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by ..cap alpha.. irradiation is applied to /sup 224/Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transforming events is the killing of any endosteal cell by ..cap alpha.. irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human /sup 224/Ra cases: after the decay of /sup 224/Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate; for exposure to the same dose the model predicts an increased number of tumors for protracted exposure (i.e., exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by /sup 224/Ra in man.

  15. Association of the IL2RA/CD25 Gene With Juvenile Idiopathic Arthritis

    Science.gov (United States)

    Hinks, Anne; Ke, Xiayi; Barton, Anne; Eyre, Steve; Bowes, John; Worthington, Jane; Thompson, Susan D; Langefeld, Carl D; Glass, David N; Thomson, Wendy

    2009-01-01

    Objective IL2RA/CD25, the gene for interleukin-2 receptor α, is emerging as a general susceptibility gene for autoimmune diseases because of its role in the development and function of regulatory T cells and the association of single-nucleotide polymorphisms (SNPs) within this gene with type 1 diabetes mellitus (DM), Graves' disease, rheumatoid arthritis (RA), and multiple sclerosis (MS). The aim of this study was to determine whether SNPs within the IL2RA/CD25 gene are associated with juvenile idiopathic arthritis (JIA). Methods Three SNPs within the IL2RA/CD25 gene, that previously showed evidence of an association with either RA, MS, or type 1 DM, were selected for genotyping in UK JIA cases (n = 654) and controls (n = 3,849). Data for 1 SNP (rs2104286) were also available from North American JIA cases (n = 747) and controls (n = 1,161). Association analyses were performed using Plink software. Odds ratios (ORs) and 95% confidence intervals (95% CIs) were calculated. Results SNP rs2104286 within the IL2RA/CD25 gene was significantly associated with UK JIA cases (OR for the allele 0.76 [95% CI 0.66–0.88], P for trend = 0.0002). A second SNP (rs41295061) also showed modest evidence for association with JIA (OR 0.80 [95% CI 0.63–1.0], P = 0.05). Association with rs2104286 was convincingly replicated in the North American JIA cohort (OR 0.84 [95% CI 0.65–0.99], P for trend = 0.05). Meta-analysis of the 2 cohorts yielded highly significant evidence of association with JIA (OR 0.76 [95% CI 0.62–0.88], P = 4.9 × 10−5). Conclusion These results provide strong evidence that the IL2RA/CD25 gene represents a JIA susceptibility locus. Further investigation of the gene using both genetic and functional approaches is now required. PMID:19116909

  16. Functional analysis of the Phycomyces carRA gene encoding the enzymes phytoene synthase and lycopene cyclase.

    Directory of Open Access Journals (Sweden)

    Catalina Sanz

    Full Text Available Phycomyces carRA gene encodes a protein with two domains. Domain R is characterized by red carR mutants that accumulate lycopene. Domain A is characterized by white carA mutants that do not accumulate significant amounts of carotenoids. The carRA-encoded protein was identified as the lycopene cyclase and phytoene synthase enzyme by sequence homology with other proteins. However, no direct data showing the function of this protein have been reported so far. Different Mucor circinelloides mutants altered at the phytoene synthase, the lycopene cyclase or both activities were transformed with the Phycomyces carRA gene. Fully transcribed carRA mRNA molecules were detected by Northern assays in the transformants and the correct processing of the carRA messenger was verified by RT-PCR. These results showed that Phycomyces carRA gene was correctly expressed in Mucor. Carotenoids analysis in these transformants showed the presence of ß-carotene, absent in the untransformed strains, providing functional evidence that the Phycomyces carRA gene complements the M. circinelloides mutations. Co-transformation of the carRA cDNA in E. coli with different combinations of the carotenoid structural genes from Erwinia uredovora was also performed. Newly formed carotenoids were accumulated showing that the Phycomyces CarRA protein does contain lycopene cyclase and phytoene synthase activities. The heterologous expression of the carRA gene and the functional complementation of the mentioned activities are not very efficient in E. coli. However, the simultaneous presence of both carRA and carB gene products from Phycomyces increases the efficiency of these enzymes, presumably due to an interaction mechanism.

  17. 利用 HPGe γ谱仪快速测量226 Ra%Rapid Measurement of 226 Ra Using HPGe Gamma Spectrometer

    Institute of Scientific and Technical Information of China (English)

    张轶名; 於国兵; 杜勤; 闻德运; 顾先宝; 潘灵婧

    2014-01-01

    HPGeγ谱分析中,一般通过测量222 Rn的子体来确定样品中226 Ra的含量,这种方法需要对样品密封数周后测量,无法实现样品中226 Ra含量的快速测量。文章分析了样品γ谱中186 keV全能峰的计数来源,对使用186 keV全能峰计算出的226 Ra的含量结果进行修正,得到较好的实验结果,实现了用186 keV全能峰快速测量样品中Ra的含量。%In general , the content of 226 Ra in a sample is deduced from results of 222 Rn progeny in HPGeγspectral analysis .Because the sample should be sealed for several weeks before the measurement , we can not get the results quickly through this method .The paper analyzes the source of the counts of the full -en-ergy peak in 186 keV in the full-energy peak , and modifies the result of 226 Ra content calculated by using the full-energy peak in 186 keV.The study gets good experiment results and realizes the rapid measurement of Ra in samples using the full -energy peak in 186 keV.

  18. Quantification of {sup 235} U and {sup 226} Ra in soil samples by means of Gamma spectroscopy; Cuantificacion de {sup 235} U y {sup 226} Ra en muestras de suelo por medio de espectrometria gamma

    Energy Technology Data Exchange (ETDEWEB)

    Quintero P, E.; Rojas M, V.P.; Montes M, F.R.; Gaso P, M.I.; Cervantes N, M.L. [Gerencia de Innovacion Tecnologica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of {sup 235} U and {sup 226} Ra; also is presented the method for the {sup 226} Ra correction activity. (Author)

  19. The role of combined application of RF,AKA,anti-CCP antibody and CRP in diagnosing rheumatoid arthritis%联合检测 RF、AKA、抗 CCP 抗体和 CRP 对 RA 的诊断价值

    Institute of Scientific and Technical Information of China (English)

    王波; 牛莉莉; 常波

    2016-01-01

    Objective To explore the clinical value of combination detection of rheumatoid factor(RF),anti-cyclic citrullinated peptide antibody (CCP),anti-keratin antibody(AKA)and c-reactive protein (CRP)in the diagnosing rheu-matoid arthritis(RA).Methods The serum samples of 68 RA patients and 42 other autoimmune diseases patients were collected.Anti-CCP antibody was detected by chemiluminescent microparticle immunoassay(CMIA).AKA was meas-ured by indirect immunofluorescence.Both RF and CRP were detected by Immune turbidimetry (ITM).Then analyze the results.Results In RA group,positive rate of RF,Anti-CCP antibody,AKA,CRP was obviously higher than those of other autoimmune diseases patients(P <0.01 or P <0.05),the difference between both groups was statistically sig-nificant.Single diagnostic sensitivity of RA from high to low ranking is CRP Anti-CCP antibody RF AKA.The diagnos-tic specificity of RA from high to low ranking is AKA Anti-CCP antibody RF CRP.Four series of joint detection im-proves the sensitivity (91.2%)of RA diagnosis,parallel combined detection can improve the specificity and even reached 100%.Conclusion The RF,AKA,Anti-CCP antibody and CRP detection alone RA has good sensitivity and specificity,but a separate application index easily missed diagnosis or misdiagnosis.Combined detection of four indexes may offer clinical benefits for diagnosis of RA and can significantly improve the specificity and sensitivity to diagnose RA.%目的:探讨联合检测类风湿因子(RF)、抗角蛋白抗体(AKA)、抗环瓜氨酸多肽(CCP)抗体和 C 反应蛋白(CRP)在类风湿性关节炎(RA)诊断中的价值。方法收集68例 RA 病人和42例非 RA 的自身免疫病病人血清,化学发光微粒子免疫法测抗 CCP 抗体,间接免疫荧光法检测 AKA,免疫比浊法测 RF 和 CRP,然后对检测结果进行计算分析。结果RA 组 RF、AKA、抗 CCP 抗体和 CRP 的阳性率均明显高于非 RA 组,且差

  20. The Cossacks of the South of Russia in R.A. Fadeev’s geopolitical plans

    Directory of Open Access Journals (Sweden)

    Kuznetsov Oleg Viktorovich

    2013-11-01

    Full Text Available The political project of a conservative writer of political essays of the second half of the XIX c. R.A. Fadeev (1824–1883, in which a key part is assigned to the attraction of the Cossacks of Southern Russia to solving the pressing foreign policy issues, is analyzed. A conclusion that the Cossacks could be used as a militant vanguard, i.e. military force (infantry, cavalry, reconnaissance and an effective tool of the colonization of the suburbs of the Russian Empire – is drawn. The conditions under which R.A. Fadeev could implement his plans are revealed. The key condition is the preservation of the identity of the Cossacks as a class and as a sub-ethnos. The historical assessment of the R.A. Fadeev’s plans is given. According to the plans R.A. Fadeev, revived after the reforms of its military power, Russia should not only play a key role in international relations, but also strive for a first impact and then rule on its neighboring Asian and European territories. And in the perspective he saw the new world order, in which there would be two dominating superpowers, Russia and the United States. The Cossacks were assigned an important role in the implementation of these plans by the publicist.This geopolitical project, no matter how attractive it was not for the Russians at first glance, was a utopia. The publicist obviously overestimated the military and economic capabilities of contemporary Imperial Russia, the ability of the autocracy to the socio-economic and political renewal of the country corresponding to the demands of the times. Consequently, the Cossacks were not destined to play the role which was assigned to them by R.A. Fadeev. Althoughhe anticipated accurately the individual elements of the future world order established for several decades in the XX century.

  1. Mucosal delivery of anti-inflammatory IL-1Ra by sporulating recombinant bacteria

    Directory of Open Access Journals (Sweden)

    Ruggiero Paolo

    2004-10-01

    Full Text Available Abstract Background Mucosal delivery of therapeutic protein drugs or vaccines is actively investigated, in order to improve bioavailability and avoid side effects associated with systemic administration. Orally administered bacteria, engineered to produce anti-inflammatory cytokines (IL-10, IL-1Ra, have shown localised ameliorating effects in inflammatory gastro-intestinal conditions. However, the possible systemic effects of mucosally delivered recombinant bacteria have not been investigated. Results B. subtilis was engineered to produce the mature human IL-1 receptor antagonist (IL-1Ra. When recombinant B. subtilis was instilled in the distal colon of rats or rabbits, human IL-1Ra was found both in the intestinal lavage and in the serum of treated animals. The IL-1Ra protein in serum was intact and biologically active. IL-1-induced fever, neutrophilia, hypoglycemia and hypoferremia were inhibited in a dose-dependent fashion by intra-colon administration of IL-1Ra-producing B. subtilis. In the mouse, intra-peritoneal treatment with recombinant B. subtilis could inhibit endotoxin-induced shock and death. Instillation in the rabbit colon of another recombinant B. subtilis strain, which releases bioactive human recombinant IL-1β upon autolysis, could induce fever and eventually death, similarly to parenteral administration of high doses of IL-1β. Conclusions A novel system of controlled release of pharmacologically active proteins is described, which exploits bacterial autolysis in a non-permissive environment. Mucosal administration of recombinant B. subtilis causes the release of cytoplasmic recombinant proteins, which can then be found in serum and exert their biological activity in vivo systemically.

  2. LoRa Scalability: A Simulation Model Based on Interference Measurements

    Directory of Open Access Journals (Sweden)

    Jetmir Haxhibeqiri

    2017-05-01

    Full Text Available LoRa is a long-range, low power, low bit rate and single-hop wireless communication technology. It is intended to be used in Internet of Things (IoT applications involving battery-powered devices with low throughput requirements. A LoRaWAN network consists of multiple end nodes that communicate with one or more gateways. These gateways act like a transparent bridge towards a common network server. The amount of end devices and their throughput requirements will have an impact on the performance of the LoRaWAN network. This study investigates the scalability in terms of the number of end devices per gateway of single-gateway LoRaWAN deployments. First, we determine the intra-technology interference behavior with two physical end nodes, by checking the impact of an interfering node on a transmitting node. Measurements show that even under concurrent transmission, one of the packets can be received under certain conditions. Based on these measurements, we create a simulation model for assessing the scalability of a single gateway LoRaWAN network. We show that when the number of nodes increases up to 1000 per gateway, the losses will be up to 32%. In such a case, pure Aloha will have around 90% losses. However, when the duty cycle of the application layer becomes lower than the allowed radio duty cycle of 1%, losses will be even lower. We also show network scalability simulation results for some IoT use cases based on real data.

  3. Zaštita računarskih mreža / Protection of computer networks

    Directory of Open Access Journals (Sweden)

    Milojko Jevtović

    2005-09-01

    Full Text Available U radu su obrađene metode napada, oblici ugrožavanja i vrste pretnji kojima su izložene računarske mreže, kao i moguće metode i tehnička rešenja za zaštitu mreža. Analizirani su efekti pretnji kojima mogu biti izložene računarske mreže i informacije koje se preko njih prenose. Opisana su određena tehnička rešenja koja obezbeđuju potreban nivo zaštite računarskih mreža, kao i mere za zaštitu informacija koje se preko njih prenose. Navedeni su standardi koji se odnose na metode i procedure kriptozaštite informacija u računarskim mrežama. U radu je naveden primer zaštite jedne lokalne računarske mreže. / In this paper different methods of attacks, threats and different forms of dangers to the computer networks are described. The possible models and technical solutions for networks protection are also given. The effects of threats directed to the computer networks and their information are analyzed certain technical solutions that provide necessary protection level of the computer networks as well as measures for information protection are also described. The standards for methods and security procedure for the information in computer networks are enlisted. There is also an example of protecting one local data network (in this paper.

  4. Successful TB treatment induces B-cells expressing FASL and IL5RA mRNA.

    Science.gov (United States)

    van Rensburg, Ilana C; Wagman, Chandre; Stanley, Kim; Beltran, Caroline; Ronacher, Katharina; Walzl, Gerhard; Loxton, Andre G

    2017-01-10

    Activated B-cells increase T-cell behaviour during autoimmune disease and other infections by means of cytokine production and antigen-presentation. Functional studies in experimental autoimmune encephalomyelitis (EAE) indicate that B-cell deficiencies, and a lack of IL10 and IL35 leads to a poor prognosis. We hypothesised that B-cells play a role during tuberculosis. We evaluated B-cell mRNA expression using real-time PCR from healthy community controls, individuals with other lung diseases and newly diagnosed untreated pulmonary TB patients at three different time points (diagnosis, month 2 and 6 of treatment).We show that FASLG, IL5RA, CD38 and IL4 expression was lower in B-cells from TB cases compared to healthy controls. The changes in expression levels of CD38 may be due to a reduced activation of B-cells from TB cases at diagnosis. By month 2 of treatment, there was a significant increase in the expression of APRIL and IL5RA in TB cases. Furthermore, after 6 months of treatment, APRIL, FASLG, IL5RA and CD19 were upregulated in B-cells from TB cases. The increase in the expression of APRIL and CD19 suggests that there may be restored activation of B-cells following anti-TB treatment. The upregulation of FASLG and IL5RA indicates that B-cells expressing regulatory genes may play an important role in the protective immunity against M.tb infection. Our results show that increased activation of B-cells is present following successful TB treatment, and that the expression of FASLG and IL5RA could potentially be utilised as a signature to monitor treatment response.

  5. Estimation of dose rate of a package ({sup 223+}Ra) and evaluation of transport index; Dosisleistungsabschaetzung bei einem Versandstueck ({sup 223+}Ra) und Ermittlung der Transportkennzahl nach ADR

    Energy Technology Data Exchange (ETDEWEB)

    Bittner, Michael [TUEV SUED Industrie Services GmbH, Region Nordost, Leipzig (Germany). Anlagensicherheit/Strahlenschutz; Richter, Jens [TUEV SUED Industrie Services GmbH, Region Nordost, Dresden (Germany). Anlagensicherheit/Strahlenschutz

    2016-08-01

    The transport index of a package is to be determined according to provisions of the ADR. It is directly related to the maximum radiation level in mSv/h at a distance of 1 m from the external surface of the package or pallet. To evaluate the existing distribution of the dose equivalent outside the package or pallet calculations of photon dose rates are required. For Monte-Carlo simulations with MCNP5 a three-dimensional model of a package containing Xofigo trademark was created, which contains all relevant sources from {sup 223}Ra and its decay chain.

  6. Therapy palliative with {sup 2}23Ra without special radiation protection measures?; Palliative Therapie mit {sup 223}Ra ohne besondere Strahlenschutzmassnahmen?

    Energy Technology Data Exchange (ETDEWEB)

    Just, Guenther [Forschungsbuero Radonbalneologie (FRB), Grosspoesna (Germany); Petzold, Juergen

    2015-07-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with {sup 223}Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  7. Frequency and effectiveness of dose increase of adalimumab, etanercept, and infliximab in daily clinical practice.

    NARCIS (Netherlands)

    Blom, M.; Kievit, W.; Kuper, H.H.; Jansen, T.L.Th.A.; Visser, H.; Broeder, A. den; Brus, H.L.; Laar, M.A. van de; Riel, P.L.C.M. van

    2010-01-01

    OBJECTIVE: To describe the frequency and effectiveness of dose increase of adalimumab, etanercept, and infliximab in the treatment of rheumatoid arthritis (RA) in daily clinical practice. METHODS: All RA patients with a dose increase of tumor necrosis factor (TNF)-blocking therapy between January

  8. Activity ratios of (234)U/(238)U and (226)Ra/(228)Ra for transport mechanisms of elevated uranium in alluvial aquifers of groundwater in south-western (SW) Punjab, India.

    Science.gov (United States)

    Kumar, A; Karpe, R K; Rout, S; Gautam, Y P; Mishra, M K; Ravi, P M; Tripathi, R M

    2016-01-01

    The concentrations of total dissolved uranium (U), its isotopic composition ((234)U, (235)U, (238)U) and two long lived Ra isotopes ((226)Ra and (228)Ra) in alluvial aquifers of groundwater were determined to investigate the groundwater flow pattern in the south-western (SW) Punjab, India. Particular attention was given to the spatial variability of activity ratios (ARs) of (234)U/(238)U and (226)Ra/(228)Ra to predict the possible sources and supply process of U into the water from the solid phase. The measured groundwater (234)U/(238)U ARs were ∼1 or >1 in the shallow zone (depth  30 m) with relatively low U concentration. The simultaneous elevated U concentration and (234)U/(238)U ARs in waters were possibly due to differences in imprints of rock-water interactions under hydrologic conditions. However, (234)U/(238)U ARs aquifers.

  9. A Single Nucleotide Polymorphism in the Il17ra Promoter Is Associated with Functional Severity of Ankylosing Spondylitis.

    Directory of Open Access Journals (Sweden)

    Jose Ramón Vidal-Castiñeira

    Full Text Available The aim of this study was to identify new genetic variants associated with the severity of ankylosing spondylitis (AS. We sequenced the exome of eight patients diagnosed with AS, selected on the basis of the severity of their clinical parameters. We identified 27 variants in exons and regulatory regions. The contribution of candidate variants found to AS severity was validated by genotyping two Spanish cohorts consisting of 180 cases/300 controls and 419 cases/656 controls. Relationships of SNPs and clinical variables with the Bath Ankylosing Spondylitis Disease Activity and Functional Indices BASDAI and BASFI were analyzed. BASFI was standardized by adjusting for the duration of the disease since the appearance of the first symptoms. Refining the analysis of SNPs in the two cohorts, we found that the rs4819554 minor allele G in the promoter of the IL17RA gene was associated with AS (p<0.005. This variant was also associated with the BASFI score. Classifying AS patients by the severity of their functional status with respect to BASFI/disease duration of the 60th, 65th, 70th and 75th percentiles, we found the association increased from p60 to p75 (cohort 1: p<0.05 to p<0.01; cohort 2: p<0.01 to p<0.005. Our findings indicate a genetic role for the IL17/ILRA axis in the development of severe forms of AS.

  10. Co-contraction in RA patients with a mobile bearing total knee prosthesis during a step-up task

    NARCIS (Netherlands)

    Garling, E.H.; Wolterbeek, N.; Velzeboer, S.; Nelissen, R.G.H.H.; Valstar, E.R.; Doorenbosch, C.A.M.; Harlaar, J.

    2008-01-01

    It was hypothesized that rheumatoid arthritis (RA) patients with a total knee prosthesis that allows axial rotation of the bearing (MB) will show more co-contraction to stabilize the knee joint during a step-up task than RA patients with a fixed bearing total knee prosthesis (FB) where this rotation

  11. SF Treg cells transcribing high levels of Bcl-2 and microRNA-21 demonstrate limited apoptosis in RA

    NARCIS (Netherlands)

    van der Geest, Kornelis S. M.; Smigielska, Katarzyna; Park, Ji-Ah; Abdulahad, Wayel H.; Kim, Hye-Won; Kroesen, Bart-Jan; van den Berg, Anke; Boots, Annemieke M. H.; Lee, Eun-Bong; Brouwer, Elisabeth

    2015-01-01

    Objective. The aim of this study was to investigate the turnover of Treg cells in the SF of RA patients. Methods. Treg cells were enumerated in peripheral blood and SF of RA patients and analysed by flow cytometry for expression of the proliferation marker Ki-67 and binding of the apoptosis marker a

  12. ra kontoris segab tööd / Patrick Kurtz ; tõlk. Pille Korpen

    Index Scriptorium Estoniae

    Kurtz, Patrick

    2005-01-01

    Üldnõuetest kontorite planeerimisel. Müra vähendamise planeerimisest. Tabelid: Müra helivõimsuse taseme allikad; Arvutitöökohtade akustika. Vt. ka: Avatud kontor võib olla ka vaikne. BNSi vastutav peatoimetaja Anvar Samost räägib avatud tööruumi eelistest

  13. ScaRaB and CERES-Terra: results of the inter-comparison campaigns

    Science.gov (United States)

    Trémas, Thierry L.; Aznay, Ouahid; Chomette, Olivier

    2016-09-01

    ScaRaB (SCAnner for RAdiation Budget) is an Indo-French satellite onboard MEGHA-TROPIQUES launched on October 12th 2011. This radiometer has been designed to fill the gap between the ERBS and CERES missions to study the water cycle and energy exchanges in the tropics. ScaRaB is fit with four parallel and independent channels: channel- 2 and channel-3 being considered as the main ones, channel-1 is dedicated to measure solar radiance while channel-4 is an infrared window. The absolute calibration of ScaRaB is achieved by internal calibration sources (black bodies and a lamp for channel-1). The radiometric properties of deserts sites and more especially their stable spectral response over time made them very good candidates to perform temporal monitoring of ScaRaB channel-1. This paper deals with the corresponding results. High altitude clouds are observed by ScaRaB to survey the balance between channel 2 and channel 3: the earth longwave radiance is isolated by subtracting the short-wave channel to the total channel. Radiometric cross calibration of Earth observation sensors is a crucial need to guarantee or quantify the consistency of measurements from different sensors. CERES and ScaRaB Earth Radiation Budget missions have the same specification: to provide an accuracy of 1% in the measurement of short-wave and long-wave radiances and an estimation of the short-wave and long-wave fluxes less than 10 W/m2. Taking advantage of the "equatorial" orbit of Megha-Tropiques, NASA proceeded to manoeuvers on CERES-Terra in order to ease an inter-comparison between both instruments over common targets. Actually, The CERES PAPS mode was used to align its swath scan in order to increase the collocated pixels between the two instruments. The experience lasted 3 months from March 22th and May 31st 2015. A previous similar campaign has already been led in 2012. This article presents the results of these inter-comparisons, providing an indication on the temporal stability of the

  14. Implementation of the Juvenile Justice and Welfare Act of 2006 (RA 9344: Inputs to Policy Amendments

    Directory of Open Access Journals (Sweden)

    DR. FREDDY E. BILOG

    2014-06-01

    Full Text Available The study aimed to assess the status of implementation of RA 9433 or Juvenile Justice and Welfare Act of 2006 with respect to the various sectors namely: police; city social welfare and development and family court.. It also determine the problems encountered by the three groups of respondents and test the difference among the responses of the three groups: to determine the implication of implementation of RA 9344 to the community as perceived by three groups of respondents and based on the findings to propose inputs to policy amendments. It was found out that majority of the juvenile offenders in Batangas City are 15-17 years old, single, males, finished elementary education with crime of theft committed in 2012 and under the custody of their parents or legal guardians. Objectives, compliance, evaluation and monitoring as status of RA 9344 were implemented as a new approach in criminal justice system with juvenile offenders. Each sector experiences problems in implementing RA 9344 especially when it comes to insufficient knowledge of the child, and the parents regarding the child’s severity of crime and constitutional rights. The study found a significant relationship between the status of implementation of RA 9344 and the problems encountered. Further, there are differences between the responses of the three groups of respondents. Exemption of youth offenders in criminal responsibility has an impact on the community since the youth may repeat the crime or they could commit crime that is more severe than the previous crime committed. Additionally, compliance, evaluation and monitoring were found to be significantly related to the impact of exemption of youth offenders in criminal responsibility. Based on the findings, the study identified inputs for possible amendments of policies that govern RA 9344 towards a more efficient and effective implementation. These intervention programs such as child management training and rehabilitative program

  15. CD45RA-Foxp3(low) non-regulatory T cells in the CCR7-CD45RA-CD27+CD28+ effector memory subset are increased in synovial fluid from patients with rheumatoid arthritis.

    Science.gov (United States)

    Matsuki, Fumichika; Saegusa, Jun; Nishimura, Keisuke; Miura, Yasushi; Kurosaka, Masahiro; Kumagai, Shunichi; Morinobu, Akio

    2014-07-01

    Increased numbers of regulatory T (Treg) cells are found in synovial fluid from patients with rheumatoid arthritis (RASF) compared with peripheral blood. However, Treg cells in RASF have been shown to have a decreased capacity to suppress T cells. Here we phenotypically classified CD4+ T cells in RASF into six subsets based on the expression of CD45RA, CCR7, CD27 and CD28, and demonstrated that the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in synovial fluid compared with peripheral blood. In addition, the proportion of Foxp3+ Treg cells in the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in RASF. Furthermore, most of the Foxp3+ Treg cells in RASF were non-suppressive CD45RA-Foxp3(low) non-Treg cells, and the frequency of the non-Treg cells in the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in RASF. Our findings suggest that the pro-inflammatory environment in RA joints may induce the increase of CD45RA-Foxp3(low) non-Treg cells in synovial fluid.

  16. Common variants in IL-17A/IL-17RA axis contribute to predisposition to and progression of congestive heart failure.

    Science.gov (United States)

    Sandip, Chaugai; Tan, Lun; Huang, Jin; Li, Qing; Ni, Li; Cianflone, Katherine; Wang, Dao Wen

    2016-07-01

    Heart failure is characterized by immune activation leading to production and release of proinflammatory cytokines. Interleukin 17A (IL-17A) is a proinflammatory cytokine and multiple lines of evidence from animal and human studies suggest crucial roles of IL-17A in heart failure. Therefore, we investigated whether common polymorphisms of genes IL17A and IL17RA (coding interleukin 17 receptor A) contribute to genetic predisposition to heart failure and adverse clinical outcomes associated with it.A total of 1713 adult patients with congestive heart failure and 1713 age- and sex-matched controls were genotyped for promoter single nucleotide polymorphisms (SNPs), rs2275913 and rs8193037 in IL17A and rs4819554 in IL17RA, to assess the relationship between individual SNPs and the risk of congestive heart failure. Results showed that rs8193037 in IL17A was associated with the risk of congestive heart failure (odds ratio [OR] = 0.76; 95% confidence interval [CI] 0.63-0.90, adjusted P = 0.002) after adjustment for multiple cardiovascular risk factors including age, sex, smoking status, diabetes, hypertension, and dyslipidemia. This association was evident in both ischemic and nonischemic heart failure (P = 0.005 and P = 0.05, respectively). Furthermore, prospective follow-up of 12.7 months for the occurrence of adverse clinical outcomes showed that rs4819554 in IL17RA was significantly associated with cardiovascular mortality (hazard ratio [HR] = 1.28; 95% CI = 1.02-1.59, adjusted P = 0.03) after adjustments for multiple cardiovascular risk factors and New York Heart Association functional class.This study demonstrated associations of rs8193037 in the promoter of IL17A with the risk of congestive heart failure, and of rs4819554 in the promoter of IL17RA with the risk of cardiovascular mortality in patients with congestive heart failure. These data lend further support to the notion that immune activation and genetic polymorphisms contribute to heart failure pathogenesis

  17. Estudio comparado de las Rañas Españolas

    OpenAIRE

    1994-01-01

    Es intención del estudio conseguir un mayor conocimiento geomorfológico de las rañas de las distintas áreas seleccionadas (s de la cantábrica, n y s del Sistema Central, n de los montes de Toledo y ambas vertientes de Sierra Morena) y poner de manifiesto la diversidad de las rañas españolas, con el fin de profundizar en el tema de una posible génesis única o bien una poligenia. La diversidad se ha puesto de manifiesto a través del conocimiento del medio físico (geología, clima, suelo y vegeta...

  18. A COMPARISON OF THE ROSE-WAALER, LATEX FIXATION, "RA-TEST," AND BENTONITE FLOCCULATION TESTS.

    Science.gov (United States)

    Greenbury, C L; Keningale, J

    1960-07-01

    The bentonite flocculation test of Bozicevich, Bunim, Freund, and Ward (1958), the latex fixation test of Singer and Plotz (1956), and the "RA-test" (a latex reagent for use as a slide test) of Hyland Laboratories have been compared with each other and with a modified Rose-Waaler test, the behaviour of which has been previously extensively investigated. In these tests sera from 2,250 patients were tested by two or more methods on 3,000 occasions. The findings of this trial are set out and the merits of the tests and reasons for disagreement among them are discussed. It is concluded that the most satisfactory means of testing rheumatoid sera is by the Rose-Waaler test and the "RA-test," or a satisfactory modification of it, in parallel.

  19. Mechanics of the IL2RA gene activation revealed by modeling and atomic force microscopy.

    Science.gov (United States)

    Milani, Pascale; Marilley, Monique; Sanchez-Sevilla, Albert; Imbert, Jean; Vaillant, Cédric; Argoul, Françoise; Egly, Jean-Marc; Rocca-Serra, José; Arneodo, Alain

    2011-04-13

    Transcription implies recruitment of RNA polymerase II and transcription factors (TFs) by DNA melting near transcription start site (TSS). Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites), located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studies, result in the progressive positioning of curvature apex towards the TSS, likely facilitating local DNA melting. In vitro assays confirm specific binding of the General Transcription Factors (GTFs) TBP and TFIIB over TATA-TSS position, where an inhibitory nucleosome prevented preinitiation complex (PIC) formation and uncontrolled DNA melting. These findings represent a substantial advance showing, first, that the structural properties of the IL2RA promoter are encoded in the DNA sequence and second, that during the initiation process DNA conformation is dynamic and not static.

  20. Data communications with VSATs - RA/TDMA vs. SS/CDMA

    Science.gov (United States)

    Kim, Kap S.

    Random-access TDMA and spread-spectrum CDMA, two of the most predominant hub-VSAT (very-small-aperture terminal) inbound access techniques today, are discussed in relation to the interactive data application environment where the response time is the most critical performance parameter. The system access techniques, access time, channel capacity, and performance comparison are presented. It is concluded that, in general, either RA/TDMA or SS/CDMA can provide cost/performance-effective serivce for interactive applications as compared with terrestrial service alternatives. If the user's data application consists mostly of short message transactions and its inbound aggregated data rate is low (less than 9.6 kb/s), the SS/CDMA system is recommended. The RA/TDMA system is better suited for the user applications which require a mix of interactive and batch processings.

  1. Efecto del hierro en el desarrollo de las raíces de las plantas

    OpenAIRE

    Correa Velásquez, Jairo

    2012-01-01

    Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. ...

  2. Parasitismo em bovinos de raças de carne e brava no concelho de Coruche

    OpenAIRE

    Crespo, Maria Virgínia; Mariano, Pedro; ROSA, FERNANDA

    2013-01-01

    Entre março e maio de 2007 efetuou-se um estudo parasitológico em efetivos bovinos de raças de Carne e Brava do Concelho de Coruche, visando a determinação das principais helmintoses presentes. Colheram-se 206 amostras de fezes em explorações bovinas de carne e 30 em explorações de raça brava. As amostras foram sujeitas a análises coprológicas, com base em métodos qualitativos e quantitativos (técnicas de Willis, de sedimentação e de McMaster). Procedeu-se também à prospeção...

  3. Olivier Caïra, Jeux de rôle. Les forges de la fiction

    Directory of Open Access Journals (Sweden)

    Antoine Dauphragne

    2010-06-01

    Full Text Available Les forges de la fiction, d’Olivier Caïra, est à ranger parmi les rares ouvrages francophones en sciences humaines s’attachant au jeu de rôles. L’ouvrage en propose une analyse fine et dynamique centrée sur la pratique des joueurs. La démarche annoncée, qui entend proposer un texte accessible aussi bien aux rôlistes qu’aux universitaires, semble renvoyer autant à un souci de clarté qu’au profil de l’auteur. Olivier Caïra est sociologue ; ses travaux portent sur l’industrie du divertissement e...

  4. Measurements of octupole collectivity in Rn and Ra nuclei using Coulomb excitation

    CERN Multimedia

    We propose to exploit the unique capability of HIE-ISOLDE to provide post-accelerated $^{221,222}$Rn and $^{222,226,228}$Ra ion beams for the study of octupole collectivity in these nuclei. We will measure E3 transition moments in $^{222}$Rn and $^{222,226,228}$Ra in order to fully map out the variation in E3 strength in the octupole mass region with Z$\\thicksim$88 and N$\\thicksim$134. This will validate model calculations that predict different behaviour as a function of N. We will also locate the position of the parity doublet partner of the ground state in $^{221}$Rn, in order to test the suitability of odd-A radon isotopes for EDM searches.

  5. PACKAGING WASTE MANAGEMENT ON EXAMPLE OF CITY ZIELONA GÓRA

    Directory of Open Access Journals (Sweden)

    Joanna ZARĘBSKA

    2012-01-01

    Full Text Available The article presents the legal requirements of the European Union's packaging waste, and their most recent transposition into Polish law. The author has attempted to describe selected achievements of the Department of Public Utilities and Housing (DPUaH in Zielona Góra, which for many years on behalf of the city, in a systematic way it’s developing municipal waste management system (including packaging, consistent with EU policies and objectives of sustainable development. The deficiencies and weaknesses in the system are taken into consideration, whose liquidation is a priority for future investment of DPUaH consistent with the Waste Management Plan for the City of Zielona Góra.

  6. Precise Study of Fine Structure in $^{14}$C Emission from $^{223}$Ra

    CERN Multimedia

    2002-01-01

    We request 10 shifts in two sessions of beam time at ISOLDE for the production of a $^{223}$Ra source. This source will be used with the superconducting spectrometer SOLENO at Orsay for a precise measurement (good statistics and energy resolution) of the fine stucture in the energy spectrum of $^{14}$C nuclei emitted by $^{223}$Ra, discovered at Orsay in July 1989. The measurement will be devoted to carry out the hindrance factors of the transitions to 15$\\!^-\\!$/2$\\,$ (1.423 MeV) and 5$\\!^+\\!$/2$\\,$ (1.567 MeV) excited states of $^{209}$Pb, which present a particular interest for obtaining spectroscopic information and testing nuclear models.

  7. Studies of transport pathways of Th, U, rare earths, Ra-228, and Ra-226 from soil to plants and farm animals: Final progress report, 1983-1988

    Energy Technology Data Exchange (ETDEWEB)

    Linsalata, P

    1988-07-01

    This report consists of three parts. Part 1 discusses a field study conducted in an area of enhanced, natural radioactivity to assess the soil to edible vegetable concentration ratios (CR = concentration in dry vegetable/concentration in dry soil) of Th-232, Th-230, Ra-226, Ra-228, and the light rare earth elements (REE's), La, Ce, and Nd. Twenty-eight soil, and approximately 42 vegetable samples consisting of relatively equal numbers of seven varieties, were obtained from 11 farms on the Pocos de Caldas Plateau in the state of Minas Gerais, Brazil. This region is the site of a major natural analogue study to assess the mobilization and retardation processes affecting thorium and the REE's at the Morro do Ferro ore body, and uranium series radionuclides at the Osamu Utsumi open pit uranium mine. Thorium (IV) serves as a chemical analogue for quadrivalent plutonium, the light REE's (III) as chemical analogues for trivalent americium and curium, and uranium (VI) as an analogue for transuranics with stable oxidation states above IV, e.g., Pu(VI). Part 2 includes our final measurement results for naturally occurring light rare earth elements (REE's include La, Ce, Nd, and SM), U-series and Th-series radionuclides in adult farm animal tissues, feeds and soils. Our findings on soil-to-tissue concentration ratios (CR's) and the comparative behavior of these elements in farm animals raised under natural conditions by local farmers are presented. Part 3 summarizes our findings to date on the distribution and mobilization of Th-232, light rare earth elements (LREE), U-238 and Ra-228 in the MF basin. Estimates of first order, present day, mobilization rate constants resulting from ground water solubilization and seepage/stream transport are calculated using revised inventory estimates for the occurrence of these elements in the ore body and annual flux estimates for the transport of these elements away from the ore body. 151 refs., 20 figs., 40 tabs.

  8. Mechanics of the IL2RA Gene Activation Revealed by Modeling and Atomic Force Microscopy

    OpenAIRE

    Pascale Milani; Monique Marilley; Albert Sanchez-Sevilla; Jean Imbert; Cédric Vaillant; Françoise Argoul; Jean-Marc Egly; José Rocca-Serra; Alain Arneodo

    2011-01-01

    Transcription implies recruitment of RNA polymerase II and transcription factors (TFs) by DNA melting near transcription start site (TSS). Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites), located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studi...

  9. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-10-12

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  10. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-09-30

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  11. A Brief History of IL-1 and IL-1 Ra in Rheumatology

    Directory of Open Access Journals (Sweden)

    Jean-Michel Dayer

    2017-05-01

    Full Text Available The history of what, in 1979, was called interleukin-1 (IL-1, orchestrator of leukocyte inter-communication, began many years before then, initially by the observation of fever induction via the endogenous pyrogen (EP (1974 and then in rheumatology on the role in tissue destruction in rheumatoid diseases via the induction of collagenase and PGE2 in human synovial cells by a mononuclear cell factor (MCF (1977. Since then, the family has exploded to presently 11 members as well as many membrane-bound and soluble receptor forms. The discovery of a natural Interleukin-1 receptor antagonist (IL-1Ra in human biological fluids has highlighted the importance of IL-1 and IL-1Ra in human diseases. Evidence delineating its role in autoinflammatory syndromes and the elucidation of the macromolecular complex referred to as “inflammasome” have been instrumental to our understanding of the link with IL-1. At present, the IL-1blockade as therapeutic approach is crucial for many hereditary autoinflammatory diseases, as well as for adult-onset Still’s disease, crystal-induced arthropathies, certain skin diseases including neutrophil-triggered skin diseases, Behçet’s disease and deficiency of IL-1Ra and other rare fever syndromes. Its role is only marginally important in rheumatoid arthritis and is still under debate with regard to osteoarthritis, type 2 diabetes mellitus, cardiovascular diseases and cancer. This brief historical review focuses on some aspects of IL-1, mainly IL-1β and IL-Ra, in rheumatology. There are many excellent reviews focusing on the IL-1 family in general or with regard to specific diseases or biological discoveries.

  12. Quantifying bone weathering stages using the average roughness parameter Ra measured from 3D data

    Science.gov (United States)

    Vietti, Laura A.

    2016-09-01

    Bone surface texture is known to degrade in a predictable fashion due to subaerial exposure, and can thus act as a relative proxy for estimating temporal information from modern and ancient bone assemblages. To date, the majority of bone weathering data is collected on a categorical scale based on descriptive terms. While this qualitative classification of weathering data is well established, textural analyses of bone surfaces may provide means to quantify weathering stages but have yet to be tested. Here, I examined the suitability of textural analyses for bone weathering studies by first establishing bone surface regions most appropriate for weathering analyses. I then measured and compared the roughness texture of weathered bones at different stages. To establish regions of bone most suitable for textural analyses, Ra was measured from 3D scans of dorsal ribs of four adult ungulate taxa. Results indicate that the rib-shafts from unweathered ungulate skeletons were similar and are likely good candidates because differences in surface texture will not be due to differences in initial bone texture. To test if textural measurements could reliably characterize weathering stages, the average roughness values (Ra) were measured from weathered ungulate rib-shafts assigned to four descriptive weathering stages. Results from analyses indicate that the Ra was statistically distinct for each weathering stage and that roughness positively correlates with the degree of weathering. As such, results suggest that textural analyses may provide the means for quantifying bone-weathering stages. Using Ra and other quantifiable texture parameters may enable more reliable and comparative taphonomic analyses by reducing inter-observer variations and by providing numerical data more compatible for multivariate statistics.

  13. Efeito de diferentes formas de congelamento sobre raízes de mandioca

    Directory of Open Access Journals (Sweden)

    Maria Madalena Rinaldi

    2015-06-01

    Full Text Available ResumoAvaliaram-se as características físico-químicas, sensoriais e microbiológicas durante o armazenamento de raízes de mandioca submetidas a diferentes métodos de congelamento. As raízes foram caracterizadas fisicamente, processadas, acondicionadas em embalagem de polietileno de baixa densidade (PEBD de 100 µm de espessura e submetidas aos diferentes tratamentos: congelamento e armazenamento a –18 °C; congelamento e armazenamento a –80 °C; congelamento com nitrogênio líquido e armazenamento a –80 °C. O período de armazenamento foi de 31 dias. O produto submetido a todos os tratamentos apresentou níveis aceitáveis de pH, acidez titulável, sólidos solúveis, ratio, ácido ascórbico e tempo para a cocção, bem como quanto à contagem dos microrganismos avaliados. Nos tratamentos congelamento e armazenamento a –18 °C e congelamento com nitrogênio líquido e armazenamento a –80 °C as raízes de mandioca foram aceitas sensorialmente durante todo o armazenamento. Apesar dos bons resultados apresentados no armazenamento de raízes de mandioca submetidas ao congelamento com nitrogênio líquido e armazenamento a –80° C, sugerem-se estudos mais aprofundados quanto às exigências e custo para a utilização dessa tecnologia em nível de produtor. A temperatura de –18 °C é satisfatória para manter o produto com características adequadas por no mínimo 31 dias.

  14. PACKAGING WASTE MANAGEMENT ON EXAMPLE OF CITY ZIELONA GÓRA

    OpenAIRE

    Joanna ZARĘBSKA

    2012-01-01

    The article presents the legal requirements of the European Union's packaging waste, and their most recent transposition into Polish law. The author has attempted to describe selected achievements of the Department of Public Utilities and Housing (DPUaH) in Zielona Góra, which for many years on behalf of the city, in a systematic way it’s developing municipal waste management system (including packaging), consistent with EU policies and objectives of sustainable development. The deficiencies ...

  15. Integriteta podatkov skozi validacijo računalniško podprtega laboratorijskega sistema

    OpenAIRE

    Ramić, Jasmin

    2017-01-01

    Diplomska naloga obravnava zagotavljanje regulatorne skladnosti in validacijo računalniško podprtega laboratorijskega sistema v farmacevtski industriji. Opisuje delovanje in pomen regulatornih organov, pojasnjeni so standardi in primeri dobre prakse, ki se morajo upoštevati v procesu validacije. Z aktivnim uvajanjem zakona na področju elektronskih zapisov in elektronskih podpisov so agencije za prehrano in zdravila uspele postaviti jasne zahteve in smernice v farmacevtski industriji in tako p...

  16. Correlation of Demographic and Clinical Characteristics with Rheumatoid Factor Seropositivity in Rheumatoid Arthritis Patients.

    Science.gov (United States)

    Othman, Maizatul Akmal; Ghazali, Wan Syamimee Wan; Yahya, Nurul Khaiza; Wong, Kah Keng

    2016-11-01

    The rheumatoid factor (RF) blood test is the most commonly adopted test for the diagnosis of rheumatoid arthritis (RA). RA patients who are seropositive for RF might face a greater likelihood of developing more aggressive symptoms. Our goal was to study the demographic and clinical characteristics, as well as their correlation with RF seropositivity, among a series of 80 RA patients aged ≥ 18 years who attend Hospital Universiti Sains Malaysia (HUSM). Of the 80 RA patients included in this study, 66 (82.5%) were female and 14 (17.5%) were male. No significant associations between RF seropositivity and demographic and/or clinical characteristics or other laboratory investigations were observed, including gender, morning stiffness, individual joint involvement (from multiple sites of the body), and erythrocyte sedimentation rate (ESR) measurement. However, a significant association between RF seropositivity and patients aged ≥ 50 was found (P = 0.032). RF seropositivity was found to be more common in much older RA patients.

  17. [Automatization of colorimetric serum zinc determination using the Bayer RA 1000 autoanalyzer].

    Science.gov (United States)

    Shum-Cheong-Sing, J; Arnaud, J; Favier, A

    1994-01-01

    A colorimetric method for the determination of zinc in serum was adapted for use with the Bayer RA 1000 autoanalyzer. Zinc is dissociated from proteins by guanidinium hydrochloride and complexed with 2-(5-bromo-2-pyridylazo)-5-(N-propyl-N- sulfopropylamino-)phenol (5-Br-PAPS). Precision (within-run CVs from 1.4 to 4.2%; between-run CVs from 3.5 to 8.1%), accuracy (93 to 103%) and detection limit (1.15 mumol/l) were sufficient for routine determinations. Moreover, results obtained with the proposed Bayer RA 1000 method were in good agreement with those obtained by flame atomic absorption spectrometry (FAAS) which could be considered the reference method. For 119 sera, the correlation coefficient r was found to be 0.958 and the regression line was as follows: serum zinc (RA 1000) = 0.96 serum zinc (FAAS) + 0.8 mumol/l. Moreover, 98% of the differences between colorimetry and FAAS were within the range Md +/- 1.96 SDd, where Md is the mean of the differences and SDd is the standard deviation of the differences.

  18. Movimento negro e educação: ressignificando e politizando a raça

    Directory of Open Access Journals (Sweden)

    Nilma Lino Gomes

    2012-09-01

    Full Text Available Este artigo discute o papel do movimento negro brasileiro na ressignificação e politização da ideia de raça. A raça é aqui entendida como construção social que marca, de forma estrutural e estruturante, as sociedades latino-americanas, em especial, a brasileira. Ao refletir sobre a atuação do movimento negro, parte-se da premissa de que este movimento social, por meio de suas ações políticas, sobretudo em prol da educação, reeduca a si próprio, o Estado, a sociedade e o campo educacional sobre as relações étnico-raciais no Brasil, caminhando rumo à emancipação social. A ideia de raça analisada no presente artigo se assenta na reflexão realizada pelos estudos pós-coloniais, que discutem a sua centralidade nos países com passado colonial e a sua operacionalidade nas relações de poder, as quais têm sido mantidas e subsistem no pensamento moderno ocidental, inclusive, no educacional.

  19. Projekts: Piena produktu bērniem ražotnes izveide Rīgā

    OpenAIRE

    Šakina, Natālija

    2010-01-01

    Maģistra darba nosaukums ir „Projekts: Piena produktu bērniem ražotnes izveide Rīgā”. Maģistra darba mērķis-no 2010.gada 5.janvāra līdz 2010.gada 31.decembrim uzcelt uzņēmumu SIA „Mazulis” un sākot ar 2011.gada 2.janvāri uzsākt piena un skābpiena produktu bērniem ražošanu ar jaudu 10 tonnas produkcijas maiņā, nepārtērējot 2010.gadā projekta realizēšanai atvēlētos naudas līdzekļus 1250000 Ls apmērā, lai nodrošinātu Latvijas zīdaiņus un pirmskolas vecuma bērnus ar kvalitatīvu bērnu pār...

  20. Pharmacokinetics of C-1027 in mice as determined by TCA-RA method

    Institute of Scientific and Technical Information of China (English)

    You-Ping Liu; Quan-Sheng Li; Yu-Rong Huang; Mao-Jin Zhou; Chang-Xiao Liu

    2005-01-01

    AIM: To validate a radioactivity assay, the TCA-RA method,for the measurement of C-1027 in serum and to evaluate its application in determination of pharmacokinetics of C-1027 in mice.METHODS: 125I-C-1027 was prepared by the Iodogen method and separated by HPLC. The radioactivity assay was established and used to determine 125I-C-1027 in mice at doses of 10, 50 and 100 μg/kg after precipitation with20% trichloroacetic acid (TCA-RA method). Severalpharmacokinetic parameters were determined after intravenous injection of 125I-C-1027 to mice.RESULTS: After intravenous injection of 125I-C-1027 to mice,at doses of 10, 50 and 100 μg/kg; the apparent distribution volumes (Vd) were 0.26, 0.31 and 0.33 L/kg; the biological half-lives (T1/2) were 3.10, 3.40 and 3.90 h; the areas under curve (AUC) were 18.41, 103.69 and 202.74 ng/h/mL; the elimination rate constants (K) were 1.04, 1.26 and 0.58/h;and the total body clearance (Cl) were 0.54, 0.48 and0.49 L/kg/h, respectively.CONCLUSION: TCA-RA is a sensitive, reliable and suitable method for the determination of 125I-C-1027 in mouse serum.

  1. 18O and 226Ra in the Minjiang River estuary, China and their hydrological implications

    Science.gov (United States)

    Liu, Huatai; Guo, Zhanrong; Gao, Aiguo; Yuan, Xiaojie; Zhang, Bin

    2016-05-01

    In this work, the 2H, 18O and 226Ra values in groundwater and surface water in the Minjiang River estuary were investigated in the dry and wet seasons. The δ18O values in the dry season were always higher than those in the wet season in both groundwater and surface water because of the presence of evaporation in the water cycle process. During the dry season, the δ18O values in groundwater on the southern bank of the Minjiang River are much higher than those on the northern bank because evaporation is more intense in the farmland of the southern bank than in the urbanized northern bank. The δ18O values in the estuarine water exhibit a good positive correlation with salinity, with a coefficient of 0.96 (p = 0.05) in both seasons. The 226Ra activities in the estuarine water increase with increasing salinity because of desorption from riverine suspended particles. The 226Ra activity reaches a peak value at a salinity of 20.5. Based on a three-endmember model, the average proportions of the estuarine water are calculated to be 0.02 for groundwater, 0.39 for river water and 0.59 for seawater. From this mixing ratio, the groundwater discharge into the estuary is estimated to be 9.31 × 106 m3 d-1 in the wet season.

  2. Interseccionalidade gênero, raça e etnia e a lei Maria da Penha

    Directory of Open Access Journals (Sweden)

    Raquel da Silva Silveira

    2014-01-01

    Full Text Available A violência de gênero contra as mulheres é um fenômeno mundial abordado exaustivamente. Este artigo discute como a interseccionalidade gênero, raça e etnia emerge nos discursos jurídicos sobre as mulheres que acessam a justiça. O referencial teórico foi composto pela analítica do poder de Michel Foucault articulada aos conceitos de interseccionalidade, gênero, raça e etnia. A pesquisa de campo foi realizada no Poder Judiciário de Porto Alegre e de Sevilha entre agosto de 2010 e outubro de 2012. Foram construídas três amostras de conveniência: entrevistas com 290 mulheres, análise de 70 processos judiciais e de 55 boletins de ocorrência. Foram realizadas entrevistas com quatro juízes/as de Porto Alegre e dois juízes em Sevilha. Os resultados apontam uma sobrerrepresentação das mulheres negras nos boletins de ocorrência, nas entrevistas, mas não nos processos. Apesar disso, os/as juízes/as entrevistados/as compreendem que a interseccionalidade gênero-raça e etnia não interfere no acesso à justiça.

  3. ExoMars Lander Radioscience LaRa, a Space Geodesy Experiment to Mars.

    Science.gov (United States)

    Dehant, Veronique; Le Maistre, Sebastien; Yseboodt, Marie; Peters, Marie-Julie; Karatekin, Ozgur; Van Hove, Bart; Rivoldini, Attilio; Baland, Rose-Marie; Van Hoolst, Tim

    2017-04-01

    The LaRa (Lander Radioscience) experiment is designed to obtain coherent two-way Doppler measurements from the radio link between the ExoMars lander and Earth over at least one Martian year. The instrument life time is thus almost twice the one Earth year of nominal mission duration. The Doppler measurements will be used to observe the orientation and rotation of Mars in space (precession, nutations, and length-of-day variations), as well as polar motion. The ultimate objective is to obtain information / constraints on the Martian interior, and on the sublimation / condensation cycle of atmospheric CO2. Rotational variations will allow us to constrain the moment of inertia of the entire planet, including its mantle and core, the moment of inertia of the core, and seasonal mass transfer between the atmosphere and the ice caps. The LaRa experiment will be combined with other ExoMars experiments, in order to retrieve a maximum amount of information on the interior of Mars. Specifically, combining LaRa's Doppler measurements with similar data from the Viking landers, Mars Pathfinder, Mars Exploration Rovers landers, and the forthcoming InSight-RISE lander missions, will allow us to improve our knowledge on the interior of Mars with unprecedented accuracy, hereby providing crucial information on the formation and evolution of the red planet.

  4. [The life and work of Zaíra Cintra Vidal].

    Science.gov (United States)

    Lopes, G T; Caldas, N P; Lima, T C; Martingil, I C

    2001-01-01

    This is a social-historical study that aims at describing the trajectory of Zaíra Cintra Vidal, her participation in the Nursing School Rachel Haddock Lobo and in the Brazilian Association of Nursing (ABEn). The study is based on the concepts of symbolic power, habitus and symbolic struggle of Pierre Bourdieu. The primary sources are documents which were collected in the Documentation Center of Escola de Enfermagem Ana Neri (EEAN--Ana Neri School of Nursing) in the Federeal University of Rio de Janeiro (UFRJ) and at the Memory Center of the Faculty of Nursing (FENF) in the State University of Rio de Janeiro (UERJ). The data was collected between August 2000 and April 2001 by means of document analysis script. The outcomes showed that Zaíra Cintra Vidal was born on 5 May 1903; graduated from the Nursing School of the National Public Health Department in 1926; studied and post-graduated in the United States from 1927 until 1929 and returned to Brazil in 1943. Zaíra Cintra Vidal was the founder of the Nursing School Rachel Haddock Lobo and was its first director for nine years. She also and took part in ABEn's Direction Board and in the Revista Anais de Enfermagem (Nursing Magazine).

  5. Klebsiella phage vB_KleM-RaK2 - a giant singleton virus of the family Myoviridae.

    Directory of Open Access Journals (Sweden)

    Eugenijus Simoliūnas

    Full Text Available At 346 kbp in size, the genome of a jumbo bacteriophage vB_KleM-RaK2 (RaK2 is the largest Klebsiella infecting myovirus genome sequenced to date. In total, 272 out of 534 RaK2 ORFs lack detectable database homologues. Based on the similarity to biologically defined proteins and/or MS/MS analysis, 117 of RaK2 ORFs were given a functional annotation, including 28 RaK2 ORFs coding for structural proteins that have no reliable homologues to annotated structural proteins in other organisms. The electron micrographs revealed elaborate spike-like structures on the tail fibers of Rak2, suggesting that this phage is an atypical myovirus. While head and tail proteins of RaK2 are mostly myoviridae-related, the bioinformatics analysis indicate that tail fibers/spikes of this phage are formed from podovirus-like peptides predominantly. Overall, these results provide evidence that bacteriophage RaK2 differs profoundly from previously studied viruses of the Myoviridae family.

  6. The Clinical Application of Anti-CCP in Rheumatoid Arthritis and Other Rheumatic Diseases

    Directory of Open Access Journals (Sweden)

    CT Chou

    2007-01-01

    Full Text Available Rheumatoid arthritis (RA is a common rheumatic disease in Caucasians and in other ethnic groups. Diagnosis is mainly based on clinical features. Before 1998, the only serological laboratory test that could contribute to the diagnosis was that for rheumatoid factor (RF. The disease activity markers for the evaluation of clinical symptoms or treatment outcome were the erythrocyte sedimentation rate (ESR and C-reactive protein (CRP. As a matter of fact, the diagnosis of early RA is quite impossible, as the clinical criteria are insuffi cient at the beginning stage of the disease. In 1998, Schelleken reported that a high percentage of RA patients had a specifi c antibody that could interact with a synthetic peptide which contained the amino acid citrulline. The high specifi city (98% for RA of this new serological marker, anti-cyclic citrullinated antibody (anti-CCP antibody, can be detected early in RA, before the typical clinical features appear. The presence or absence of this antibody can easily distinguish other rheumatic diseases from RA. Additionally, the titer of anti-CCP can be used to predict the prognosis and treatment outcome after DMARDs or biological therapy. Therefore, with improvement of sensitivity, the anti-CCP antibody will be widely used as a routine laboratory test in the clinical practice for RA.

  7. Uptake of Ra during the recrystallization of barite: a microscopic and time of flight-secondary ion mass spectrometry study.

    Science.gov (United States)

    Klinkenberg, Martina; Brandt, Felix; Breuer, Uwe; Bosbach, Dirk

    2014-06-17

    A combined macroscopic and microanalytical approach was applied on two distinct barite samples from Ra uptake batch experiments using time of flight-secondary ion mass spectrometry (ToF-SIMS) and detailed scanning electron microscopy (SEM) investigations. The experiments were set up at near to equilibrium conditions to distinguish between two possible scenarios for the uptake of Ra by already existent barite: (1) formation of a Ba1-xRaxSO4 solid solution surface layer on the barite or (2) a complete recrystallization, leading to homogeneous Ba1-xRaxSO4 crystals. It could be clearly shown that Ra uptake in all barite particles analyzed within this study is not limited to the surface but extends to the entire solid. For most grains a homogeneous distribution of Ra could be determined, indicating a complete recrystallization of barite into a Ba1-xRaxSO4 solid solution. The maxima of the Ra/Ba intensity ratio distribution histograms calculated from ToF-SIMS are identical with the expected Ra/Ba ratios calculated from mass balance assuming a complete recrystallization. In addition, the role of Ra during the recrystallization of barite was examined via detailed SEM investigations. Depending on the type of barite used, an additional coarsening effect or a strong formation of oriented aggregates was observed compared to blank samples without Ra. In conclusion, the addition of Ra to a barite at close to equilibrium conditions has a major impact on the system leading to a fast re-equilibration of the solid to a Ba1-xRaxSO4 solid solution and visible effects on the particle size distribution, even at room temperature.

  8. Profile of circulating levels of IL-1Ra, CXCL10/IP-10, CCL4/MIP-1β and CCL2/MCP-1 in dengue fever and parvovirosis.

    Science.gov (United States)

    de-Oliveira-Pinto, Luzia Maria; Gandini, Mariana; Freitas, Laís Picinini; Siqueira, Marilda Mendonça; Marinho, Cíntia Ferreira; Setúbal, Sérgio; Kubelka, Claire Fernandes; Cruz, Oswaldo Gonçalves; Oliveira, Solange Artimos de

    2012-02-01

    Dengue virus (DENV) and parvovirus B19 (B19V) infections are acute exanthematic febrile illnesses that are not easily differentiated on clinical grounds and affect the paediatric population. Patients with these acute exanthematic diseases were studied. Fever was more frequent in DENV than in B19V-infected patients. Arthritis/arthralgias with DENV infection were shown to be significantly more frequent in adults than in children. The circulating levels of interleukin (IL)-1 receptor antagonist (Ra), CXCL10/inducible protein-10 (IP-10), CCL4/macrophage inflammatory protein-1 beta and CCL2/monocyte chemotactic protein-1 (MCP-1) were determined by multiplex immunoassay in serum samples obtained from B19V (37) and DENV-infected (36) patients and from healthy individuals (7). Forward stepwise logistic regression analysis revealed that circulating CXCL10/IP-10 tends to be associated with DENV infection and that IL-1Ra was significantly associated with DENV infection. Similar analysis showed that circulating CCL2/MCP-1 tends to be associated with B19V infection. In dengue fever, increased circulating IL-1Ra may exert antipyretic actions in an effort to counteract the already increased concentrations of IL-1β, while CXCL10/IP-10 was confirmed as a strong pro-inflammatory marker. Recruitment of monocytes/macrophages and upregulation of the humoral immune response by CCL2/MCP-1 by B19V may be involved in the persistence of the infection. Children with B19V or DENV infections had levels of these cytokines similar to those of adult patients.

  9. Profile of circulating levels of IL-1Ra, CXCL10/IP-10, CCL4/MIP-1β and CCL2/MCP-1 in dengue fever and parvovirosis

    Directory of Open Access Journals (Sweden)

    Luzia Maria de-Oliveira-Pinto

    2012-02-01

    Full Text Available Dengue virus (DENV and parvovirus B19 (B19V infections are acute exanthematic febrile illnesses that are not easily differentiated on clinical grounds and affect the paediatric population. Patients with these acute exanthematic diseases were studied. Fever was more frequent in DENV than in B19V-infected patients. Arthritis/arthralgias with DENV infection were shown to be significantly more frequent in adults than in children. The circulating levels of interleukin (IL-1 receptor antagonist (Ra, CXCL10/inducible protein-10 (IP-10, CCL4/macrophage inflammatory protein-1 beta and CCL2/monocyte chemotactic protein-1 (MCP-1 were determined by multiplex immunoassay in serum samples obtained from B19V (37 and DENV-infected (36 patients and from healthy individuals (7. Forward stepwise logistic regression analysis revealed that circulating CXCL10/IP-10 tends to be associated with DENV infection and that IL-1Ra was significantly associated with DENV infection. Similar analysis showed that circulating CCL2/MCP-1 tends to be associated with B19V infection. In dengue fever, increased circulating IL-1Ra may exert antipyretic actions in an effort to counteract the already increased concentrations of IL-1β, while CXCL10/IP-10 was confirmed as a strong pro-inflammatory marker. Recruitment of monocytes/macrophages and upregulation of the humoral immune response by CCL2/MCP-1 by B19V may be involved in the persistence of the infection. Children with B19V or DENV infections had levels of these cytokines similar to those of adult patients.

  10. Impact of a magnetic resonance imaging-guided treat-to-target strategy on disease activity and progression in patients with rheumatoid arthritis (the IMAGINE-RA trial)

    DEFF Research Database (Denmark)

    Møller-Bisgaard, Signe; Hørslev-Petersen, Kim; Ejbjerg, Bo Jannik

    2015-01-01

    . This demonstrates that additional methods for prognostication and monitoring of the disease activity are needed. Bone marrow edema (BME) detected by magnetic resonance imaging (MRI) has proved to be an independent predictor of subsequent radiographic progression. Guiding the treatment based on the presence....../absence of BME may therefore be clinically beneficial. We present the design of a randomized controlled trial (RCT) aiming to evaluate whether an MRI-guided treatment strategy compared to a conventional treatment strategy in anti-CCP-positive erosive RA is better to prevent progression of erosive joint damage...... swollen joints and treatment with synthetic disease-modifying antirheumatic drugs (DMARDs) will be included. Patients will be randomized to either a treatment strategy based on conventional laboratory and clinical examinations (control group) or a treatment strategy based on conventional laboratory...

  11. Temporal evolution of natural radionuclides distributions {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po in the Bransfield strait, Antarctica peninsula; Evolucao temporal das distribuicoes dos radionuclideos naturais {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po no estreito de Bransfiel, peninsula Antartica

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia Valverde

    2013-07-01

    Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. {sup 234}Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity {sup 238}U (t½ = 4.5 10{sup 9} years). Since {sup 234}Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium {sup 234}Th/{sup 238}U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO{sub 2} atmospheric concentrations. The radionuclides {sup 210}Pb (t½ = 22.3 years) and {sup 210}Po (t½ = 138 days) are also particle-reactive. The disequilibrium {sup 210}Po/{sup 210}Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, {sup 226}Ra (t½ = 1,600 years) and {sup 228}Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides {sup 238}U, {sup 234}Th, {sup 22}'6Ra, {sup 22}'8Ra, {sup 210}Pb and {sup 210}Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)

  12. Efecto del Hierro en el Desarrollo de las Raíces de las Plantas

    Directory of Open Access Journals (Sweden)

    Correa Velásquez Jairo

    1964-08-01

    Full Text Available Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. Las plantas fueron cultivadas en el invernadero en solución HoagIand N° 2 sin Fe y las raíces para cultivo se obtuvieron de semillas germinadas en el laboratorio. Se usaron plantas de cacao del clon uf 668 de 3 meses y de café (variedad caturra con la misma edad. El hierro radiactivo utilizado fue en forma de cloruro (Fe59 cl 3 y el agregado a la solución o al follaje, en forma de quelato (Fe E. D. T. A.. Las adiciones de este elemento se hicieron cuando las plantas mostraban síntomas característicos de su deficiencia. Hubo una recuperación casi total de la clorosis y tanto el volumen como la longitud radical aumentaron con las aplicaciones crecientes de hierro, aunque la longitud relativa de los tallos mostró una tendencia decreciente. En las hojas de cacao se presentó una acumulación del Fe y su movilización hacia los demás órganos de la planta fue lenta y en proporción reducida en relación con el total absorbido. Igual cosa sucedió con el Fe50 suministrado a las raíces. No se pudieron observar los efectos del Fe en el crecimiento de raíces aisladas de cacao, café y fríjol, pues el desarrollo fue muy reducido, debido a que la rápida oxidación de los tejidos (al separar aquéllas del resto de la planta redujo la viabilidad a unos pocos días.

  13. 225Ac and 223Ra production via 800 MeV proton irradiation of natural thorium targets.

    Science.gov (United States)

    Weidner, J W; Mashnik, S G; John, K D; Ballard, B; Birnbaum, E R; Bitteker, L J; Couture, A; Fassbender, M E; Goff, G S; Gritzo, R; Hemez, F M; Runde, W; Ullmann, J L; Wolfsberg, L E; Nortier, F M

    2012-11-01

    Cross sections for the formation of (225,227)Ac, (223,225)Ra, and (227)Th via the proton bombardment of natural thorium targets were measured at a nominal proton energy of 800 MeV. No earlier experimental cross section data for the production of (223,225)Ra, (227)Ac and (227)Th by this method were found in the literature. A comparison of theoretical predictions with the experimental data shows agreement within a factor of two. Results indicate that accelerator-based production of (225)Ac and (223)Ra is a viable production method.

  14. Potencial agronômico e teor de carotenoides em raízes de reserva de mandioca

    Directory of Open Access Journals (Sweden)

    Karina Nascimento da Silva

    2014-01-01

    Full Text Available Os programas de melhoramento genético de mandioca de mesa estão focados na seleção de variedades com a presença de carotenoides nas raízes de reserva. O trabalho foi realizado com o objetivo de avaliar o potencial agronômico e o teor de carotenoides em raízes de reserva de acessos de mandioca com coloração da polpa das raízes creme, amarela e rosada visando à utilização direta por produtores e/ou sua utilização como genitores em programas de melhoramento. Treze acessos de mandioca foram avaliados em experimento conduzido na Embrapa Cerrados por duas safras, quanto aos caracteres altura da primeira ramificação, altura da planta, massa da parte aérea, produtividade de raízes, porcentagem de amido nas raízes, severidade de bacteriose, teor de carotenoides nas raízes, tempo para a cocção em minutos e teor de ácido cianídrico nas raízes. Os resultados evidenciaram a existência de diferenças significativas entre os acessos para os caracteres altura da primeira ramificação, altura da planta, massa da parte aérea, produtividade de raízes, porcentagem de amido nas raízes, severidade de bacteriose e teor de carotenoides nas raízes. Também foram detectadas variações significativas entre as safras e interação significativa entre as safras e acessos para todos os caracteres, com exceção da severidade da bacteriose e do teor de carotenoides nas raízes. Nenhum acesso apresentou desempenho agronômico que justifique o cultivo de forma comercial na região do Cerrado do Brasil Central. Foram detectados acessos com potencial para utilização no melhoramento, visando ao incremento de β-caroteno BGMC 1221, BGMC BGMC 1223 e BGMC 1224 e de licopeno BGMC 1222 e BGMC 1229 em raízes de reserva.

  15. Complement and membrane-bound complement regulatory proteins as biomarkers and therapeutic targets for autoimmune inflammatory disorders, RA and SLE.

    Science.gov (United States)

    Das, Nibhriti

    2015-11-01

    Complement system is a major effecter system of the innate immunity that bridges with adaptive immunity. The system consists of about 40 humoral and cell surface proteins that include zymogens, receptors and regulators. The zymogens get activated in a cascade fashion by antigen-antibody complex, antigen alone or by polymannans, respectively, by the classical, alternative and mannose binding lectin (MBL) pathways. The ongoing research on complement regulators and complement receptors suggest key role of these proteins in the initiation, regulation and effecter mechanisms of the innate and adaptive immunity. Although, the complement system provides the first line of defence against the invading pathogens, its aberrant uncontrolled activation causes extensive self tissue injury. A large number of humoral and cell surface complement regulatory protein keep the system well-regulated in healthy individuals. Complement profiling had brought important information on the pathophysiology of several infectious and chronic inflammatory disorders. In view of the diversity of the clinical disorders involving abnormal complement activity or regulation, which include both acute and chronic diseases that affect a wide range of organs, diverse yet specifically tailored therapeutic approaches may be needed to shift complement back into balance. This brief review discusses on the complement system, its functions and its importance as biomarkers and therapeutic targets for autoimmune diseases with focus on SLE and RA.

  16. Pharmacokinetic-pharmacodynamic modeling of fostamatinib efficacy on ACR20 to support dose selection in patients with rheumatoid arthritis (RA).

    Science.gov (United States)

    Maringwa, John; Kågedal, Matts; Hamrén, Ulrika Wählby; Martin, Paul; Cox, Eugène; Hamrén, Bengt

    2015-03-01

    R788 (fostamatinib) is an oral prodrug that is rapidly converted into a relatively selective spleen tyrosine kinase (SYK) inhibitor R406, evaluated for the treatment of rheumatoid arthritis (RA). This analysis aimed at developing a pharmacodynamic model for efficacy using pooled ACR20 data from two phase II studies in patients with rheumatoid arthritis (TASKi1 and TASKi2), describing the effect of fostamatinib as a function of fostamatinib exposure (dose, R406 plasma concentration) and other explanatory variables. The exposure-response relationship of fostamatinib was implemented into a continuous time Markov model describing the time course of transition probabilities between the three possible states of ACR20 non-responder, responder, and dropout at each visit. The probability of transition to the ACR20 response state was linearly (at the rate constant level) related to average R406 plasma concentrations and the onset of this drug effect was fast. Further, increases of fostamatinib dose resulted in increased dropout and subsequent loss of efficacy. This analysis provided an increased understanding of the exposure-response relationship, and provided support for fostamatinib 100 mg BID an appropriate dose regimen for further clinical evaluation.

  17. Comparison of four clinical scores for the predicting lower limb deep venous thrombosis in Chinese patients

    Institute of Scientific and Technical Information of China (English)

    Li Zhua; Min Liu; Xiaojuan Guo; Jianguo Wang; Youmin Guo; Chen Wang; Hongxia Ma; Yulin Guo

    2008-01-01

    To evaluate Wells, Kahn, St.Andr é and Constans scores for the prediction of deep venous thrombosis in Chinese patients.Methods:One hundred and seventy-two patients, prospectively, blinded referred for evaluation with four clinical-score systems for suspected deep venous thrombosis, were examined by ultrasonography.Sensitivity, specificity, positive predictive value, nega- tive predictive value and receiver operation curves were calculated for four clinical scores.The difference between areas of the ROC curve for each of the scores was compared with others and reference line.Results:Forty-six of 172 patients had deep venous throm- bosis proven by sonography.The sensitivity, specificity, positive predictive value and negative predictive value for Wells score was 91.3%, 27.4% and 74.2% respectively, for Constans score; 95.7%, 34.9%, 34.9% and 95.7% respectively.Area under ROV curve of Constans with the reference line.Conclusion:Based on the results of our study, the sensitivity, negative prediction value and area under ROC Considering the aim of the clinical assessment, Constans score and Wells score are more efficient for Chinese hospitalized patients.

  18. 挤光工艺在深长孔粗糙度Ra0.2加工中的应用%Application of Burnishing Technology in Machining of Deep Long Holes with Roughness Ra0.2

    Institute of Scientific and Technical Information of China (English)

    崔立平

    2010-01-01

    挤光加工是利用滚针对零件深长孔表面产生塑性变形,以达到修正表面微观几何形状、降低表面粗糙度的效果.表面粗糙度可从Ra3.2~Ra1.6降低到Ra0.8~Ra0.2.同时,滚压过程的本身导致了金属表面层金相组织的改变,形成了有利的残余应力,提高了零件的机械性能.

  19. Ordination of environmental data using principal component analysis: the case of the radium isotopes (Ra-226 and Ra-28) in surface waters in an area associated with NORM/TENORM mining

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Wagner de S.; Py Junior, Delcy de A.; Antunes, Marcos M., E-mail: wspereira@inb.gov.b, E-mail: delcy@inb.gov.b, E-mail: antunes@inb.gov.b [Industrias Nucleares do Brasil SA, Pocos de Caldas, MG (Brazil). Unidade de Tratamento de Minerios. Coordenacao de Protecao Radiologica; Kelecom, Alphonse, E-mail: kelecom@uol.com.b [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Inst. de Biologia. Curso de Pos-Graduacao em Biologia Marinha; Carmo, Roberto F., E-mail: rfcarmo@inb.gov.b [Industrias Nucleares do Brasil SA, Caetite, BA (Brazil). Unidade de Concentracao de Uranio. Coordenacao de Protecao Radiologica; Oliveira, Gabriela T. de [Centro Universitario de Sao Joao da Boa Vista (UNIFAE), SP (Brazil). Curso de Engenharia Quimica

    2009-07-01

    The radium isotopes Ra-226 and Ra-228 were analyzed in surface water at six points, during eighteen months, from June 2006 to December 2007, in the neighborhood of a mine of phosphate associated with uranium in the region of Santa Quiteria, state of Ceara, Brazil. The soluble fraction (which passes through filter of 0.45 micron) and the particulate fraction (which is retained on the 0.45 micron filter) were analyzed using the Principal Component Analysis, PCA, a method for ranking environmental data, and were analyzed also by F test for testing the difference between radionuclides and the difference between the two analyzed fractions. The PCA has identified four groups of samples. Results of Ra-226 in soluble fraction are grouped in the negative part of axis 1 (Factor 1) and axis 2 (Factor 2). Results of Ra-228 in particulate fraction are grouped in the positive part of axis 1 (Factor 1) and in the negative part of axis 2. Results of Ra-226 in soluble fraction are grouped along the positive part of axis 1 (Factor 1). Finally, results of Ra-228 in the particulate fraction are grouped in the positive part of axis 1 (Factor 1) and axis 2 (Factor 2). This last group has two discrepant points (01 and 06). There is no statistical difference between the two analyzed fractions but there are statistical differences between analyzed radionuclides. Therefore, three conclusions can be identified: The use of PCA with radionuclides and analyzed fractions as parameters permits the grouping of collecting data by their environmental similarities; the mean concentration of Ra-226 was statistically higher than that of Ra-228; and there is no statistical difference between soluble and particulate fractions. (author)

  20. Refractory anemia with severe dysplasia: clinical significance of morphological features in refractory anemia.

    Science.gov (United States)

    Matsuda, A; Jinnai, I; Yagasaki, F; Kusumoto, S; Minamihisamatsu, M; Honda, S; Murohashi, I; Bessho, M; Hirashima, K

    1998-04-01

    Refractory anemia (RA) in myelodysplastic syndromes (MDS) are very heterogeneous diseases regarding their morphology, clinical features and survival. We proposed the new designations 'RA with severe dysplasia (RASD)' and 'RA with minimal dysplasia (RAminiD)'. In our criteria, RASD is considered present if a bone marrow (BM) examination shows Pseudo-Pelger-Huet anomalies of mature neutrophils > or =3% and/or micromegakaryocytes (mMgk) of megakaryocytes > or =10% in RA patients. RAminiD is defined as RA cases other than RASD. After the reclassification of 58 primary RA patients, the group was composed of 45 RAminiD and 13 RASD patients. The blast percentage in the BM and the frequency of cytogenetic abnormalities observed in the RASD patients were intermediate between those in the RAminiD and RAEB patients. The analysis of survival curves revealed differences among the three groups; the RASD patients had lower survival probabilities than those of the RAminiD group, and significantly higher probabilities than those of the RAEB group. (RAminiD vs RASD, P=0.06; RASD vs RAEB, P=0.004.) Our data indicate that in RA patients, RASD is a distinct subset of RA with an unfavorable clinical outcome.

  1. Intake of {sup 226} Ra in osteoporosis prevention and therapy with gran-white dolomite as calcium supplement

    Energy Technology Data Exchange (ETDEWEB)

    Pecequilo, B.R.S.; Campos, M.P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mails: brigitte@net.ipen.br; mpcampos@net.ipen.br

    2002-04-01

    A {sup 226} Ra average specific activity of 4.3 Bq.kg{sup -1} was determined by passive high resolution gamma-ray spectrometry in six samples of 'Gran White' dolomite. The committed effective dose and committed equivalent dose at bone surface were calculated through the Ana Comp code, using {sup 226} Ra intake and radium metabolic model from ICRP 67. The doses were calculated for patients submitted to osteoporosis prevention and osteoporosis therapy. (author)

  2. IL-13Ra2- and glioma stem cell-pulsed dendritic cells induce glioma cell death in vitro

    Institute of Scientific and Technical Information of China (English)

    Ying Wang; Ruifan Xie; Hongquan Niu; Ting Lei

    2016-01-01

    Objective Gliomas are the most common malignant tumors in the central nervous system. Despite mul-tiple therapies including surgery, chemotherapy, and radiotherapy, the prognosis of patients remains poor. Immunotherapy is an alternative method of treating glioma, and the use of dendritic cel vaccines is one of the promising treatment options. However, there is no specific tumor cel antigen that can trigger dendritic cel s (DCs). IL-13Ra2 is a specific antigen expressed in glioma cel s; in the current study, we have at-tempted to explore whether IL-13Ra2 could be the antigen that triggers DCs and to envisage its application as potential therapy for glioma. Methods The expression of IL-13Ra2 was detected in U251 glioma cel lines and primary glioma tissues using dif erent methods. DCs from human blood were isolated and pulsed with recombinant IL-13Ra2, fol-lowing which the cytotoxicity of these DCs on glioma cel s was detected and analyzed. Results About 55.9% human glioma tissue cel s expressed IL-13Ra2, while normal brain tissue cel s did not show any expression. DC vaccines loaded with IL-13Ra2, glioma cel antigen, and brain tumor stem cel (BTSC) antigen could significantly stimulate the proliferation of T lymphocytes and induce cel death in the glioma tissue. Compared to other groups, DC vaccines loaded with BTSC antigen showed the strongest ability to activate cytotoxic T lymphocytes (CTLs), while the glioma cel antigen group showed no significant dif erence. Conclusion IL-13Ra2, which is expressed in gliomas and by glioma stem cel s, as wel as IL-13Ra2 could prove to be potential antigens for DC vaccine-based immunotherapy.

  3. 232Th-228Ra-228Th Recording of Estuarine and Coastal Sedimentological Events

    Science.gov (United States)

    Hillaire-Marcel, C.; Ghaleb, B.; Ruiz-Fernandez, A.

    2011-12-01

    Climatic events (e.g., storminess, floods) and river/coastal management activities (e.g., dredging) may result in the removal and re-suspension of contaminated sediments in shallow coastal areas and estuaries, thus leading to long-term contamination of such environments. Short-lived daughter isotopes of 232Th (228Ra-228Th) in sediments may then provide some quantitative assessment of the amount of material removed/re-deposited as well as some indications on the chronology of causal events. Examples from the Gulf of St. Lawrence (GSL) and the Pacific coastal rea of Mexico (PcM) are used to illustrate such isotopic responses to natural or anthropogenic disturbances. In the GSL relatively steady accumulation processes are usually observed, although sedimentary sequences show variable benthic mixing patterns over a large array of sedimentation rates (from mm/a to cm/a). In undisturbed sequences, 232Th-daughter isotopes in particulate matter show strong disequilibria due i) to 228Ra-diffusion/228Th adsorption in source-soils and during particulate transport, ii) 228Ra-behavior at the water column/sea-floor interface. Core-top sediments thus depict a strong excess in 228Th vs. 232Th. Below, a fast return (within ~ 10 a) of 228Th to equilibrium with its parent 228Ra leads to a 228Th deficit vs 232Th, in response to 228Ra-losses and diffusion towards the water column. Deeper, a return to full equilibrium conditions is observed (~ 30 a), but for "non-local mixing" events. Few disturbances are observed in the area. They include nearly cyclic pulses in 210Pb at the head of the Laurentian Trough, which we attribute to dredging operations of the St. Lawrence Sea-Way, and in the sealing of Hg-contaminated sediments in the Saguenay Fjord, by flood layers. Comparatively most sequences cored in estuarine settings of the PcM illustrate more critical situations with respect to the re-suspension of sediments, which are often contaminated due to land management and industrial practices

  4. IL-1 receptor-antagonist (IL-1Ra) knockout mice show anxiety-like behavior by aging.

    Science.gov (United States)

    Wakabayashi, Chisato; Numakawa, Tadahiro; Odaka, Haruki; Ooshima, Yoshiko; Kiyama, Yuji; Manabe, Toshiya; Kunugi, Hiroshi; Iwakura, Yoichiro

    2015-07-10

    Interleukin 1 (IL-1) plays a critical role in stress responses, and its mRNA is induced in the brain by restraint stress. Previously, we reported that IL-1 receptor antagonist (IL-1Ra) knockout (KO) mice, which lacked IL-1Ra molecules that antagonize the IL-1 receptor, showed anti-depression-like behavior via adrenergic modulation at the age of 8 weeks. Here, we report that IL-1Ra KO mice display an anxiety-like phenotype that is induced spontaneously by aging in the elevated plus-maze (EPM) test. This anxiety-like phenotype was improved by the administration of diazepam. The expression of the anxiety-related molecule glucocorticoid receptor (GR) was significantly reduced in 20-week-old but not in 11-week-old IL-1Ra KO mice compared to wild-type (WT) littermates. The expression of the mineralocorticoid receptor (MR) was not altered between IL-1Ra KO mice and WT littermates at either 11 or 20 weeks old. Analysis of monoamine concentration in the hippocampus revealed that tryptophan, the serotonin metabolite 5-hydroxyindole acetic acid (5-HIAA), and the dopamine metabolite homovanillic acid (HVA) were significantly increased in 20-week-old IL-1Ra KO mice compared to littermate WT mice. These findings strongly suggest that the anxiety-like behavior observed in older mice was caused by the complicated alteration of monoamine metabolism and/or GR expression in the hippocampus.

  5. Evaluation of IL-1β, IL-1ra, and IL-10 levels and outcome of periodontal therapy in chronic periodontitis with familial Mediterranean fever.

    Science.gov (United States)

    Bostanci, Vildan; Toker, Hulya; Senel, Soner; Poyraz, Omer; Akpinar, Aysun; Görgün, Emine Pirim; Bakar, Olcay

    2017-01-01

    This study aimed to examine the IL-1β, IL-1ra, and IL-10 cytokine levels in gingival crevicular fluid (GCF) and serum of familial Mediterranean fever (FMF) and chronic periodontitis (CP) patients, and their response to nonsurgical periodontal therapy. A total of 50 patients, 15 FMF patients with generalized chronic periodontitis (FMF-CP), 15 systemically healthy patients with generalized chronic periodontitis (CP), ten systemically and periodontal healthy controls (HC), and ten periodontally healthy FMF patients (FMF-HC) were enrolled in the study. The cytokine levels in GCF and serum were determined by ELISA. Probing depth, clinical attachment level, and gingival and plaque indices in each participant were also measured. The GCF and clinical parameters at baseline and 6 weeks were recorded. The study indicated statistically significant healing of the clinical parameters in both FMF-CP and CP groups after periodontal treatment. GCF IL-1β levels at 6 weeks in FMF-CP group were significantly lower than the CP group (p  0.05). The results of our study suggested that there was a positive correlation between gingival inflammation and serum cytokine levels in FMF patients and also colchicine treatment showed protective effects on GCF cytokine levels in FMF-CP group. Following treatment, GCF IL-1β and GCF IL-1ra levels were decreased in FMF-CP group. GCF IL-10 levels were increased in FMF-CP group compared to other groups. Also, the serum cytokine levels associated with periodontal inflammation in FMF patients.

  6. Effects of aerobic exercise on hematologic indices of women with rheumatoid arthritis: A randomized clinical trial

    OpenAIRE

    2016-01-01

    Background: To investigate the effects of moderate aerobic exercise on the hemoglobin, hematocrit, and red blood cell (RBC) mass of women with rheumatoid arthritis (RA). Materials and Methods: This randomized clinical trial was conducted at the Specialized Clinic of Physical Medicine and Rehabilitation, Al-Zahra Hospital of Isfahan, during a 4-month period in 2014. We included patients with RA who did not have any malignancy and hematologic disorder. Two groups — one group receiving aerobic t...

  7. Efficacy of abatacept and tocilizumab in patients with rheumatoid arthritis treated in clinical practice

    DEFF Research Database (Denmark)

    Leffers, Henrik Christian; Ostergaard, Mikkel; Glintborg, Bente;

    2011-01-01

    To describe drug survival, disease activity and clinical response in patients with rheumatoid arthritis (RA) treated with abatacept or tocilizumab in routine care, based on prospectively registered observational data from the nationwide Danish DANBIO registry.......To describe drug survival, disease activity and clinical response in patients with rheumatoid arthritis (RA) treated with abatacept or tocilizumab in routine care, based on prospectively registered observational data from the nationwide Danish DANBIO registry....

  8. Investigation of the effect of Interleukin-1 receptor antagonist (IL-1ra on markers of inflammation in non-ST elevation acute coronary syndromes (The MRC-ILA-HEART Study

    Directory of Open Access Journals (Sweden)

    Flather Marcus D

    2008-02-01

    Full Text Available Abstract Background Acute Coronary Syndromes account for 15% of deaths in the UK, and patients remain at significant risk of re-admission for future complications and death. Pathologically the underlying process of atherosclerosis is driven by inflammatory mechanisms, which are activated in ACS patients. Previous studies have investigated the role of inflammatory markers in this process, including interleukin 1 (IL-1 and C Reactive Protein (CRP. Pre-clinical studies indicate that IL-1 may be a primary driver of ACS and that the naturally occurring interleukin-1 receptor antagonist (IL-1ra may inhibit the atherosclerotic process. This study will investigate the effects of IL-1ra on inflammatory markers in man. Methods/design Three centres in the UK are planning to recruit 186 Non-ST elevation myocardial infarction patients to receive either interleukin-1 receptor antagonist (Anakinra or matching placebo. Patients will receive a daily subcutaneous injection of either study drug or placebo over a 14 day period. The primary outcome is area under the curve of high sensitivity C-Reactive Protein (CRP over the first 7 days. Discussion The MRC-ILA-HEART Study is a proof of concept clinical trial investigating the effects of IL-1ra upon markers of inflammation in patients with Non-ST elevation myocardial infarction. It is hoped this will provide new and exciting information in relation to an "anti-inflammatory" strategy for patients with acute coronary syndrome. Trial registration ISRCTN89369318

  9. CuRa: Cooperation on non-polluting resource exchange for cost reduction. Final report; CuRa: Cooperation fuer umweltschonenden Ressourcenaustausch zur Nutzung von Kostenreduktionspotenzialen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Schoen, M.; Delahaye, F.; Hiessl, H.; Kotz, C.; Kuntze, U.; Matuschweski, A.; Schuenke, P.; Zoche, P.; Hafkesbrink, J.; Rebhan, A.; Schroll, M.

    2003-02-01

    The project CuRa: (German acronym for Cooperation for Environmentally Friendly Exchange of Resources) aimed to design elements to put into practice the model of sustainable development. The focus was on the participation of industry and business on a regional level and two model regions were chosen for the analysis of case studies. It was intended to give impulses for regional material flow networks between companies, for example by bundling similar material flows to achieve a better profitability and by one-to-one cooperation between companies, one of them using the waste of the partner as raw material. In addition, the potential for reducing material throughput using modern information technology was investigated in a case study. A set of theses derived from institutional theory was verified on the basis of the empirical results. Useful for the development and the stabilization of networks are, among others, expected economic benefits for the partners, common socio-cultural values and traditions, and using existing institutional arrangements as a basis. Different forms of market and policy failures were identified as obstacles, e.g. the established system of waste disposal services, the focus among the responsible actors on compliance with existing rules, and different regulatory obstacles. Nevertheless, in spite of the insufficient number of successful examples and demonstration projects, a shift in orientation from focusing on mere waste disposal towards a closed loop recycling economy and even towards sustainable development was identified within the commercial sector. (orig.) [German] Im Projekt CuRa: (Cooperation fuer umweltschonenden Ressourcenaustausch) sollten in zwei Modellregionen Bausteine fuer die operative Umsetzung des Leitbildes nachhaltiger Entwicklung durch regionale Akteure aus Industrie und Gewerbe entwickelt werden. Es sollte ein Anstoss zu zwischen- und ueberbetrieblicher Vernetzung von Materialfluessen sowie zu einer Umgestaltung der

  10. Pitfalls in the assessment of smoking status detected in a cohort of South African RA patients.

    Science.gov (United States)

    Govind, Nimmisha; Ally, Mahmood M T M; Tikly, Mohammed; Anderson, Ronald; Hodkinson, Bridget; Meyer, Pieter W A

    2016-10-01

    This study was conceived in an attempt to explain the unexpectedly high frequency of elevated levels of serum cotinine measured retrospectively in a cohort of predominantly black South African females with rheumatoid arthritis (RA), findings that were inconsistent with the smoking histories derived from health questionnaires. The discrepant findings suggested either a greater tendency towards underreporting of smoking status in the study cohort, or possible confounding effects of the use of smokeless tobacco products. In addition to the cohort of RA patients (n = 138, of whom 115 (83 %) were female), blood samples were also taken from a second cohort consisting of 29 declared smokers, 18 (62 %) of whom where females, 29 smokeless tobacco (SLT) users (all female), and 22 non-users of any tobacco products, 18 (82 %) of whom were females. Serum cotinine levels were determined using an ELISA procedure. Cotinine levels of >10.0 ng/ml were detected in serum specimens from 43 (31 %), RA patients of whom 35 (81 %) were female, with a median value of 50.1 ng/ml and interquartile range (iqr) of 68.6. Only 18 of the 35 females indicated that they smoked. The groups of declared smokers and SLT users had equivalent median serum cotinine levels of 88.0 ng/ml (iqr = 10.8 ng/ml) and 87.0 ng/ml (iqr = 15.6 ng/ml), respectively, while cotinine was undetectable in specimens from non-tobacco product users (<0.2 ng/ml). Users of SLT products in South Africa are predominantly female and have serum cotinine levels which are comparable with those of current smokers, raising concerns about the validity of measurement of cotinine as the sole objective marker of smoking status in populations with high usage of SLTs. This situation can be rectified by ensuring that usage of SLT products is accurately recorded in health questionnaires, while inclusion of measurement of one or more additional, objective biomarkers of smoking in combination with cotinine may enable reliable

  11. Poredbena raščlamba dimenzija međučlanova lateralnih mostova

    OpenAIRE

    Mehulić, Ketij; Baučić, Ivo; Ćatović, Adnan; Živko-Babić, Jasenka; Stipetić, Jasmina

    1998-01-01

    Svrha istraživanja: Raščlamba topografskoanatomskih oblika međučlanova mostova premolarno-molarnoga segmenta u odnosu prema sljedećim varijablama: zastupljenost po pojedinom zubu u jednoj čeljusti te u objema čeljustima, čestoća nadomještanja određenih zuba po spolu, meziodistalni i okluzogingivni promjer, te visina međučlanova i vrijednosti higijenskoga kuta. Materijal i metoda: Istraživanje je provedeno na 973 člana lateralnih mostova u gornjoj i donjoj čeljusti na 251 pacijentu dobi od 18 ...

  12. Zasnova in izvedba računskega jedra OpenCL z vezjem FPGA

    OpenAIRE

    MARAŽ, DOMEN

    2016-01-01

    V diplomskem delu smo predstavili zasnovo in izvedbo računskega jedra OpenCL z vezjem FPGA. Uvodoma smo podali problematiko in ključne rešitve za povečevanje zmogljivosti in učinkovitosti procesnih sistemov. Predstavili smo heterogene sisteme, navedli njihov razvoj in izvedbe strojne opreme. Načrtovanje programske opreme za tovrstne sisteme je izredno kompleksno. Rešitev je v ogrodju OpenCL, ki ga je zasnovalo podjetje Apple Inc. in ga prepustilo krovni organizaciji Khronos Group. V delu je ...

  13. Raúl Serrano: dialéctica y creación teatral

    OpenAIRE

    Ana Cecilia Prenz

    1994-01-01

    Raúl Serrano estudioso de teatro, tiene una formación completamente diferente con respecto a la de los hombres de teatro argentino; es, con toda seguridad, la persona que más profunda y científicamente se ha dedicado al estudio de K. Stanislavskij en el ámbito del teatro de este país. La experiencia teatral adquirida en Europa influenciará profundamente sobre este autor en sus investigaciones, de tal modo que al regresar a su país de origen será profundamente crítico con respecto a la realida...

  14. Herencia del contenido de carotenos en raíces de yuca Manihot esculenta Crantz

    OpenAIRE

    Morillo Coronado, Yacenia

    2009-01-01

    Cinco familias de hermanos completos (CM 9816, GM 705, GM 708, GM 734 y GM 893) de un total de 32 familias de yuca fueron seleccionadas para el estudio de herencia del contenido de carotenos en raíces, ya que presentaron altos contenidos de carotenos totales y un gran contraste entre sus progenies (gran desviación estándar y un amplio rango de variación). Los individuos pertenecientes a las cinco familias fueron autopolinizados para generar a las familias S1. De las familias CM 9816, GM 708 y...

  15. La cultura de vocación intercultural en Raúl Fornet-Betancourt

    Directory of Open Access Journals (Sweden)

    Alexander Cer n Samboni

    2013-01-01

    Full Text Available En este artículo se sostienen algunas tesis provisionales sobre la concepción de cultura en la perspectiva del filósofo cubano Raúl Fornet-Betancourt y de otros representantes de la filosofía intercultural latinoamericana. Para ello, la tesis central afirma que se puede entender por cultura en Fornet- Betancourt el contexto histórico que sirve de identidad a una cultura así también la crítica que hace posible una radical desantropologización de la cultura, vista desde el paradigma latinoamericano de la liberación.

  16. Jenseits von Christa Wolf – marginalisierte Schriftstellerinnen in der Honecker-Ära

    Directory of Open Access Journals (Sweden)

    Beate Ihme-Tuchel

    2001-11-01

    Full Text Available Anne Lequy geht es in ihrer aus feministischer Sicht geschriebenen literaturwissenschaftlichen Studie um den „Ort“, um also um das „Zuhause“, um „Desorientierungen“ und um den „Schwerpunktverlust“ in den Arbeiten von weniger bekannten Schriftstellerinnen der Honecker-Ära. Sie untersucht, wie das „DDR-Milieu“ deren Schaffen beeinflusst hat, ob sie sich der Doppelmoral hinsichtlich der angeblich erreichten Gleichstellung von Mann und Frau bewusst waren und wie sie „auf diesen Betrug“ reagierten.

  17. Raíces metafísicas de la Lógica de Hegel

    Directory of Open Access Journals (Sweden)

    Miguel Giusti

    1994-06-01

    Full Text Available El artículo ofrece una reflexión hermenéutica sobre el sentido aparentementeparadójico de la combinación de los términos "ciencia" y "lógica" en laCiencia de la lógica de Hegel. Se muestran las raíces metafísicas de estaempresa, presentes en la transformación kantiana de la secular concepciónaristotélica, con la finalidad de hacer más comprensible la transformaciónhegeliana de la metafísica en lógica.

  18. Análise da estrutura genética da raça caracu

    OpenAIRE

    Dias, Amábily Cardoso

    2012-01-01

    O objetivo do trabalho foi determinar a estrutura genética dos bovinos da raça Caracu. Foi utilizado um arquivo de pedigree de 130.165 animais que foi obtido da Associação Brasileira de Criadores de Caracu. O banco de dados foi dividido em seis períodos: 1979-1983, 1984-1988, 1989-1993, 1994-1998, 1999-2003 e 2004-2008. Foram estimados o coeficiente de endogamia, o tamanho efetivo populacional e o número efetivo de fundadores e ancestrais. O coeficiente médio de endogamia entre os animais c...

  19. Tulumaksumäära langetamine on kõigi huvides / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Valgamaalane, 10. nov. 2001, lk. 2; Severnoje Poberezhje, 13. nov. 2001, lk. 2; Koit, 13. nov. 2001, lk. 6; Võrumaa Teataja, 13. nov. 2001, lk. 2; Põhjarannik, 15. nov. 2001, lk. 2; Vooremaa, 15. nov. 2001, lk. 2; Pärnu Postimees, 17. nov. 2001, lk. 2; Hiiu Leht, 20. nov. 2001, lk. 2; Lääne Elu, 20. nov. 2001, lk. 4; Sakala, 21. nov. 2001, lk. 2; Nädaline, 24. nov. 2001, lk. 4. Tulumaksumäära langetamine on majanduskliima säilitamiseks hädavajalik. Autor: Reformierakond. Parlamendisaadik

  20. Traços laringais em Latundê (Nambikwára do Norte

    Directory of Open Access Journals (Sweden)

    Stella Telles

    Full Text Available Este trabalho reflete o status dos traços laringais na língua Latundê, pertencente ao subgrupo Nambikwára do Norte, da família Nambikwára. Os dados foram coletados in loco pela autora entre os anos 1997-2001. Para a análise, considerou-se também a literatura disponível sobre outras línguas da família. O presente artigo está organizado em cinco seções: na primeira, são fornecidas informações sobre a família Nambikwára e os inventários segmentais de três línguas da família; na segunda, são apresentados os quadros fonológicos (consonantal e vocálico do Latundê; na terceira, encontram-se dados que evidenciam a realização dos traços laringais existentes em consoantes Latundê (glotalização e aspiração e o contraste do traço creaky voice, nas vogais; na quarta, são feitas considerações sobre a variação laringal no Latundê; finalmente, na quinta seção, são apresentadas reflexões sobre a correspondência entre segmentos com traço laringal do Latundê e do Mamaindê, outra língua Nambikwára do Norte. Os resultados do estudo evidenciaram que no Latundê as consoantes neutralizaram os traços laringais, enquanto que as vogais os mantêm contrastivamente. No interior do ramo do Norte, a correspondência entre consoantes Latundê e Mamaindê parece indicar que a primeira língua é mais inovadora no processo de mudança histórica.

  1. Tulumaksumäära langetamine on kõigi huvides / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Valgamaalane, 10. nov. 2001, lk. 2; Severnoje Poberezhje, 13. nov. 2001, lk. 2; Koit, 13. nov. 2001, lk. 6; Võrumaa Teataja, 13. nov. 2001, lk. 2; Põhjarannik, 15. nov. 2001, lk. 2; Vooremaa, 15. nov. 2001, lk. 2; Pärnu Postimees, 17. nov. 2001, lk. 2; Hiiu Leht, 20. nov. 2001, lk. 2; Lääne Elu, 20. nov. 2001, lk. 4; Sakala, 21. nov. 2001, lk. 2; Nädaline, 24. nov. 2001, lk. 4. Tulumaksumäära langetamine on majanduskliima säilitamiseks hädavajalik. Autor: Reformierakond. Parlamendisaadik

  2. Archaeological investigations of the Bronze Age village of Bagnara di Romagna (RA

    Directory of Open Access Journals (Sweden)

    Maurizio Cattani

    2014-12-01

    Full Text Available This paper summarizes the results of researches carried out in the area next to the modern village of Bagnara di Romagna (RA, where several evidences related to a Bronze Age settlement have been collected. Recently test trenches and surface collections allowed to retrieve bronze and ceramics dating from the Middle Bronze Age (phase BM2 to the Recent Bronze Age (phase BR2. The analysis of landscape and the palaeoenvironmental reconstruction complete the outline of the region of Imola, Faenza and Lugo during the Bronze Age where are well known the ancient settlements of Solarolo, via Ordiere, Monte Castellaccio end S. Giuliano di Toscanella.

  3. Atividade antimicrobiana de extratos de raízes de Byrsonima crassifolia

    Directory of Open Access Journals (Sweden)

    Luís Fernando Albarello Gellen

    2016-06-01

    Full Text Available A Byrsonima crassifolia ou popularmente conhecida como “murici” é amplamente difundida nas regiões norte, nordeste e algumas partes da região centro-oeste. Bastante utilizado na culinária local tanto pelo seu gosto exótico, como pelos seus efeitos terapêuticos. O objetivo do trabalho foi avaliar o potencial antimicrobiano do extrato de raízes de Byrsonima crassifolia sobre bactérias de interesse médico. As amostras de B. crassifolia foram coletadas no interior do estado do Tocantins, na região do município de Cristalândia. Em seguida as raízes foram encaminhadas para o Centro Universitário Luterano de Palmas - TO, onde foram realizados os processos de produção dos extratos provenientes das raízes. Os demais procedimentos foram realizados na Universidade Federal do Tocantins, campus de Gurupi. Foram utilizadas quatro cepas bacterianas, sendo elas: Klebsiella pneumoniae ATCC700603, Escherichia coli ATCC 35218, Staphylococcus aureus ATCC 25923 e Pseudomonas aeruginosa ATCC 27853. A concentração dos extratos consistiu de 10% aquecido, 20% aquecido e 20% não aquecido. A resistência aos antimicrobianos foi realizada pelo método de difusão em disco, cuja as avaliações procederam-se 24 horas após aplicação do extrato, com auxílio de um paquímetro digital e o resultado expresso em mm. As concentrações do extrato aquoso de Byrsonima crassifólia foram eficientes na inibição bacteriana, exceto para Escherichia coli ATCC 35218. Foram observadas nas raízes pigmentações de cor característica de antocianina e quercetina, condição que pode ter influenciado no potencial antimicrobiano, pela ação antibacteriana, antiflamatório e cicatrizante destes dois flavonoides natural.

  4. Leaching of radionuclides from uranium ore and mill tailings ( Ra- 226, Tn-230).

    Science.gov (United States)

    Landa, E.R.

    1982-01-01

    The major part of the extractable uranium is associated with a readily acid-soluble fraction in both ore and tailings. The major part of the extractable 226Ra was associated with an iron, manganese hydrous-oxide fraction in the ore and tailings. Thorium-230 was the least leachable of the radionuclides studied. The major portion of the extractable 230Th was associated with alkaline-earth sulphate precipitates, organic matter, or both. The specific effects of milling on each of the nuclides are discussed.-Author

  5. Inspection of state of spent fuel elements stored in RA reactor spent fuel storage pool

    Energy Technology Data Exchange (ETDEWEB)

    Aden, V.G.; Bulkin, S.Yu.; Sokolov, A.V. [Research and Development Institute of Power Engineering, Moscow (Russian Federation); Matausek, M.V.; Vukadin, Z. [VINCA Institute of Nuclear Science, Belgrade (Yugoslavia)

    1999-07-01

    About five thousand spent fuel elements from RA reactor have been stored for over 30 years in sealed aluminum barrels in the spent fuel storage pool. This way of storage does not provide complete information about the state of spent fuel elements or the medium inside the barrels, like pressure or radioactivity. The technology has recently been developed and the equipment has been manufactured to inspect the state of the spent fuel and to reduce eventual internal pressure inside the aluminum barrels. Based on the results of this inspection, a procedure will be proposed for transferring spent fuel to a more reliable storage facility. (author)

  6. Traditional Chinese medicine: potential for clinical treatment of rheumatoid arthritis.

    Science.gov (United States)

    Moudgil, Kamal D; Berman, Brian M

    2014-07-01

    Rheumatoid arthritis (RA) is a chronic debilitating autoimmune disease affecting people worldwide. Increasing numbers of RA patients in the west are resorting to various complementary and alternative medicine modalities for relief of symptoms and well-being. Herbal products and acupuncture representing traditional Chinese medicine (TCM) are two of the most commonly used forms of complementary and alternative medicine. Frequently, their efficacy against RA and safety have been inferred from anecdotal experience or pilot testing on a relatively small number of patients following inadequate study designs. Accordingly, significant efforts need to be invested in objectively testing TCM in clinical trials that are sufficiently powered, randomized, blinded, possess appropriate controls and follow standard criteria for assessment of the outcomes. In addition, the mechanisms underlying the immunomodulatory and other antiarthritic activities of TCM modalities need to be better defined. These efforts would help validate the scientific rationale for the use of TCM for the management of RA.

  7. Periodontal pathogens participate in synovitis in patients with rheumatoid arthritis in clinical remission: a retrospective case-control study.

    Science.gov (United States)

    Kimura, Yuko; Yoshida, Shuzo; Takeuchi, Tohru; Kimura, Motoshi; Yoshikawa, Ayaka; Hiramatsu, Yuri; Ishida, Takaaki; Makino, Shigeki; Takasugi, Yoshihiro; Hanafusa, Toshiaki

    2015-12-01

    The objective of this study was to investigate the role of periodontal pathogens in RA in remission. Twenty-one patients with active RA and 70 patients in clinical remission, including 48 patients with synovitis [US power Doppler (USPD)(+) group] and 22 patients without synovitis [USPD(-) group] were clinically assessed by US. CRP, ESR, haemoglobin, MMP-3, RF and ACPA were measured. Antibody titres against four types of periodontal pathogen [Aggregatibacter actinomycetemcomitans, Eikenella corrodens (Ec), Porphyromonas gingivalis and Prevotella intermedia (Pi)] were analysed using ELISA. Musculoskeletal US examination showed that 68.6% of patients with RA in clinical remission exhibited synovitis. CRP, ESR, haemoglobin, MMP-3 and RF levels in both the USPD(+) and USPD(-) groups were clearly lower compared with the RA group in non-remission. The IgG serum antibody titre against Ec in the non-remission RA(+) group was significantly greater than that in the USPD(+) group, and the IgG antibody titre against Pi in the non-remission RA and USPD(+) groups was greater than in the USPD(-) group. More than half of RA patients in remission showed persistent synovitis. This synovitis may be associated with periodontal disease-causing Pi. Thus, treating periodontal disease should also be considered in order to achieve more profound remission of RA. © The Author 2015. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Recombinant Rhipicephalus appendiculatus gut (Ra86 and salivary gland cement (Trp64 proteins as candidate antigens for inclusion in tick vaccines: protective effects of Ra86 on infestation with adult R. appendiculatus

    Directory of Open Access Journals (Sweden)

    Saimo M

    2011-11-01

    Full Text Available Margaret Saimo1,2,*, David O Odongo3,4,*, Stephen Mwaura3, Just M Vlak1, Anthony J Musoke5, George W Lubega2, Richard P Bishop3, Monique M van Oers11Laboratory of Virology, Wageningen University, Wageningen, The Netherlands; 2School of Veterinary Medicine, Makerere University, Kampala, Uganda; 3International Livestock Research Institute, Nairobi, Kenya; 4School of Biological Sciences, University of Nairobi, Nairobi, Kenya; 5Onderstepoort Veterinary Institute, Onderstepoort, Pretoria, South Africa *These two authors made an equal contribution to this workAbstract: Rhipicephalus appendiculatus gut protein Ra86 (variants Ra85A and Ra92A and the salivary gland cement protein (Trp64 were expressed in the baculovirus-insect cell system. The recombinant gut proteins expressed as soluble proteins and the recombinant cement protein, as insoluble inclusion bodies, were used to immunize rabbits, which were then challenged with larval, nymphal, and adult stages of R. appendiculatus ticks. High tick mortality (23.3% occurred on adult ticks that fed on rabbits vaccinated with the gut proteins, compared with 1.9% mortality in ticks that fed on unvaccinated naïve control rabbits. The mean weight of engorged female ticks was significantly reduced by 31.5% in rabbits vaccinated with the Ra86 recombinant protein compared with controls, as was egg production. Marked effects on these parameters were also observed in adult ticks as a result from vaccination using Trp64, but these were not statistically significant. For both antigens, there was no demonstrable effect on larval or nymphal ticks. This study demonstrates for the first time the protective efficacy of a homolog of Boophilus microplus Bm86 in reducing tick infestation by the adult stage of the three-host tick R. appendiculatus. The results demonstrate the potential of Ra86 for vaccine development against this tick and for the control of East Coast fever.Keywords: baculovirus, Ra85A, Ra92A, Boophilus

  9. MSFIA-LOV system for {sup 226}Ra isolation and pre-concentration from water samples previous radiometric detection

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, Rogelio [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Borràs, Antoni [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Leal, Luz [Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Cerdà, Víctor [Department of Chemistry, University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Ferrer, Laura, E-mail: laura.ferrer@uib.es [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain)

    2016-03-10

    An automatic system based on multisyringe flow injection analysis (MSFIA) and lab-on-valve (LOV) flow techniques for separation and pre-concentration of {sup 226}Ra from drinking and natural water samples has been developed. The analytical protocol combines two different procedures: the Ra adsorption on MnO{sub 2} and the BaSO{sub 4} co-precipitation, achieving more selectivity especially in water samples with low radium levels. Radium is adsorbed on MnO{sub 2} deposited on macroporous of bead cellulose. Then, it is eluted with hydroxylamine to transform insoluble MnO{sub 2} to soluble Mn(II) thus freeing Ra, which is then coprecipitated with BaSO{sub 4}. The {sup 226}Ra can be directly detected in off-line mode using a low background proportional counter (LBPC) or through a liquid scintillation counter (LSC), after performing an on-line coprecipitate dissolution. Thus, the versatility of the proposed system allows the selection of the radiometric detection technique depending on the detector availability or the required response efficiency (sample number vs. response time and limit of detection). The MSFIA-LOV system improves the precision (1.7% RSD), and the extraction frequency (up to 3 h{sup −1}). Besides, it has been satisfactorily applied to different types of water matrices (tap, mineral, well and sea water). The {sup 226}Ra minimum detectable activities (LSC: 0.004 Bq L{sup −1}; LBPC: 0.02 Bq L{sup −1}) attained by this system allow to reach the guidance values proposed by the relevant international agencies e.g. WHO, EPA and EC. - Highlights: • Automatic, rapid and selective method for {sup 226}Ra extraction/pre-concentration from water. • MSFIA-LOV system performs a sample clean-up prior to {sup 226}Ra radiometric detection. • {sup 226}Ra sample preparation allows using two radiometric detectors (LBPC and LSC). • Environmental levels of {sup 226}Ra are easily quantified. • High sensitivity and selectivity are achieved, reaching the

  10. Evaluating galactic cosmic ray environment models using RaD-X flight data

    Science.gov (United States)

    Norman, R. B.; Mertens, C. J.; Slaba, T. C.

    2016-10-01

    Galactic cosmic rays enter Earth's atmosphere after interacting with the geomagnetic field. The primary galactic cosmic rays spectrum is fundamentally changed as it interacts with Earth's atmosphere through nuclear and atomic interactions. At points deeper in the atmosphere, such as at airline altitudes, the radiation environment is a combination of the primary galactic cosmic rays and the secondary particles produced through nuclear interactions. The RaD-X balloon experiment measured the atmospheric radiation environment above 20 km during 2 days in September 2015. These experimental measurements were used to validate and quantify uncertainty in physics-based models used to calculate exposure levels for commercial aviation. In this paper, the Badhwar-O'Neill 2014, the International Organization for Standardization 15390, and the German Aerospace Company galactic cosmic ray environment models are used as input into the same radiation transport code to predict and compare dosimetric quantities to RaD-X measurements. In general, the various model results match the measured tissue equivalent dose well, with results generated by the German Aerospace Center galactic cosmic ray environment model providing the best comparison. For dose equivalent and dose measured in silicon, however, the models were compared less favorably to the measurements.

  11. Average Frequency – RA Value for Reinforced Concrete Beam Strengthened with Carbon Fibre Sheet

    Directory of Open Access Journals (Sweden)

    Mohamad M. Z.

    2016-01-01

    Full Text Available Acoustic Emission (AE is one of the tools that can be used to detect the crack and to classify the type of the crack of reinforced concrete (RC structure. Dislocation or movement of the material inside the RC may release the transient elastic wave. In this situation, AE plays important role whereby it can be used to capture the transient elastic wave and convert it into AE parameters such as amplitude, count, rise time and duration. Certain parameter can be used directly to evaluate the crack behavior. But in certain cases, the AE parameter needs to add and calculate by using related formula in order to observe the behavior of the crack. Using analysis of average frequency and RA value, the crack can be classified into tensile or shear cracks. In this study, seven phases of increasing static load were used to observe the crack behavior. The beams were tested in two conditions. For the first condition, the beams were tested in original stated without strengthened with carbon fibre sheet (CFS at the bottom of the beam or called as tension part of the beam. For the second condition, the beams were strengthened with CFS at the tension part of the beam. It was found that, beam wrapped with CFS enhanced the strength of the beams in term of maximum ultimate load. Based on the relationship between average frequency (AF and RA value, the cracks of the beams can be classified.

  12. Natural radioactivity levels (K, Th and Ra in some areas of Punjab, India

    Directory of Open Access Journals (Sweden)

    Kumar Sanjeev

    2012-04-01

    Full Text Available Radioactivity, natural and man-made, is omnipresent in the earth's crust in different amounts. Natural radioactive materials under certain conditions can reach hazardous radiological levels. So, it becomes necessary to study the natural radioactivity levels in soil to assess the dose for the population in order to know the health risks and to have a baseline for future changes in the environmental radioactivity due to human activities. 226Ra, 232Th and 40K analysis has been carried out in soil samples collected from some areas of Punjab, India using gamma-ray spectrometry. Phe technique of gamma ray spectrometry was applied using high purity germanium gamma-ray detector and a PC based MCA. Radium equivalent activities are calculated for the analyzed samples to assess radiation hazards arising due to the use of these soil samples in construction of dwellings. Phe measured activity in the soil ranges from 23.17 to 57.87 Bq kg−1, 59.03 to 160.40 Bq kg−1 and 228.06 to 501.03 Bq kg−1 for 226Ra, 232Ph and 40K with mean values of 37.93, 84.47 and 351.17Bqkg−1 respectively. It has been observed that on the average the outdoor terrestrial gamma air absorbed dose rate is about 84.65nGyh−1.

  13. Mechanics of the IL2RA gene activation revealed by modeling and atomic force microscopy.

    Directory of Open Access Journals (Sweden)

    Pascale Milani

    Full Text Available Transcription implies recruitment of RNA polymerase II and transcription factors (TFs by DNA melting near transcription start site (TSS. Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites, located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studies, result in the progressive positioning of curvature apex towards the TSS, likely facilitating local DNA melting. In vitro assays confirm specific binding of the General Transcription Factors (GTFs TBP and TFIIB over TATA-TSS position, where an inhibitory nucleosome prevented preinitiation complex (PIC formation and uncontrolled DNA melting. These findings represent a substantial advance showing, first, that the structural properties of the IL2RA promoter are encoded in the DNA sequence and second, that during the initiation process DNA conformation is dynamic and not static.

  14. U-Th-Ra disequilibria in sediments of the Dora Baltea river (Italia)

    Science.gov (United States)

    Chabaux, F.; Deloche, A.; Pelt, E.; Granet, M.; Perrone, Th.; Boutin, R.; Viville, D.; Rihs, S.; Stille, P.

    2012-04-01

    In order to constrain the transfer time of sediments in Alpine rivers, we propose to use the U-series nuclides approach recently developed for Himalayan rivers (e.g., Chabaux et al., 2008; Granet et al., 2010). Therefore, a series of bank sediments has beeen collected along the Dora Baltea river (Italia), one of the Po's tributaries draining the southern slope of the Mont Blanc Massif. In addition to U series nuclides, major and trace element concentrations and Sr and Nd isotope ratios have been analyzed for each sample. The study indicates that the (234U/238U)-, (230Th/234U)- and the (226Ra/230Th)- activity ratios are very similar for all the samples, whereas the 230Th/232Th ratios can differ from one sample to another. Such a variation, consistent with the Sr and Nd isotope data, is certainly the consequence of mineralogical heterogeneities in the samples. This suggests that the use of 238U-230Th-232Th systematics alone is probably insufficient for constraining the transfer time of sediments in the Po rivers alluvial plain, whereas the combination of 238U-230Th disequilibrium with the 230Th-226Ra disequilibrium can help to constrain such time information.

  15. Fitting peculiar spectral profiles in He I 10830 \\r{A} absorption features

    CERN Document Server

    Manrique, S J González; Yabar, A Pastor; Denker, M Collados C; Fischer, C E; Gömöry, P; Diercke, A; González, N Bello; Schlichenmaier, R; Balthasar, H; Berkefeld, T; Feller, A; Hoch, S; Hofmann, A; Kneer, F; Lagg, A; Nicklas, H; Suárez, D Orozco; Schmidt, D; Schmidt, W; Sigwarth, M; Sobotka, M; Solanki, S K; Soltau, D; Staude, J; Strassmeier, K G; Verma, M; Volkmer, R; von der Lühe, O; Waldmann, T

    2016-01-01

    The new generation of solar instruments provides better spectral, spatial, and temporal resolution for a better understanding of the physical processes that take place on the Sun. Multiple-component profiles are more commonly observed with these instruments. Particularly, the He I 10830 \\r{A} triplet presents such peculiar spectral profiles, which give information on the velocity and magnetic fine structure of the upper chromosphere. The purpose of this investigation is to describe a technique to efficiently fit the two blended components of the He I 10830 \\r{A} triplet, which are commonly observed when two atmospheric components are located within the same resolution element. The observations used in this study were taken on 2015 April 17 with the very fast spectroscopic mode of the GREGOR Infrared Spectrograph (GRIS) attached to the 1.5-meter GREGOR solar telescope, located at the Observatorio del Teide, Tenerife, Spain. We apply a double-Lorentzian fitting technique using Levenberg-Marquardt least-squares ...

  16. Coverage and Capacity Analysis of Sigfox, LoRa, GPRS, and NB-IoT

    DEFF Research Database (Denmark)

    Vejlgaard, Benny; Lauridsen, Mads; Nguyen, Huan Cong

    2017-01-01

    In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS is challe......In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS...... is challenged for indoor coverage. Furthermore, the study analyzes the capacity of the four technologies assuming a traffic growth from 1 to 10 IoT device per user. The conclusion is that the 95 %-tile uplink failure rate for outdoor users is below 5 % for all technologies. For indoor users only NB-IoT provides...

  17. RaD-X: Complementary measurements of dose rates at aviation altitudes

    Science.gov (United States)

    Meier, Matthias M.; Matthiä, Daniel; Forkert, Tomas; Wirtz, Michael; Scheibinger, Markus; Hübel, Robert; Mertens, Christopher J.

    2016-09-01

    The RaD-X stratospheric balloon flight organized by the National Aeronautics and Space Administration was launched from Fort Sumner on 25 September 2015 and carried several instruments to measure the radiation field in the upper atmosphere at the average vertical cutoff rigidity Rc of 4.1 GV. The German Aerospace Center (Deutsches Zentrum für Luft- und Raumfahrt) in cooperation with Lufthansa German Airlines supported this campaign with an independent measuring flight at the altitudes of civil aviation on a round trip from Germany to Japan. The goal was to measure dose rates under similar space weather conditions over an area on the Northern Hemisphere opposite to the RaD-X flight. Dose rates were measured in the target areas, i.e., around vertical cutoff rigidity Rc of 4.1 GV, at two flight altitudes for about 1 h at each position with acceptable counting statistics. The analysis of the space weather situation during the flights shows that measuring data were acquired under stable and moderate space weather conditions with a virtually undisturbed magnetosphere. The measured rates of absorbed dose in silicon and ambient dose equivalent complement the data recorded during the balloon flight. The combined measurements provide a set of experimental data suitable for validating and improving numerical models for the calculation of radiation exposure at aviation altitudes.

  18. Rapid Reagentless Detection of M. tuberculosis H37Ra in Respiratory Effluents

    Energy Technology Data Exchange (ETDEWEB)

    Adams, K L; Steele, P T; Bogan, M J; Sadler, N M; Martin, S; Martin, A N; Frank, M

    2008-01-29

    Two similar mycobacteria, Mycobacteria tuberculosis H37Ra and Mycobacteria smegmatis are rapidly detected and identified within samples containing a complex background of respiratory effluents using Single Particle Aerosol Mass Spectrometry (SPAMS). M. tuberculosis H37Ra (TBa), an avirulent strain, is used as a surrogate for virulent tuberculosis (TBv); M. smegmatis (MSm) is utilized as a near neighbor confounder for TBa. Bovine lung surfactant and human exhaled breath condensate are used as first-order surrogates for infected human lung expirations from patients with pulmonary tuberculosis. This simulated background sputum is mixed with TBa or MSm and nebulized to produce conglomerate aerosol particles, single particles that contain a bacterium embedded within a background respiratory matrix. Mass spectra of single conglomerate particles exhibit ions associated with both respiratory effluents and mycobacteria. Spectral features distinguishing TBa from MSm in pure and conglomerate particles are shown. SPAMS pattern matching alarm algorithms are able to distinguish TBa containing particles from background matrix and MSm for >50% of the test particles, which is sufficient to enable a high probability of detection and a low false alarm rate if an adequate number of such particles are present. These results indicate the potential usefulness of SPAMS for rapid, reagentless tuberculosis screening.

  19. Concerted action of NIC relaxase and auxiliary protein MobC in RA3 plasmid conjugation.

    Science.gov (United States)

    Godziszewska, Jolanta; Moncalián, Gabriel; Cabezas, Matilde; Bartosik, Aneta A; de la Cruz, Fernando; Jagura-Burdzy, Grazyna

    2016-08-01

    Conjugative transfer of the broad-host-range RA3 plasmid, the archetype of the IncU group, relies on the relaxase NIC that belongs to the as yet uncharacterized MOBP4 subfamily. NIC contains the signature motifs of HUH relaxases involved in Tyr nucleophilic attack. However, it differs in the residue involved in His activation for cation coordination and was shown here to have altered divalent cation requirements. NIC is encoded in the mobC-nic operon preceded directly by oriT, where mobC encodes an auxiliary transfer protein with a dual function: autorepressor and stimulator of conjugative transfer. Here an interplay between MobC and NIC was demonstrated. MobC is required for efficient NIC cleavage of oriT in supercoiled DNA whereas NIC assists MobC in repression of the mobC-nic operon. A 7-bp arm of IR3 (IR3a) was identified as the binding site for NIC and the crucial nucleotides in IR3a for NIC recognition were defined. Fully active oriTRA3 was delineated to a 47-bp DNA segment encompassing a conserved cleavage site sequence, the NIC binding site IR3a and the MobC binding site OM . This highly efficient RA3 conjugative system with defined requirements for minimal oriT could find ample applications in biotechnology and computational biology where simple conjugative systems are needed.

  20. Aniela Meyer Ginsberg e os estudos de raça/etnia e intercultura no Brasil

    Directory of Open Access Journals (Sweden)

    Renata Rocha Tsuji da Cunha

    2014-12-01

    Full Text Available Este ensaio delineia as contribuições de Aniela Meyer Ginsberg (1902-1986 para o estudo das relações étnico-raciais e interculturais no Brasil. Sua produção sobre estes temas – entre artigos, capítulos de livros e resumos de congressos – foi nosso objeto central de interesse. Influenciada pela agenda antirracista do pós-guerra, os processos inter e intraculturais, as relações étnico-raciais e as migrações estavam no centro de suas investigações. Aniela é uma personagem importante da história do pensamento psicológico brasileiro, seus estudos sobre raça/ etnia no Brasil configuram-se como estudos intraculturais da sociedade nacional e de suas amplas diversidades. A autora procurou desconstruir a visão determinista biológica das raças/etnias e mostrar que é na interação dos indivíduos com a sociedade que as diferenças podem transformar-se em desigualdades.

  1. Upgrades for an improved measurement of the EDM of 225Ra

    Science.gov (United States)

    Rabga, Tenzin; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Korsch, Wolfgang; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Fromm, Steven; Ready, Roy; Singh, Jaideep T.

    2017-01-01

    If charge conjugation (C), parity (P) and time-reversal (T) symmetries, collectively form a good symmetry of nature, CPT, then T-violating phenomena would also violate CP. An Electric Dipole Moment (EDM) would violate time-reversal symmetry, and therefor EDMs provide a sensitive way for probing CP-violation that might explain the abundance of matter over anti-matter in the Universe. The 225Ra atom (t1/2 = 15 days, I = 1/2) is a particularly attractive candidate for an EDM search in diamagnetic atoms due to its octupole deformed nuclear structure, nearly degenerate parity doublet ground state, and a large mass, that make it sensitive to T-violating interactions in the nuclear sector. Our latest measurement limits the atomic EDM of 225Ra to be less than 1.4x10-23 e-cm (95% C.L). Further experimental upgrades are being implemented including an electric field upgrade to enhance the EDM sensitivity and STIRAP for an improved spin precession detection scheme. With these upgrades in place our EDM sensitivity should increase by nearly two orders of magnitude and allow us to substantially improve constraints on certain T-violating processes within the nucleus. This work is supported by the U.S. DOE, Office of Science, Office of Nuclear Physics, under contract DE-AC02-06CH11357 and the Michigan State University.

  2. Early vascular alterations in SLE and RA patients--a step towards understanding the associated cardiovascular risk.

    Directory of Open Access Journals (Sweden)

    Maria José Santos

    Full Text Available Accelerated atherosclerosis represents a major problem in both systemic lupus erythematosus (SLE and rheumatoid arthritis (RA patients, and endothelial damage is a key feature of atherogenesis. We aimed to assess early endothelial changes in SLE and RA female patients (127 SLE and 107 RA without previous CV events. Biomarkers of endothelial cell activation (intercellular adhesion molecule-1 (sICAM-1, vascular cell adhesion molecule-1 (sVCAM-1, thrombomodulin (TM, and tissue factor (TF were measured and endothelial function was assessed using peripheral artery tonometry. Reactive hyperemia index (RHI, an indicator of microvascular reactivity, and augmentation index (AIx, a measure of arterial stiffness, were obtained. In addition, traditional CV risk factors, disease activity and medication were determined. Women with SLE displayed higher sICAM-1 and TM and lower TF levels than women with RA (p = 0.001, p<0.001 and p<0.001, respectively. These differences remained significant after controlling for CV risk factors and medication. Serum levels of vascular biomarkers were increased in active disease and a moderate correlation was observed between sVCAM-1 levels and lupus disease activity (rho = 0.246 and between TF levels and RA disease activity (rho = 0.301. Although RHI was similar across the groups, AIx was higher in lupus as compared to RA (p = 0.04. Also in active SLE, a trend towards poorer vasodilation was observed (p = 0.06. In conclusion, women with SLE and RA present with distinct patterns of endothelial cell activation biomarkers not explained by differences in traditional CV risk factors. Early vascular alterations are more pronounced in SLE which is in line with the higher CV risk of these patients.

  3. [Guidelines in RA treatment: concepts on safety and recommendations using anti-TNF-alpha inhibitors. Grupo de Estudio de Nuevas Terapias de Enfermedades reumáticas (GENTE)].

    Science.gov (United States)

    Díaz-Jouanen, Efraín; Abud-Mendoza, Carlos; Garza-Elizondo, Mario Alberto; Medrano-Ramírez, Gabriel; Burgos-Vargas, Rubén; Orozco-Alcalá, José Javier; Pacheco-Tena, César Francisco; Pineda, Carlos; Pozos-Espíndola, Juan Carlos; Ramos-Niembro, Francisco; Robles-San-Román, Manuel; Santana-Sahagún, Jesús Ernesto

    2009-01-01

    Recommendations for the use of Disease-Modifying Antirheumatic Drugs (DMARD) with both conventional and biological agents in Rheumatoid Arthritis (RA) must be based on their safety profile, adverse effects, risks, and advantages. With the purpose of presenting the most updated information about the safety of tumor necrosis factor alpha (TNFalpha) antagonists, in this article we summarize the literature published during the last three years about this sort of biological agents in specific clinical situations, such as risk of developing infections, cancer, cardiovascular diseases, and autoimmunity; as well as their administration to patients who will undergo surgical procedures, pregnant and/or breast-feeding women, and patients who need immunizations. Likewise, in this analysis we offer specific recommendations, based on evidence, for the best anti-TNF-alfa management.

  4. Oceanographic profile data collected from CTD casts aboard RA-4 as part of project OPR-P136-RA-14 in the Coastal Waters of SE Alaska and Gulf of Alaska from 2014-05-07 to 2014-11-11 (NCEI Accession 0130664)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130664 includes physical and profile data collected aboard the RA-4 during project OPR-P136-RA-14 in the Coastal Waters of SE Alaska and Gulf of...

  5. Characterization of rheumatoid arthritis subtypes using symptom profiles, clinical chemistry and metabolomics measurements.

    Directory of Open Access Journals (Sweden)

    Herman A van Wietmarschen

    Full Text Available OBJECTIVE: The aim is to characterize subgroups or phenotypes of rheumatoid arthritis (RA patients using a systems biology approach. The discovery of subtypes of rheumatoid arthritis patients is an essential research area for the improvement of response to therapy and the development of personalized medicine strategies. METHODS: In this study, 39 RA patients are phenotyped using clinical chemistry measurements, urine and plasma metabolomics analysis and symptom profiles. In addition, a Chinese medicine expert classified each RA patient as a Cold or Heat type according to Chinese medicine theory. Multivariate data analysis techniques are employed to detect and validate biochemical and symptom relationships with the classification. RESULTS: The questionnaire items 'Red joints', 'Swollen joints', 'Warm joints' suggest differences in the level of inflammation between the groups although c-reactive protein (CRP and rheumatoid factor (RHF levels were equal. Multivariate analysis of the urine metabolomics data revealed that the levels of 11 acylcarnitines were lower in the Cold RA than in the Heat RA patients, suggesting differences in muscle breakdown. Additionally, higher dehydroepiandrosterone sulfate (DHEAS levels in Heat patients compared to Cold patients were found suggesting that the Cold RA group has a more suppressed hypothalamic-pituitary-adrenal (HPA axis function. CONCLUSION: Significant and relevant biochemical differences are found between Cold and Heat RA patients. Differences in immune function, HPA axis involvement and muscle breakdown point towards opportunities to tailor disease management strategies to each of the subgroups RA patient.

  6. Modeling using clinical examination indicators predicts interstitial lung disease among patients with rheumatoid arthritis

    Science.gov (United States)

    Wang, Yao; Song, Wuqi; Wu, Jing; Li, Zhangming; Mu, Fengyun; Li, Yang; Huang, He; Zhu, Wenliang

    2017-01-01

    Interstitial lung disease (ILD) is a severe extra-articular manifestation of rheumatoid arthritis (RA) that is well-defined as a chronic systemic autoimmune disease. A proportion of patients with RA-associated ILD (RA-ILD) develop pulmonary fibrosis (PF), resulting in poor prognosis and increased lifetime risk. We investigated whether routine clinical examination indicators (CEIs) could be used to identify RA patients with high PF risk. A total of 533 patients with established RA were recruited in this study for model building and 32 CEIs were measured for each of them. To identify PF risk, a new artificial neural network (ANN) was built, in which inputs were generated by calculating Euclidean distance of CEIs between patients. Receiver operating characteristic curve analysis indicated that the ANN performed well in predicting the PF risk (Youden index = 0.436) by only incorporating four CEIs including age, eosinophil count, platelet count, and white blood cell count. A set of 218 RA patients with healthy lungs or suffering from ILD and a set of 87 RA patients suffering from PF were used for independent validation. Results showed that the model successfully identified ILD and PF with a true positive rate of 84.9% and 82.8%, respectively. The present study suggests that model integration of multiple routine CEIs contributes to identification of potential PF risk among patients with RA.

  7. A theoretical model for the production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Fan Liu, Sau; Allen, B J

    2006-09-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.

  8. RA Acts in a Coherent Feed-Forward Mechanism with Tbx5 to Control Limb Bud Induction and Initiation

    Science.gov (United States)

    Nishimoto, Satoko; Wilde, Susan M.; Wood, Sophie; Logan, Malcolm P.O.

    2015-01-01

    Summary The retinoic acid (RA)- and β-catenin-signaling pathways regulate limb bud induction and initiation; however, their mechanisms of action are not understood and have been disputed. We demonstrate that both pathways are essential and that RA and β-catenin/TCF/LEF signaling act cooperatively with Hox gene inputs to directly regulate Tbx5 expression. Furthermore, in contrast to previous models, we show that Tbx5 and Tbx4 expression in forelimb and hindlimb, respectively, are not sufficient for limb outgrowth and that input from RA is required. Collectively, our data indicate that RA signaling and Tbx genes act in a coherent feed-forward loop to regulate Fgf10 expression and, as a result, establish a positive feedback loop of FGF signaling between the limb mesenchyme and ectoderm. Our results incorporate RA-, β-catenin/TCF/LEF-, and FGF-signaling pathways into a regulatory network acting to recruit cells of the embryo flank to become limb precursors. PMID:26212321

  9. RA Acts in a Coherent Feed-Forward Mechanism with Tbx5 to Control Limb Bud Induction and Initiation

    Directory of Open Access Journals (Sweden)

    Satoko Nishimoto

    2015-08-01

    Full Text Available The retinoic acid (RA- and β-catenin-signaling pathways regulate limb bud induction and initiation; however, their mechanisms of action are not understood and have been disputed. We demonstrate that both pathways are essential and that RA and β-catenin/TCF/LEF signaling act cooperatively with Hox gene inputs to directly regulate Tbx5 expression. Furthermore, in contrast to previous models, we show that Tbx5 and Tbx4 expression in forelimb and hindlimb, respectively, are not sufficient for limb outgrowth and that input from RA is required. Collectively, our data indicate that RA signaling and Tbx genes act in a coherent feed-forward loop to regulate Fgf10 expression and, as a result, establish a positive feedback loop of FGF signaling between the limb mesenchyme and ectoderm. Our results incorporate RA-, β-catenin/TCF/LEF-, and FGF-signaling pathways into a regulatory network acting to recruit cells of the embryo flank to become limb precursors.

  10. Chromosomal localization of a novel retinoic acid induced gene RA28 and the protein distribution of its encoded protein

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Gene RA28 is a retinoic acid induced novel gene isolated in our laboratory previously. All-trans retinoic acid (ATRA) was used to induce lung adenocarcinoma cell line GLC-82, and RA28 was obtained by subtractive hybridization. Green fluorescent protein (GFP) has emerged as a unique tool for examining introcellular phenomena in living cells. GFP possesses an intrinsic fluorescence at 488 nm that does not require other co-factors. In this report, an eukaryotic expression plasmid pEGFP-C1-RA28 was constructed and transfected with parental cell line GLC-82 to analyze protein expression and its distribution in living cells. Moreover, radiation hybrid (RH) technique was used to localize RA28 to the chromosome. The results show that gene RA28 is mapped to the chromosome 19q13.1 region, its encoded protein is distributed on cell membrane. All the results further demonstrate that GFP and RH techniques are accurate, fast, repetitive, and will be powerful methods for investigating the gene and protein localization.

  11. Interplay between patient global assessment, pain, and fatigue and influence of other clinical disease activity measures in patients with active rheumatoid arthritis

    DEFF Research Database (Denmark)

    Egsmose, Emilie Lund; Madsen, Ole Rintek

    2015-01-01

    analog scales (VAS) in the daily clinic by patients with active rheumatoid arthritis (RA). Associations with other measures of disease activity were also examined. Traditional disease activity data on 221 RA patients with active disease planned to initiate biological treatment were extracted from...

  12. Body mass does not impact the clinical response to intravenous abatacept in patients with rheumatoid arthritis. Analysis from the "pan-European registry collaboration for abatacept (PANABA)

    DEFF Research Database (Denmark)

    Iannone, Florenzo; Courvoisier, Delphine S; Gottenberg, Jacques Eric

    2017-01-01

    Some evidences suggest that obesity impairs the effectiveness of TNF inhibitors. We examined the impact of body mass index (BMI) on the clinical effectiveness of abatacept in rheumatoid arthritis (RA) patients. This is a pooled analysis of 10 prospective cohorts of RA patients. All patients with ...

  13. Våld i nära relationer : En diskursanalys kring framställningar om våld i nära relationer i tidskriften Socionomen

    OpenAIRE

    Alakokkare, Marlene; Andreasson, Cecilia

    2014-01-01

    Syftet med denna kvalitativa uppsats är att undersöka hur våld i nära relationer framställs i tidskriften Socionomen. Vår empiri består av 42 artiklar som berör våld i nära relationer. Artiklarna är publicerade mellan åren 1997 - 2013 i tidskriften Socionomen. Uppsatsens teoretiska utgångspunkt är ett socialkonstruktionistiskt perspektiv, som bidrar med att synliggöra sociala konstruktioner inom forskningsområdet. Som analysmetod används en form av diskursanalys för att urskilja subjektsposit...

  14. Magmatic Processes at Loihi Seamount Inferred From 226Ra-230Th-234U-238U Disequilibria

    Science.gov (United States)

    Pietruszka, A. J.; Hauri, E. H.; Garcia, M. O.

    2001-12-01

    We have conducted a detailed study of the U-series isotope geochemistry of young tholeiitic, transitional and alkalic Loihi basalts to examine the melt generation process during the preshield stage of a Hawaiian volcano. A previous study (Sims et al. 1999; GCA, v. 63) of two dredged lavas from the deep flanks of Loihi found a higher (230Th/238U) activity ratio in an alkalic basalt (1.07) compared to a tholeiitic basalt (1.04). This difference suggests that the tholeiitic basalt may have formed at a higher rate of mantle upwelling than the alkalic basalt. Our samples were collected from surface lava flows at Loihi's summit and along the volcano's south rift zone by submersible. Analyses were preformed using high-precision plasma ionization mass spectrometry. The samples display a relatively large range in the amount of excess 226Ra (0-13%) that extends to much lower values than observed at Kilauea Volcano (11-12%). The low (226Ra/230Th) ratios of Loihi lavas probably result from post-eruptive decay of 226Ra and imply eruption ages of 0-12 kyr. All of the Loihi samples (including the 1996 lava) have small amounts of excess 234U (0.2-0.8%). The most likely source for (234U/238U)>1 at Loihi is seawater, which has (234U/238U)=1.14. Since all of the samples were fresh, hand-picked glasses, these elevated (234U/238U) ratios may have resulted from the assimilation of a seawater-derived component within Loihi's magmatic plumbing system rather than post-eruptive U addition. The range of (230Th/238U) that we measured is 1.01-1.07, which is larger than the previous range known for Loihi. Mass balance calculations using the measured (234U/238U) ratios suggest that 1-6% of the U in the samples that we analyzed is ultimately derived from seawater. Correcting the 230Th-238U disequilibria of the Loihi lavas for this seawater-derived U results in a narrower range in the amount of excess 230Th (6-9%) with no significant differences between tholeiitic, transitional or alkalic basalts

  15. Role of IL-1ra/IL-1β and IL-10/IL-6 ratio in coronary artery disease%IL-1Ra/IL-1β及IL-10/IL-6比值在冠心病的作用及其意义

    Institute of Scientific and Technical Information of China (English)

    刘书院; 钟小理; 杨正林; 段克欣

    2012-01-01

    目的:探讨IL-1β、IL-1受体拮抗剂(IL-1 Ra)、IL-10、IL-6水平及IL-1 Ra/IL-1β、IL-10/IL-6比值在冠状动脉粥样硬化性心脏病(冠心痛)患者血清中的变化以及临床意义.方法:选择稳定型心绞痛(SAP)患者26例,不稳定型心绞痛(UAP)患者27例,AMI患者27例,健康体检者30名,分为SAP组、UAP组、AMI组及正常对照组,采用ELISA法检测四组患者血清IL-1β、IL-1 Ra、IL-10、IL-6水平,计算IL-1 Ra/IL-1β、IL-10/IL-6比值,并进行比较.结果:UAP组、AMI组患者的血清IL-1Ra水平均明显低于正常对照组(P<0.05),IL-1β高于对照组(P<0.05);三组冠心痛患者的IL-1 Ra/IL-1β比值均低于正常对照组(P<0.05).三组冠心病患者的血清IL-10、IL-6水平均高于正常对照组(P均<0.05),而IL-10/IL-6比值低于正常对照组(P均<0.05).结论:IL-1β、IL-1Ra、IL-10、IL-6可能参与了冠心病的炎症反应过程,IL-1Ra/IL-1β及IL-10/IL-6比值反映了冠心痛患者的免疫调节状况,其比值高低及动态变化对冠心痛患者的病情监测有重要参考价值.%Objective: To investigate the clinical significance of interleukin-1 β (IL-1β) , interleukin-1 recep- tor antagonist (IL-IRa) , interleukin 10 (IL-10) , interleukin-6 (IL-6) and the ratio of IL-1 Ra/IL-1 β, IL-10/IL-6 in coronary heart disease (CHD). Methods : Patients with stable angina pectoris (SAP group, n = 26), unstable angina pectoris ( UAP group, n = 26 ) , and acute myocardial infarction ( AMI group, n = 27) were involved. Thirty healthy people were selected as control group. Serum level of IL-1 β, IL-IRa, IL-10, IL-6 were detected by Enzyme-linked immunosorbent assay (ELISA) and the ratio of IL-1 Ra/IL-1 β and IL-10/IL-6 were calculated. Results : The serum level of IL-1 Ra in UAP group and AMI group were significantly lower , and IL-1β levels were significantly higher than that in control group (P <0. 05). IL-1 Ra/IL-1 p ratio in CHD patients was lower than in control group (P

  16. Discussion on etiology and pathogenesis of chest of RA in TCM%类风湿关节炎胸痹的中医学病因病机的探讨

    Institute of Scientific and Technical Information of China (English)

    崔欣美; 陈会君; 张静

    2013-01-01

    Rheumatoid arthritis (RA) is a kind of destructive joint disease is characterized by chronic systemic autoimmune disease, The pathological lesions often think that the joint synovitis. The disease is a TCM “arthralgia”, “Lijie”, “gout” category. RA mostly late-stage clinical manifestations chest main article on the relationship between the two aspects of the etiology and pathogenesis are reviewed.%类风湿关节炎(Rheumatoid Arthritis, RA)是一种以慢性破坏性关节病变为特征的全身性自身免疫疾病,其病理病变特点常以为关节滑膜炎为主。本病属中医“痹证”、“历节”、“痛风”范畴。RA 后期临床表现大多以胸痹为主,本文就对二者的关系,在病因病机方面进行了综述。

  17. Hand bone loss in early rheumatoid arthritis during a methotrexate-based treat-to-target strategy with or without adalimumab-a substudy of the optimized treatment algorithm in early RA (OPERA) trial.

    Science.gov (United States)

    Ørnbjerg, L M; Østergaard, M; Jensen, T; Hørslev-Petersen, K; Stengaard-Pedersen, K; Junker, P; Ellingsen, T; Ahlquist, P; Lindegaard, H; Linauskas, A; Schlemmer, A; Dam, M Y; Hansen, I; Lottenburger, T; Ammitzbøll, C G; Jørgensen, A; Krintel, S B; Raun, J; Hetland, M L; Slot, Ole; Nielsen, Lars Kjær; Skjødt, Henrik; Majgaard, Ole; Lorenzen, Tove; Horn, Hans Christian; Kowalski, Marcin; Johansen, Inger Lauge; Pedersen, Peter Mosborg; Manilo, Natalia; Bliddal, Henning

    2017-04-01

    This study aims to investigate 1-year hand bone loss (HBL1-year) in early rheumatoid arthritis (RA) patients treated with a methotrexate (MTX) and intra-articular triamcinolone treat-to-target strategy +/- adalimumab and to determine if HBL6months is associated with radiographic progression after 2 years. In a clinical trial (OPERA) of 180 treatment-naive early RA patients, bone mineral density (BMD) was estimated from hand radiographs with digital X-ray radiogrammetry (DXR) at baseline, after 6 (n = 90) and 12 months (n = 70) of follow-up. Baseline and 2-year radiographs were scored according to the Sharp/van der Heijde method. Baseline characteristics and HBL6months (0-6 months changes in DXR-BMD) were investigated as predictors of structural damage by univariate linear (∆ total Sharp/van der Heijde score (TSS) as dependent variable) and logistic (+/-radiographic progression (∆TSS >0) as dependent variable) regression analyses. Variables with p 0) (OR 0.96 (0.92-1.0), p = 0.10). In early RA patients treated with a methotrexate-based treat-to-target strategy, the majority of patients had increased HBL1-year, irrespective of adalimumab; HBL6months was independently associated with ∆TSS after 2 years.

  18. Patients with seronegative RA have more inflammatory activity compared with patients with seropositive RA in an inception cohort of DMARD-naïve patients classified according to the 2010 ACR/EULAR criteria.

    Science.gov (United States)

    Nordberg, Lena Bugge; Lillegraven, Siri; Lie, Elisabeth; Aga, Anna-Birgitte; Olsen, Inge Christoffer; Hammer, Hilde Berner; Uhlig, Till; Jonsson, Maria Karolina; van der Heijde, Désirée; Kvien, Tore K; Haavardsholm, Espen Andre

    2017-02-01

    To compare the presentation of seropositive and seronegative early rheumatoid arthritis (RA) in disease-modifying antirheumatic drug (DMARD)-naïve patients classified according to the 2010 American College of Rheumatology (ACR)/European League Against Rheumatism (EULAR) criteria. All patients had symptom duration from first swollen joint EULAR classification criteria for RA. NCT01205854; Pre-results. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  19. Miks ma end ära ei tapa : [luuletused] / Paul-Eerik Rummo

    Index Scriptorium Estoniae

    Rummo, Paul-Eerik, 1942-

    2001-01-01

    Tekst eesti ja inglise k. P.-E. Rummo lühibiograafia eesti ja inglise k. lk. 131. Sisu: Miks ma end ära ei tapa = Why I don't kill myself ; "Maailm mu hinge ei tungind, vaid imbus..." = "The world did not invade my soul, it seeped into it..." ; "Taevas on kummargil üle maa..." = "The sky stoops over the earth..." ; "Nüüd anna jumal jaksu joosta juhuste sajus..." = "Now grant me God the strength to run through the rains of chance..." ; Jälle, jälle, jälle, jälle, jälle... = Again again again again again ; "maailm mille lõpp on mõeldav..." = "a world whose end is conceivable..." ; Kinni hoidmas = Clinging ; Poolüminal = Crooning

  20. Raízes inquisitórias do tribunal do júri no Brasil

    OpenAIRE

    2013-01-01

    Nesta monografia se investigam as raízes do sistema inquisitório que contaminam o procedimento do tribunal do júri no Brasil, por meio de uma análise histórica. Partindo do conceito de sistema, descreve-se a formação dos dois tipos mais conhecidos de sistema, o acusatório e o inquisitório e, na sequência, a impossibilidade da existência de um sistema dito misto, conforme aponta a doutrina crítica. Em seguida, menciona-se como surgiu e se desenvolveu o tribunal do júri ao longo da história e c...