WorldWideScience

Sample records for kadowaki nims tsukuba

  1. Standard NIM instrumentation system

    International Nuclear Information System (INIS)

    1990-05-01

    NIM is a standard modular instrumentation system that is in wide use throughout the world. As the NIM system developed and accommodations were made to a dynamic instrumentation field and a rapidly advancing technology, additions, revisions and clarifications were made. These were incorporated into the standard in the form of addenda and errata. This standard is a revision of the NIM document, AEC Report TID-20893 (Rev. 4) dated July 1974. It includes all the addenda and errata items that were previously issued as well as numerous additional items to make the standard current with modern technology and manufacturing practice

  2. 76 FR 3648 - NIMS Training Plan

    Science.gov (United States)

    2011-01-20

    ...] NIMS Training Plan AGENCY: Federal Emergency Management Agency, DHS. ACTION: Notice of availability... comments on the NIMS Training Plan. This plan defines National Incident Management System (NIMS) national... sustaining NIMS training. In addition to delineating responsibilities and actions, the NIMS Training Plan...

  3. Information Communication System at Tsukuba EXPO'85

    Science.gov (United States)

    Sakagami, Yasuhiko

    At Tsukuba EXPO'85 information communication system which employs the most advanced technology such as optical technology, is operated to conduct EXPO information guide, environmental and security control at the site, and office management, which is effective for smooth management of Exposition and appropriate service to visitors. The author outlines the characteristics of the whole communication system, and also describes how communication system using optical technology is located in the whole communication system, and the system outline.

  4. Data of atmospheric diffusion experiments (Tsukuba, 1989)

    International Nuclear Information System (INIS)

    Hayashi, Takashi; Chino, Masamichi; Yamazawa, Hiromi; Moriuchi, Shigeru; Ishikawa, Hirohiko; Adachi, Takashi; Kojima, Hiromi

    1999-08-01

    The data were obtained in the atmospheric diffusion experiments in the Tsukuba area, 1989 which were a part of the Experiment to Demonstrate the Propriety of Atmospheric Dispersion Evaluation Method for Safety Analysis, entrusted with the Science and Technology Agency. The experiments were conducted by JAERI in cooperation with the Japan Weather Association. The report contains tracer concentration data of surface sampling points and meteorological data. (author)

  5. 'The Tsukuba Network' as a new medium for promoting research communications in Tsukuba

    Science.gov (United States)

    Taguchi, Masamichi

    The Science and Technology Agency constructed a PC-based communication network system named 'The Tsukuba Network' as a new medium for promoting the research communication in, and with, the Tsukuba City. For about a year prior to full operation, a pilot system was operated with the cooperation of some monitoring users to gain skill and experience for managing the PC-based communication network. The main service functions of the system are : bulletin board service; electronic mail ; construction of, and access to, the databases involving research information in Tsukuba City ; electronic conference; common use of softwares ; connection to other communication networks ( e.g., university and local network). The host computer is a work station EWS4800 and the network processor is a personal computer PC-9801 . These two computers are connected with LAN.

  6. NIMS: hotspots on Io during G2

    Science.gov (United States)

    1996-01-01

    The Near Infrared Mapping Spectrometer (NIMS) on the Galileo spacecraft imaged Io at high spectral resolution at a range of 439,000 km (275,000 miles) during the G2 encounter on 7 September 1996. This image shows (on the right) Io as seen in the infrared by NIMS. The image on the left shows the same view from Voyager in 1979. This NIMS image can be compared to the NIMS images from the G1 orbit (June 1996) to monitor changes on Io. The NIMS image is at 4.9 microns, showing thermal emissions from the hotspots. The brightness of the pixels is a function of size and temperature.At least 10 hotspots have been identified and can be matched with surface features. An accurate determination of the position of the hotspot in the vicinity of Shamash Patera is pending. Hotspots are seen in the vicinity of Prometheus, Volund and Marduk, all sites of volcanic plume activity during the Galileo encounters, and also of active plumes in 1979. Temperatures and areas have been calculated for the hotspots shown. Temperatures range from 828 K (1031 F) to 210 K (- 81.4 F). The lowest temperature is significantly higher than the Io background (non-hotspot) surface temperature of about 100 K (-279 F). Hotspot areas range from 6.5 square km (2.5 sq miles) to 40,000 sq km (15,400 sq miles). The hottest hotspots have smallest areas, and the cooler hotspots have the largest areas. NIMS is continuing to observe Io to monitor volcanic activity throughout the Galileo mission.The Galileo mission is managed by the Jet Propulsion Laboratory for NASA's Office of Space Science, Washington, D.C.This image and other images and data received from Galileo are posted on the Galileo mission home page on the World Wide Web at http://galileo.jpl.nasa.gov.

  7. NIM gas controlled sodium heat pipe

    Science.gov (United States)

    Yan, X.; Zhang, J. T.; Merlone, A.; Duan, Y.; Wang, W.

    2013-09-01

    Gas controlled heat pipes (GCHPs) provide a uniform, stable and reproducible temperature zone to calibrate thermometers and thermocouples, and to realize defining fixed points using a calorimetric method. Therefore, to perform such investigations, a GCHP furnace using sodium as its working fluid was constructed at the National Institute of Metrology (NIM), China. Also, investigations into the thermal characteristics of the NIM gas controlled sodium heat pipe were carried out. The temperature stability over 5 hours was better than ±0.25 mK while controlling the pressure at 111250 Pa. The temperature uniformity within 14 cm from the bottom of the thermometer well was within 0.3 mK. While keeping the pressure stable at the same value, 17 temperature determinations were performed over 14 days, obtaining a temperature reproducibility of 1.27 mK. Additionally, the NIM gas controlled sodium heat pipe was compared with the sodium heat pipe produced by INRiM. The temperature in the INRiM sodium heat pipe operating at 111250 Pa was determined, obtaining a difference of 21 mK with respect to the NIM GCHP. This difference was attributed to sodium impurities, pressure controller capabilities and reproducibility, and instabilities of high temperature standard platinum resistance thermometers (HTSPRTs). Further investigations will be carried out on extending the pressure/temperature range and connecting both GCHPs to the same pressure line.

  8. NIMS Observation of Hotspots on Io

    Science.gov (United States)

    1996-01-01

    Io has been imaged by the Near Infrared Mapping Spectrometer (NIMS) on Galileo. The image on the right shows for the first time the distribution of volcanic hotspots on the surface of Io, as seen by NIMS. Three of these hotspots are new discoveries, only detectable with the NIMS instrument. This image was taken during the G1 encounter on June 29 1996. The image on the left shows the same view of Io as seen by the Voyager spacecraft in 1979. At least one dozen hotspots have been identified from this NIMS image. Most of the hotspot locations can be matched with volcanic features on the surface of Io, including the vent area of the active Prometheus plume.The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov.

  9. A new multi-purpose NIM module

    International Nuclear Information System (INIS)

    Dong Binjiang; Wang Congrong; Du Chunxiang.

    1992-01-01

    The authors briefly state the function, character and main technique performance of a new multi-purpose NIM interposition (NI01) developed recently. This interposition uses 8031 single-chip microprocessors as the kernel and is multi-purpose, reliable and convenient. Especially, it is suitable for training teaching and scientific researching

  10. The 12UD Pelletron accelerator at the University of Tsukuba

    International Nuclear Information System (INIS)

    Seki, S.; Furuno, K.; Ishihara, T.; Nagashima, Y.; Yamanouchi, M.; Aoki, T.; Mikumo, T.; Sanada, J.; Tsukuba Univ., Sakura, Ibaraki

    1981-01-01

    The 12 UD Pelletron installed at the Tandem Accelerator Center of the University of Tsukuba has been in operation for nearly four years. The installation of the accelerator is described and the operational experience with the accelerator and associate facilities are summarized. (orig.)

  11. Computerized CAMAC and NIM module library

    International Nuclear Information System (INIS)

    Pope, G.F.; McDonald, R.J.

    1990-08-01

    The Lawrence Berkeley Laboratory owns a large number of CAMAC and NIM modules which can be connected together to form data acquisition systems used in experiments. Many of these modules are contained in ''pools'' for common usage. This paper describes a system of storage and inventory control that allows easy check-out and check-in of the modules utilizing networked Macintosh computers, FoxBase+/Mac software, and bar-code technology. It also provides search capability for the user and tracking capability for the pool administrator. This inventory system has applications to any pool of items that are routinely loaned. 8 figs

  12. The general solution of a Nim-heap game

    Institute of Scientific and Technical Information of China (English)

    宋林森; 卢澎涛

    2010-01-01

    As a combinatorial one,the game Nim turns out to be extremely useful in certain types of combinatorial game analysis.It has given the general solution of the game a Nim-heap game and the result has proved true.

  13. Explaining implementation behaviour of the National Incident Management System (NIMS).

    Science.gov (United States)

    Jensen, Jessica; Youngs, George

    2015-04-01

    This paper explains the perceived implementation behaviour of counties in the United States with respect to the National Incident Management System (NIMS). The system represents a massive and historic policy mandate designed to restructure, standardise and thereby unify the efforts of a wide variety of emergency management entities. Specifically, this study examined variables identified in the NIMS and policy literature that might influence the behavioural intentions and actual behaviour of counties. It found that three key factors limit or promote how counties intend to implement NIMS and how they actually implement the system: policy characteristics related to NIMS, implementer views and a measure of local capacity. One additional variable-inter-organisational characteristics-was found to influence only actual behaviour. This study's findings suggest that the purpose underlying NIMS may not be fulfilled and confirm what disaster research has long suggested: the potential for standardisation in emergency management is limited. © 2015 The Author(s). Disasters © Overseas Development Institute, 2015.

  14. NIM Realization of the Gallium Triple Point

    Science.gov (United States)

    Xiaoke, Yan; Ping, Qiu; Yuning, Duan; Yongmei, Qu

    2003-09-01

    In the last three years (1999 to 2001), the gallium triple-point cell has been successfully developed, and much corresponding research has been carried out at the National Institute of Metrology (NIM), Beijing, China. This paper presents the cell design, apparatus and procedure for realizing the gallium triple point, and presents studies on the different freezing methods. The reproducibility is 0.03 mK, and the expanded uncertainty of realization of the gallium triple point is evaluated to be 0.17 mK (p=0.99, k=2.9). Also, the reproducibility of the gallium triple point was compared with that of the triple point of water.

  15. NIMS and Empa announce STAM collaboration

    Science.gov (United States)

    Yoshida, Toyonobu; Krug, Harald F.

    2014-02-01

    In January 2014, the Swiss Federal Laboratories for Materials Science and Technology (Empa) joined the National Institute for Materials Science (NIMS) in collaborative activities on Science and Technology of Advanced Materials (STAM). STAM was founded in 2000. In 2005 NIMS took over the management of its peer review and financial systems, resulting in a continuous rise of the impact of the journal. Empa will provide further support for the editorial management of STAM. In particular, it will establish a European office in Switzerland and reinforce the Editorial Board. From this point of view, I am pleased and excited to have new colleagues from Empa on our Editorial Board, and I believe that this collaboration will bring us a remarkable improvement in the international visibility of STAM and increase the number of paper submissions from Europe. It will expand the topics covered in the journal from traditional fields of materials science with a focus on energy and environmental issues to medical and bioengineering applications, where Empa has a significant expertise. I firmly believe that Empa's participation in publishing STAM will reinforce its position as an open-access journal with a global audience. Together with my colleagues, Yoshio Sakka (NIMS) and Shu Yamaguchi (University of Tokyo), I welcome Harald F Krug as the new Co-Editor-in-Chief of STAM. I am also pleased to learn that the year 2014 not only marks the 15th anniversary of STAM, but also the 150th anniversary of the establishment of diplomatic relations between Japan and Switzerland. Toyonobu Yoshida Advances in materials science are key for the sustainable development of our society. That is why, starting from January 2014, Empa, the Swiss Federal Laboratories for Materials Science and Technology, have engaged in an entirely new field of activity: scientific publishing. As mentioned above, Empa joined NIMS in the publishing of STAM. We have a clear-cut goal in mind: we want to support our sister

  16. NIMS EXPERIMENT DATA RECORDS: SL-9 COMET IMPACT WITH JUPITER

    Data.gov (United States)

    National Aeronautics and Space Administration — NIMS Experiment Data Record (EDR) files contain raw data from the Galileo Orbiter Near-Infrared Mapping Spectrometer (CARLSONETAL1992). This raw data requires...

  17. NIMS EXPERIMENT DATA RECORDS: GASPRA/IDA ENCOUNTERS

    Data.gov (United States)

    National Aeronautics and Space Administration — NIMS Experiment Data Record (EDR) files contain raw data from the Galileo Orbiter Near-Infrared Mapping Spectrometer (CARLSONETAL1992). This raw data requires...

  18. A new electronic circuit for NIM rack power supply

    International Nuclear Information System (INIS)

    Toledo, Fabio de; Domienikan, Claudio; Zahn, Guilherme S.

    2013-01-01

    A new and useful electronic circuit designed to substitute the old power supply of IPEN model PM 1212 Nuclear Instrument Modules (NIM) racks is presented. Originally, these NIM racks were projected by IPEN workshop at 1974 to be used in nuclear research laboratories. The PM1212 provided mounting space and power sources for up to 12 standard nuclear electronic modules and power supply regulated DC voltages of ±24V (2A), ±12V (4A) and unregulated AC 117V (0.5A). Currently, several of these NIM racks are not in use because the electronic components of the original design have become obsolete and are no longer manufactured. The new electronic circuit provides the same original voltages adjusted in the single circuit and, additionally, ±6V. The new power supply was designed and constructed at IPEN-CNEN/SP by employing modern national components and expertise. (author)

  19. A new electronic circuit for NIM rack power supply

    Energy Technology Data Exchange (ETDEWEB)

    Toledo, Fabio de; Domienikan, Claudio; Zahn, Guilherme S., E-mail: fatoledo@ipen.br, E-mail: clanikan@ipen.br, E-mail: gzahn@ipen.br [Intituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), Sao Paulo, SP (Brazil)

    2013-07-01

    A new and useful electronic circuit designed to substitute the old power supply of IPEN model PM 1212 Nuclear Instrument Modules (NIM) racks is presented. Originally, these NIM racks were projected by IPEN workshop at 1974 to be used in nuclear research laboratories. The PM1212 provided mounting space and power sources for up to 12 standard nuclear electronic modules and power supply regulated DC voltages of ±24V (2A), ±12V (4A) and unregulated AC 117V (0.5A). Currently, several of these NIM racks are not in use because the electronic components of the original design have become obsolete and are no longer manufactured. The new electronic circuit provides the same original voltages adjusted in the single circuit and, additionally, ±6V. The new power supply was designed and constructed at IPEN-CNEN/SP by employing modern national components and expertise. (author)

  20. List of unrestricted NIM publications issued from 1966 to 1980

    International Nuclear Information System (INIS)

    Glen, H.W.

    1980-01-01

    This publication lists the 742 unrestricted reports, 337 papers, 26 patents, and 4 other technical publications that were issued as publications of the National Institute for Metallurgy (NIM) from 1966 (the year of its inception) to 1st April 1980. For ease of reference these publications are also classified under research topics. Also included are details of the 2 periodicals issued by NIM and a list of the current miscellaneous publications of the Institute, which include the annual report, and brochures and leaflets of various kinds [af

  1. High-resolution structure of the antibiotic resistance protein NimA from Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Leiros, Hanna-Kirsti S.; Tedesco, Consiglia; McSweeney, Seán M.

    2008-01-01

    In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. Many anaerobic human pathogenic bacteria are treated using 5-nitroimidazole-based (5-Ni) antibiotics, a class of inactive prodrugs that contain a nitro group. The nitro group must be activated in an anaerobic one-electron reduction and is therefore dependent on the redox system in the target cells. Antibiotic resistance towards 5-Ni drugs is found to be related to the nim genes (nimA, nimB, nimC, nimD, nimE and nimF), which are proposed to encode a reductase that is responsible for converting the nitro group of the antibiotic into a nonbactericidal amine. A mechanism for the Nim enzyme has been proposed in which two-electron reduction of the nitro group leads to the generation of nontoxic derivatives and confers resistance against these antibiotics. The cofactor was found to be important in the mechanism and was found to be covalently linked to the reactive His71. In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. A planar cofactor is clearly visible and well defined in the electron-density map adjacent to His71, the identification of the cofactor and its properties are discussed

  2. Present status of tandem accelerator in Tsukuba University

    Energy Technology Data Exchange (ETDEWEB)

    Ishihara, Toyoyuki; Oshima, Hiroyuki; Ishii, Satoshi [Tsukuba Univ., Ibaraki (Japan). Tandem Accelerator Center; and others

    1996-12-01

    The tandem accelerator in Tsukuba University, 12UD Peletron, has continued the operation for 21 years, and the total operation time became 61,822 hours as of the end of March, 1996. In this paper, the state of operation of the tandem accelerator in 1995 and the state of use classified by experimental fields are reported. As for the improvement of peripheral equipment, the renewal of the radiation monitoring system and the new installation of the going-in and out control system for radiation control zones were carried out. In fiscal year 1995, the operation time of the accelerator was 3,966 hours, and ion acceleration time was 3,427 hours or 86%. The renewal and improvement of the accelerator system that had been begun in fiscal year 1989 was completed. Also the operation at highest accelerating voltage 12 MV was carried out for 7 hours. In March, the operation was not done because of the periodic inspection. The state of use of two ion sources for joint utilization is shown, and 20 kinds of ions were used. The state of joint utilization, the troubles and repair, and the renewal and new installation are reported. The plan of installing 1 MV TANDETRON is explained. (K.I.)

  3. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1990-07-01

    This Annual Report covers the research activities and the technical developments of the Tandem Accelerator Center, University of Tsukuba, for the period from April 1989 to March 1990. Laborious but promising work of refreshing 12UD has continued throughout the year, in the intervals of the regular machine-time service. The terminal voltage of 12UD has gone beyond 12MV. At the time of writing this manuscript, 12UD is running up stably around 12.4MV, the loss current being essentially zero. She has recovered and further begins to flesh up without a surgical operation of grafting 'compressed tubes'. In the course of conditioning, the voltage has reached to 12.78MV. In spite of the considerable time consumed by the refreshing, the total machine-time has exceeded 2,000 hours. In addition to the improvement of 12UD, activities at the Center covered a wide area of research field, viz. 1) nuclear spectroscopy of transitional nuclei, 2) heavy ion fusion and fission processes, 3) polarization phenomena in nuclear reactions, 4) charge exchange process in atomic collisions, 5) application of energetic heavy ions investigating solid-state physics, and 6) effect of ion-irradiation on the fatigue properties of metal. Theoretical work pertinent to the nuclear structure is also included in this report. (author)

  4. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1989-07-01

    This Annual Report covers the research activities and the technical developments of the Tandem Accelerator Center, University of Tsukuba, for the period from April 1988 to March 1989. Laborious work of refreshing 12UD has continued throughout the year, in parallel with the regular machine-time service. Almost 95% of the work has been completed by the end of March 1989. At the time of writing this manuscript, 12UD is running up modestly beyond 11.0MV, raising joyous murmur of pellet chains. She has recovered up to the hilt. In spite of the considerable time consumed by the refreshing, the total machine-time has exceeded 3,000 hours. Activities at the Center covered a wide area of research field, viz. 1) nuclear spectroscopy of transitional nuclei, 2) heavy ion fusion and fission processes, 3) polarization phenomena in nuclear reactions, 4) charge exchange process in atomic collisions, 5) application of energetic heavy ions to investigating solid-state physics, and 6) effect of ion-irradiation on the fatigue properties of metal. Theoretical work pertinent to the nuclear structure is also included in this report. Prospects for a project attempting to equip the Center with a crystal-ball spectrometer is, at least, not gloomy. First streaks of light seems to begin glimmering. (author)

  5. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1985-01-01

    This annual report covers the work carried out at the Tandem Accelerator Center, University of Tsukuba, during fiscal year 1984. The 12 UD Pelletron tandem accelerator was operated very stably. In addition, the heavy ion post accelerator with interdigital-H structure has worked well, providing additional energy of 2 MeV per charge for heavy ions. The constructions of a new Lamb-shift polarized ion source, a multi-computer control system for the ion sources of the UTTA, an electrostatic inflection system of incident ions for the UTTA, a new beam bunching system, and a new SF 6 gas handling system were under way. The development and performance test of various radiation detector systems were carried out. Two thirds of the research works were performed by using the beam from the Lamb-shift polarized ion source (PIS). A newly constructed fast spin state interchange control system for the PIS made polarization experiment more effective and accurate. The research activities in the fields of nuclear physics, atomic and solid state physics, and biology and medical science are reported. (Kako, I.)

  6. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    Furuno, K.; Shima, K.; Komatsubara, T.

    1992-09-01

    This annual report includes the research activities and the technical developments carried out at the Tandem Accelerator Center in University of Tsukuba for the period from April 1991 to March 1992. Research activities covered the following subjects. Experimental investigations were made on 1) nuclear spectroscopy of high-spin rotational states and high-spin isomers in odd-odd nuclei, anomalous Fermi-coupling constant in the β decay of 35 Ar and the search for new isotopes around the mass number 90; 2) polarization phenomena in nuclear reactions; 3) the application of energetic heavy ions to solid state physics; 4) the properties of defects in metal produced by proton irradiation; 5) the magnetic properties of LiVO 2 by NMR; 6) off line Moessbauer studies; and 7) the mechanism of micro-cluster formation at the surface of material by heavy-ion bombardment. Theoretical work pertinent to the nuclear collective motion and the relativistic mean-field theory is also included in this report. (J.P.N.)

  7. NIMS: hotspots on Io during G2 (continued)

    Science.gov (United States)

    1997-01-01

    This is another Near Infrared Mapping Spectrometer (NIMS) image of Io, taken during the G2 encounter in September 1996. This is a dayside image of Io (on the right) against the clouds of Jupiter (the blue background). On the left is a Voyager mosaic of Io with the same viewing geometry for comparison purposes. This NIMS data set has been processed to highlight the positions of hot spots on the surface of Io. At least 11 can be seen. Two of the hotspots are newly discovered by the NIMS instrument. Others correspond to sites of plume eruptions and volcanic calderas and volcanic flows. This image can be compared with the SSI image P-47971 released on October 23, 1996, which was taken almost exactly the same position.The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov.

  8. List of unrestricted NIM publications issued from 1966 to 1979

    International Nuclear Information System (INIS)

    Glen, H.W.

    1979-01-01

    This publication lists the 714 unrestricted reports, 294 papers, 19 patents, and 5 other technical publications that were issued as publications of the National Institute for Metallurgy from 1966 (the year of its inception) to 1st April, 1979. For ease of reference, these publications are also classified under the research programmes that gave rise to them. Also included are details of the 2 periodicals issued by NIM and a list of the current miscellaneous publications of the Institute, which include the annual report, and brochures and leaflets of various kinds [af

  9. List of unrestricted NIM publications issued from 1966 to 1978

    International Nuclear Information System (INIS)

    Glen, H.W.

    1977-01-01

    This publication lists the 679 unrestricted reports, 263 papers, 19 patents, and 4 other technical publications that were issued as publications of the National Institute for Metallurgy from 1966 (the year of its inception) to 1st April, 1978. For ease of reference, these publications are also classified under the research programmes that gave rise to them. Also included are details of the 2 periodicals issued by NIM and a list of the current miscellaneous publications of the Institute, which include the annual report, and brochures and leaflets of various kinds [af

  10. Electronic equipment. New functional units in NIM standard

    International Nuclear Information System (INIS)

    Cheminaud, J.; Grasso, G.; Lacroix, C.; Le Baud, P.; Pichot, G.; Poirot, L.

    During the year 1974 some new modules have been developed: i) a tele-control for delay-time which utilizes a multiplexer-demultiplexer; ii) a fast pulse generator for light-emitting diodes which allows the test of devices using photomultipliers; iii) a plug-in-unit of variable shaper for fast pulses, with reset and zero dead time; iv) an amplifier with a 50MHz band-pass and an adjusting amplification from 0 to 10; v) a pocket generator delivering NIM pulses [fr

  11. National Incident Management System (NIMS) Standards Review Panel Workshop Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Stenner, Robert D.; Kirk, Jennifer L.; Stanton, James R.; Shebell, Peter; Schwartz, Deborah S.; Judd, Kathleen S.; Gelston, Gariann M.

    2006-02-07

    The importance and need for full compliant implementation of NIMS nationwide was clearly demonstrated during the Hurricane Katrina event, which was clearly expressed in Secretary Chertoff's October 4, 2005 letter addressed to the State's governors. It states, ''Hurricane Katrina was a stark reminder of how critical it is for our nation to approach incident management in a coordinated, consistent, and efficient manner. We must be able to come together, at all levels of government, to prevent, prepare for, respond to, and recover from any emergency or disaster. Our operations must be seamless and based on common incident management doctrine, because the challenges we face as a nation are far greater than capabilities of any one jurisdiction.'' The NIMS is a system/architecture for organizing response on a ''national'' level. It incorporations ICS as a main component of that structure (i.e., it institutionalizes ICS in NIMS). In a paper published on the NIMS Website, the following statements were made: ''NIMS represents a core set of doctrine, principles, terminology, and organizational processes to enable effective, efficient and collaborative incident management at all levels. To provide the framework for interoperability and compatibility, the NIMS is based on a balance between flexibility and standardization.'' Thus the NIC is challenged with the need to adopt quality SDO generated standards to support NIMS compliance, but in doing so maintain the flexibility necessary so that response operations can be tailored for the specific jurisdictional and geographical needs across the nation. In support of this large and complex challenge facing the NIC, the Pacific Northwest National Laboratory (PNNL) was asked to provide technical support to the NIC, through their DHS Science and Technology ? Standards Portfolio Contract, to help identify, review, and develop key standards for NIMS compliance. Upon

  12. Thermal stability, swelling behavior and CO 2 absorption properties of Nanoscale Ionic Materials (NIMs)

    KAUST Repository

    Andrew Lin, Kun-Yi; Park, Youngjune; Petit, Camille; Park, Ah-Hyung Alissa

    2014-01-01

    © The Royal Society of Chemistry 2015. Nanoscale Ionic Materials (NIMs) consist of a nanoscale core, a corona of charged brushes tethered on the surface of the core, and a canopy of the oppositely charged species linked to the corona. Unlike conventional polymeric nanocomposites, NIMs can display liquid-like behavior in the absence of solvents, have a negligible vapor pressure and exhibit unique solvation properties. These features enable NIMs to be a promising CO2 capture material. To optimize NIMs for CO2 capture, their structure-property relationships were examined by investigating the roles of the canopy and the core in their thermal stability, and thermally- and CO2-induced swelling behaviors. NIMs with different canopy sizes and core fractions were synthesized and their thermal stability as well as thermally- and CO2-induced swelling behaviors were determined using thermogravimetry, and ATR FT-IR and Raman spectroscopies. It was found that the ionic bonds between the canopy and the corona, as well as covalent bonds between the corona and the core significantly improved the thermal stability compared to pure polymer and polymer/nanofiller mixtures. A smaller canopy size and a larger core fraction led to a greater enhancement in thermal stability. This thermal stability enhancement was responsible for the long-term thermal stability of NIMs over 100 temperature swing cycles. Owing to their ordered structure, NIMs swelled less when heated or when they adsorbed CO2 compared to their corresponding polymers. This journal is

  13. Thermal stability, swelling behavior and CO 2 absorption properties of Nanoscale Ionic Materials (NIMs)

    KAUST Repository

    Andrew Lin, Kun-Yi

    2014-11-11

    © The Royal Society of Chemistry 2015. Nanoscale Ionic Materials (NIMs) consist of a nanoscale core, a corona of charged brushes tethered on the surface of the core, and a canopy of the oppositely charged species linked to the corona. Unlike conventional polymeric nanocomposites, NIMs can display liquid-like behavior in the absence of solvents, have a negligible vapor pressure and exhibit unique solvation properties. These features enable NIMs to be a promising CO2 capture material. To optimize NIMs for CO2 capture, their structure-property relationships were examined by investigating the roles of the canopy and the core in their thermal stability, and thermally- and CO2-induced swelling behaviors. NIMs with different canopy sizes and core fractions were synthesized and their thermal stability as well as thermally- and CO2-induced swelling behaviors were determined using thermogravimetry, and ATR FT-IR and Raman spectroscopies. It was found that the ionic bonds between the canopy and the corona, as well as covalent bonds between the corona and the core significantly improved the thermal stability compared to pure polymer and polymer/nanofiller mixtures. A smaller canopy size and a larger core fraction led to a greater enhancement in thermal stability. This thermal stability enhancement was responsible for the long-term thermal stability of NIMs over 100 temperature swing cycles. Owing to their ordered structure, NIMs swelled less when heated or when they adsorbed CO2 compared to their corresponding polymers. This journal is

  14. The NIM alanine-EPR dosimetry system: its application in NDAS programme and others

    International Nuclear Information System (INIS)

    Gao Jun-Cheng

    1999-01-01

    In 1983, National Institute of Metrology (NIM) began to study alanine-EPR dosimetry system. From 1988 on, the system has been used as a transfer standard to launch into the National Dose Assurance Service (NDAS) programme for cobalt-60 facilities in China. In this paper, the eleven years implementation of NDAS programme are presented by statistics. In 1991, under an IAEA coordinated research programme, NIM had studied to extend the range of the system to therapy level. In recent years, the NIM in cooperation with other institutes has been developing film-alanine dosimeter for electron beam dosimetry. (author)

  15. A standard digital data busing system for use with nim modules

    International Nuclear Information System (INIS)

    Kirsten, F.A.

    1984-01-01

    A NIM Committee working group has recently completed a specification that defines a standard digital bus for use with NIM modules. The standard bus is based on the General Purpose Instrumentation Bus of IEEE Standard 488. It incorporates a subset of the codes and conventions for the GPIB given in IEEE Standard 728. The standard bus definition also includes specifications for additional features and provisions that are special to the NIM application. The most prominent of these is the set of mnemonics defined for information transfer

  16. Annual report of Tandem Accelerator Center, University of Tsukuba, for fiscal 1975

    International Nuclear Information System (INIS)

    1976-01-01

    Tandem Accelerator Center (TAC) is a research center of the University of Tsukuba established mainly for interdisciplinary research. Its principal apparatus is a 12 UD Pelletron tandem accelerator of which assembling was completed in fiscal 1975. Activities of the TAC for the period of April 1975 to March 1976 are reported: accelerator and beam transport system, general equipments, equipment development, and heavy-ion reactions. (Mori, K.)

  17. Annual report of Tandem Accelerator Center, University of Tsukuba, for fiscal 1976

    International Nuclear Information System (INIS)

    1977-01-01

    A research center of the University of Tsukuba, Tandem Accelerator Center (TAC) has a 12 UD Pelletron tandem accelerator as its principal apparatus; of which acceptance test was finished in July 1976. Activities of the TAC for the period of April 1976 to March 1977 are reported: accelerator and beam transport system, general equipments, equipment development, nuclear physics, chemistry, and biological and medical Science. (Mori, K.)

  18. Diagnostic performance of sonoelastographic Tsukuba score and strain ratio in evaluation of breast masses

    Directory of Open Access Journals (Sweden)

    Mahmoud Abd Elaziz Dawood

    2018-03-01

    Full Text Available The aim of this prospective study was to evaluate the diagnostic performance of the use of strain index ratio by sonoelastography to differentiate between benign and malignant breast lesions. Patients & Methods: This prospective study including 40 females, complaining of breast masses which were suspicious to be malignant on clinical examination. All patients were submitted to B-mode Ultrasound and sonoelastography. Biopsy as a gold standard and pathological study were done for all breast lesions. Results: US examination of every mass was done and categorized according to BI-RADS categories according to ACR2013, according to US lexicon. Sonoelastography examination with Lesions classification was performed on the basis of a 5-point scoring method proposed by Tsukuba elasticity score. Then measurements of strain ratio were done. Statistical analysis of combination of the three methods was sensitivity of 96.7%, specificity of 100% when we use cut off value of 3–4 in elastography score and ≤3 cut off value of strain ratio. Conclusion: The combined use of strain ratio with Tsukuba score and BI-RADS categorization increased the diagnostic performance in differentiation between benign and malignant breast lesions. Keywords: Elastography, Breast masses, Strain ratio, Ultrasound, BI-RADS classification, Tsukuba score

  19. Small-for-Size Liver Transplantation Increases Pulmonary Injury in Rats: Prevention by NIM811

    Directory of Open Access Journals (Sweden)

    Qinlong Liu

    2012-01-01

    Full Text Available Pulmonary complications after liver transplantation (LT often cause mortality. This study investigated whether small-for-size LT increases acute pulmonary injury and whether NIM811 which improves small-for-size liver graft survival attenuates LT-associated lung injury. Rat livers were reduced to 50% of original size, stored in UW-solution with and without NIM811 (5 μM for 6 h, and implanted into recipients of the same or about twice the donor weight, resulting in half-size (HSG and quarter-size grafts (QSG, respectively. Liver injury increased and regeneration was suppressed after QSG transplantation as expected. NIM811 blunted these alterations >75%. Pulmonary histological alterations were minimal at 5–18 h after LT. At 38 h, neutrophils and monocytes/macrophage infiltration, alveolar space exudation, alveolar septal thickening, oxidative/nitrosative protein adduct formation, and alveolar epithelial cell/capillary endothelial apoptosis became overt in the lungs of QSG recipients, but these alterations were mild in full-size and HSG recipients. Liver pretreatment with NIM811 markedly decreased pulmonary injury in QSG recipients. Hepatic TNFα and IL-1β mRNAs and pulmonary ICAM-1 expression were markedly higher after QSG transplantation, which were all decreased by NIM811. Together, dysfunctional small-for-size grafts produce toxic cytokines, leading to lung inflammation and injury. NIM811 decreased toxic cytokine formation, thus attenuating pulmonary injury after small-for-size LT.

  20. Designing a power supply for Nim-bin formatted equipment

    International Nuclear Information System (INIS)

    Banuelos G, L. E.; Hernandez D, V. M.; Vega C, H. R.

    2016-09-01

    From an old Nuclear Chicago power supply that was practically in the trash, was able to recover the 19 inches casing, rear connectors and the housing where the circuits were. From here all mechanical parts were cleaned and the electronic design was started to replace the original voltage and current functions of this equipment. The cards for the ±6, ±12 and ±24 voltages were designed, simulated and tested with circuitry that does not rely on specialized components or that is sold only by the equipment manufacturer. In the handling of the current by each voltage to operate, was possible to tie with the specifications of the manufacturers like Ortec or Canberra where a model of power supply gives a power of 160 Watts. Basic tests were performed to show that the behavior is very similar to commercial equipment; such as the full load regulation index and the noise level in the supply voltages. So our Nim-bin voltage source is viable for use in our institution laboratories. (Author)

  1. NIM: A Node Influence Based Method for Cancer Classification

    Directory of Open Access Journals (Sweden)

    Yiwen Wang

    2014-01-01

    Full Text Available The classification of different cancer types owns great significance in the medical field. However, the great majority of existing cancer classification methods are clinical-based and have relatively weak diagnostic ability. With the rapid development of gene expression technology, it is able to classify different kinds of cancers using DNA microarray. Our main idea is to confront the problem of cancer classification using gene expression data from a graph-based view. Based on a new node influence model we proposed, this paper presents a novel high accuracy method for cancer classification, which is composed of four parts: the first is to calculate the similarity matrix of all samples, the second is to compute the node influence of training samples, the third is to obtain the similarity between every test sample and each class using weighted sum of node influence and similarity matrix, and the last is to classify each test sample based on its similarity between every class. The data sets used in our experiments are breast cancer, central nervous system, colon tumor, prostate cancer, acute lymphoblastic leukemia, and lung cancer. experimental results showed that our node influence based method (NIM is more efficient and robust than the support vector machine, K-nearest neighbor, C4.5, naive Bayes, and CART.

  2. The new 6 MV multi-nuclide AMS facility at the University of Tsukuba

    International Nuclear Information System (INIS)

    Sasa, Kimikazu; Takahashi, Tsutomu; Matsumura, Masumi; Matsunaka, Tetsuya; Satou, Yukihiko; Izumi, Daiki; Sueki, Keisuke

    2015-01-01

    The former accelerator mass spectrometry (AMS) system installed on the 12UD Pelletron tandem accelerator at the University of Tsukuba was completely destroyed by the Great East Japan Earthquake on 11 March 2011. A replacement has been designed and constructed at the university as part of the post-quake reconstruction project. It consists of a 6 MV Pelletron tandem accelerator, two multiple cathode AMS ion sources (MC-SNICSs), and a rare-particle detection system. The 6 MV Pelletron tandem accelerator will be applied not only to AMS, but also to areas such as nanotechnology, ion beam analysis, heavy ion irradiation, and nuclear physics. The rare-particle detection system will be capable of measuring environmental levels of long-lived radioisotopes of "1"0Be, "1"4C, "2"6Al, "3"6Cl, "4"1Ca, and "1"2"9I. It is also expected to measure other radioisotopes such as "3"2Si and "9"0Sr. The 6 MV Pelletron tandem accelerator was installed in the spring of 2014 at the University of Tsukuba. Routine beam delivery and AMS experiments will start in 2015.

  3. The new 6 MV multi-nuclide AMS facility at the University of Tsukuba

    Energy Technology Data Exchange (ETDEWEB)

    Sasa, Kimikazu, E-mail: ksasa@tac.tsukuba.ac.jp; Takahashi, Tsutomu; Matsumura, Masumi; Matsunaka, Tetsuya; Satou, Yukihiko; Izumi, Daiki; Sueki, Keisuke

    2015-10-15

    The former accelerator mass spectrometry (AMS) system installed on the 12UD Pelletron tandem accelerator at the University of Tsukuba was completely destroyed by the Great East Japan Earthquake on 11 March 2011. A replacement has been designed and constructed at the university as part of the post-quake reconstruction project. It consists of a 6 MV Pelletron tandem accelerator, two multiple cathode AMS ion sources (MC-SNICSs), and a rare-particle detection system. The 6 MV Pelletron tandem accelerator will be applied not only to AMS, but also to areas such as nanotechnology, ion beam analysis, heavy ion irradiation, and nuclear physics. The rare-particle detection system will be capable of measuring environmental levels of long-lived radioisotopes of {sup 10}Be, {sup 14}C, {sup 26}Al, {sup 36}Cl, {sup 41}Ca, and {sup 129}I. It is also expected to measure other radioisotopes such as {sup 32}Si and {sup 90}Sr. The 6 MV Pelletron tandem accelerator was installed in the spring of 2014 at the University of Tsukuba. Routine beam delivery and AMS experiments will start in 2015.

  4. The new 6 MV multi-nuclide AMS facility at the University of Tsukuba

    Science.gov (United States)

    Sasa, Kimikazu; Takahashi, Tsutomu; Matsumura, Masumi; Matsunaka, Tetsuya; Satou, Yukihiko; Izumi, Daiki; Sueki, Keisuke

    2015-10-01

    The former accelerator mass spectrometry (AMS) system installed on the 12UD Pelletron tandem accelerator at the University of Tsukuba was completely destroyed by the Great East Japan Earthquake on 11 March 2011. A replacement has been designed and constructed at the university as part of the post-quake reconstruction project. It consists of a 6 MV Pelletron tandem accelerator, two multiple cathode AMS ion sources (MC-SNICSs), and a rare-particle detection system. The 6 MV Pelletron tandem accelerator will be applied not only to AMS, but also to areas such as nanotechnology, ion beam analysis, heavy ion irradiation, and nuclear physics. The rare-particle detection system will be capable of measuring environmental levels of long-lived radioisotopes of 10Be, 14C, 26Al, 36Cl, 41Ca, and 129I. It is also expected to measure other radioisotopes such as 32Si and 90Sr. The 6 MV Pelletron tandem accelerator was installed in the spring of 2014 at the University of Tsukuba. Routine beam delivery and AMS experiments will start in 2015.

  5. NIMS structural materials databases and cross search engine - MatNavi

    Energy Technology Data Exchange (ETDEWEB)

    Yamazaki, M.; Xu, Y.; Murata, M.; Tanaka, H.; Kamihira, K.; Kimura, K. [National Institute for Materials Science, Tokyo (Japan)

    2007-06-15

    Materials Database Station (MDBS) of National Institute for Materials Science (NIMS) owns the world's largest Internet materials database for academic and industry purpose, which is composed of twelve databases: five concerning structural materials, five concerning basic physical properties, one for superconducting materials and one for polymers. All of theses databases are opened to Internet access at the website of http://mits.nims.go.jp/en. Online tools for predicting properties of polymers and composite materials are also available. The NIMS structural materials databases are composed of structural materials data sheet online version (creep, fatigue, corrosion and space use materials strength), microstructure for crept material database, Pressure vessel materials database and CCT diagram for welding. (orig.)

  6. A comparison of irradiance responsivity and thermodynamic temperature measurement between PTB and NIM

    International Nuclear Information System (INIS)

    Lu, X.; Yuan, Z.; Anhalt, K.; Taubert, R. D.

    2013-01-01

    This paper describes a comparison between PTB and NIM in the field of absolute spectral-band radiometry and thermodynamic temperature measurement. For the comparison a NIM made interference filter radiometer with a centre wavelength of 633 nm was taken to PTB. The filter radiometer was calibrated at NIM and PTB with respect to spectral irradiance responsivity. For the integral value in the band-pass range an agreement of 0.1% was observed in both calibrations. In a next step, the 633 nm filter radiometer was used to measure the temperature of a high-temperature blackbody in comparison to an 800 nm filter radiometer of PTB in the temperature range between 1400 K and 2750 K. The thermodynamic temperature measured by the two filter radiometers agreed to within 0.2 K to 0.5 K with an estimated measurement uncertainty ranging between 0.1 K and 0.4 K (k=1)

  7. Particle-size distribution of fission products in airborne dust collected at Tsukuba from April to June 1986

    International Nuclear Information System (INIS)

    Ooe, Hiroko; Seki, Riki; Ikeda, Nagao

    1988-01-01

    The radioactivity released by the reactor accident at Chernobyl was detected in surface air at Tsukuba, Japan. Gamma-spectrometry of airborne dust collected using aerodynamic separation showed higher concentrations of radionuclides in fine particles. The particle-size distribution of radionuclides changed with time. (author)

  8. Annual report 1992 of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1993-10-01

    This annual report includes the research activities and the technical developments carried out at the Tandem Accelerator Center in University of Tsukuba for the period from April 1992 to March 1993. New experimental investigations were made on (1) nuclear spectroscopy was initiated by a new γ ray spectrometer; (2) polarization phenomena in nuclear reactions; (3) the application of energetic heavy ions to solid state physics; (4) the behavior of self interstitial atoms and its migration mechanism in Mo metal (5) the studies on electronic conduction of metal oxides and bronzes by NMR; (6) Moessbauer studies on Fe-Cr alloy and the RBS analysis of YBCO superconductor films; and (7) a new field was challenged on the micro cluster physics. Nuclear collective motion and the relativistic mean-field theory is also included in this report. (J.P.N.)

  9. Speciation of Radiocesium and Radioiodine in Aerosols from Tsukuba after the Fukushima Nuclear Accident

    DEFF Research Database (Denmark)

    Xu, Sheng; Zhang, Luyuan; Freeman, Stewart P. H. T.

    2015-01-01

    iodine (I- and IO3-), soluble organic iodine, and unextractable iodine. The measured mean I-129/I-131 atomic ratio of 16.0 +/- 2.2 is in good agreement with that measured from rainwater and consistent with ratios measured in surface soil samples. Together with other aerosols and seawater samples......Aerosol samples were collected from Tsukuba, Japan, soon after the 2011 Fukushima nuclear accident and analyzed for speciation of radiocesium and radioiodine to explore their chemical behavior and isotopic ratios after the release. Most Cs-134 and Cs-137 were bound in organic matter (53......-91%) and some in water-soluble fractions (5-15%), whereas a negligible proportion of radiocesium remained in minerals. This pattern suggests that sulfate salts and organic matter may be the main carrier of Cs-bearing particles. The 129I in aerosol samples is contained in various proportions as soluble inorganic...

  10. Routine clinical heart examinations using SQUID magnetocardiography at University of Tsukuba Hospital

    Science.gov (United States)

    Inaba, T.; Nakazawa, Y.; Yoshida, K.; Kato, Y.; Hattori, A.; Kimura, T.; Hoshi, T.; Ishizu, T.; Seo, Y.; Sato, A.; Sekiguchi, Y.; Nogami, A.; Watanabe, S.; Horigome, H.; Kawakami, Y.; Aonuma, K.

    2017-11-01

    A 64-channel Nb-based DC-SQUID magnetocardiography (MCG) system was installed at the University of Tsukuba Hospital (UTH) in March 2007 after obtaining Japanese pharmaceutical approval and insurance reimbursement approval. In the period between 2008 and 2016, the total number of patients was 10 085. The heart diseases diagnosed in fetuses as well as adults are mainly atrial arrhythmia, abnormal repolarization, ventricular arrhythmia, and fetal arrhythmia. In most cases of insufficient diagnostic accuracy with electrocardiography, SQUID MCG precisely revealed these heart diseases as an abnormal electrical current distribution. Based on success in routine examinations, SQUID MCG is now an indispensable clinical instrument with diagnostic software tuned up during routine use at UTH.

  11. Temporal variation and provenance of thorium deposition observed at Tsukuba, Japan

    International Nuclear Information System (INIS)

    Hirose, Katsumi; Kikawada, Yoshikazu; Igarashi, Yasuhito

    2012-01-01

    Temporal variations of monthly thorium (Th) deposition observed at Tsukuba, Japan during the period 1990–2007, comparing with plutonium deposition, was studied. The monthly 232 Th deposition as did 239,240 Pu, varied according to season and inter-annually. In particular, 232 Th deposition increased significantly in spring coinciding with Asian dust (Kosa) events. The 230 Th/ 232 Th activity ratios vary according to sources and can therefore be used to differentiate between locally derived and remotely derived 232 Th. The 230 Th/ 232 Th activity ratios in deposition samples showed large variability with high ratios occurring in early spring. These high 230 Th/ 232 Th ratios in deposition can be attributed to local dust storms, especially in early spring, that cause resuspension of soils from cultivated fields which are characterized by high 230 Th/ 232 Th activity ratios. The results reveal that both locally and remotely derived 232 Th deposition showed seasonal variations with maxima in spring, although the remotely derived fraction is dominant rather than the locally derived one. The 232 Th deposition maxima later in spring is attributable to the remotely derived fraction, corresponding to the Kosa events. Annual 232 Th deposition exhibited an increasing trend, suggesting the presence of sources other than soil dust such as fly ash from increasing coal burning. - Highlights: ► We show monthly Th deposition observed at Tsukuba, Japan from 1990 to 2007. ► The Th deposition shows a seasonal variation and inter-annual variability. ► Th isotope ratios ( 230 Th/ 232 Th) are used to identify its sources. ► The long-term trend of Th deposition is related to increasing anthropogenic input.

  12. Annual Report of the Tandem Accelerator Center, Nuclear and Solid State Research Project, University of Tsukuba

    International Nuclear Information System (INIS)

    1978-01-01

    In 1977, 12 UD Pelletron tandem accelerator has been operated by the University's researchers and engineers. Except for the tank opening for regular inspection we met twice the troubles which forced to change the accelerating tube. The experiences teach us that it needs about 20 days to finish the conditioning after changing the accelerating tube. A sputter ion source of new version is now being installed on the top floor. Two devices for the detection of X-rays were tested. An apparatus for bombardment of samples in air for biological and medical sciences has been successfully used. The subjects of researches on nuclear physics cover the light-ion reactions, heavy-ion reactions and nuclear spectroscopy. A special emphasis has been put on the measurements on vector- and tensor-analyzing powers in the light-ion reactions, because of a higher efficiency of the polarized ion source. Elaborate works on the heavy-ion reactions including the angular correlation patterns and excitation functions have been made in parallel. Papers of these works are now being prepared, a few having been published already. Moreover, in the University of Tsukuba, a new research system, called Special Research Project on Nuclear and Solid State Sciences Using Accelerated Beams (Nuclear and Solid State Research Project) started in 1978 and will continue for five years. In this research project, researchers from various Institutes in the University of Tsukuba, as well as visiting researchers from other institutions in Japan and from abroad, participate. Using a variety of accelerated beams, i.e. of heavy, light and polarized beams, this research project aims mainly at the high excitation, short life, transient and inhomogeneous states both in nuclear and extra-nuclear world. It covers both fundamental research in nuclear, atomic and solid state sciences as well as their application in various fields. (J.P.N.)

  13. Galileo's Last Fly-Bys of Io: NIMS Observations of Loki, Tupan, and Emakong Calderas

    Science.gov (United States)

    Lopes, Rosaly M. C.; Kamp, L. W.; Davies, A. G.; Smythe, W. D.; Carlson, R. W.; Doute, S.; McEwen, A.; Turtle, E. P.; Leader, F.; Mehlman, R.

    2002-01-01

    NIMS results from the 2001 Galileo fly-bys of Io will be presented, focusing on three calderas that may contain lava lakes. Preliminary results from the January 2002 Io fly-by will be presented. Additional information is contained in the original extended abstract.

  14. An Early Danish Computer Game: The case of Nim, Piet Hein, and Regnecentralen

    DEFF Research Database (Denmark)

    Jørgensen, Anker Helms

    2009-01-01

    This paper reports on the development of Nimbi, which is an early computer game implemented at the Danish Computer Company Regnecentralen in 1962-63. Nimbi is a variant of the ancient game Nim. The paper traces the primary origins of the development of Nimbi. These include a mathematical analysis...

  15. Volcanism on Io: The Galileo NIMS Io Thermal Emission Database (NITED)

    Science.gov (United States)

    Davies, A. G.; Veeder, G. J.; Matson, D. L.; Johnson, T. V.

    2011-12-01

    In order to determine the magnitude of thermal emission from Io's volcanoes and variability with time at local, regional and global scales, we have calculated the 4.7 or 5 μm radiant flux for every hot spot in every Galileo Near Infrared Mapping Spectrometer (NIMS) observation obtained during the Galileo mission between June 1996 and October 2001. The resulting database contains over 1000 measurements of radiant flux, corrected for emission angle, range to target, and, where necessary, incident sunlight. Io's volcanoes produce the most voluminous and most powerful eruptions in the Solar System [1] and NIMS was the ideal instrument for measuring thermal emission from these volcanoes (see [1, 2]). NIMS covered the infrared from 0.7 to 5.2 μm, so measurement of hot spot thermal emission at ~5 μm was possible even in daytime observations. As part of a campaign to quantify magnitude and variability of volcanic thermal emission [1, 3-5] we examined the entire NIMS dataset (196 observations). The resulting NIMS Io Thermal Emission Database (NITED) allows the charting of 5-μm thermal emission at individual volcanoes, identifying individual eruption episodes, and enabling the comparison of activity at different hot spots [e.g., 6] and different regions of Io. Some ionian hot spots were detected only once or twice by NIMS (e.g., Ah Peku Patera, seen during I32), but most were detected many times (e.g., Culann, Tupan and Zamama, [6]). For example, the database contains over 40 observations of Loki Patera (some at high emission angle, and two partial observations). There are 55 observations of Pele. The 27 nighttime observations of Pele show a remarkably steady 5-μm radiant flux of 35 ± 12 GW/μm. There are 34 observations of Pillan, which erupted violently in 1997. Although in many observations low spatial resolution makes it difficult to separate hot spot pairs such as Susanoo Patera and Mulungu Patera; Tawhaki Patera and Hi'iaka Patera; and Janus Patera and Kanehekili

  16. Dynamic Isotope Power System (DIPS) Applications Study. Volume II. Nuclear Integrated Multimission Spacecraft (NIMS) design definition. Final report

    International Nuclear Information System (INIS)

    1979-11-01

    The design requirements for the Nuclear Integrated Multimission Spacecraft. (NIMS) are discussed in detail. The requirements are a function of mission specifications, payload, control system requirements, electric system specifications, and cost limitations

  17. Development of MW gyrotrons for fusion devices by University of Tsukuba

    International Nuclear Information System (INIS)

    Minami, R.; Kariya, T.; Imai, T.; Numakura, T.; Endo, Y.; Nakabayashi, H.; Eguchi, T.; Shimozuma, T.; Kubo, S.; Yoshimura, Y.; Igami, H.; Takahashi, H.; Mutoh, T.; Ito, S.; Idei, H.; Zushi, H.; Yamaguchi, Y.; Sakamoto, Keishi; Mitsunaka, Y.

    2012-11-01

    Over-1 MW power gyrotrons for electron cyclotron heating (ECH) have been developed in the joint program of NIFS and University of Tsukuba. The obtained maximum outputs are 1.9 MW for 0.1 s on the 77 GHz Large Helical Device (LHD) tube and 1.0 MW for 1 ms on the 28 GHz GAMMA 10 one, which are new records in these frequency ranges. In long pulse operation, 300 kW for 40 min at 77 GHz and 540 kW for 2 s at 28 GHz were achieved. A new program of 154 GHz 1 MW development has started for high density plasma heating in LHD and the first tube has been fabricated. These lower frequency tubes like 77 GHz or 28 GHz one are also important for advanced magnetic fusion devices, which use Electron Bernstein Wave (EBW) heating / current drive. As a next activity of 28 GHz gyrotron, we have already started the development of over-1.5 MW gyrotron and a new design study of 28 GHz / 35 GHz dual frequency gyrotron, which indicates the practicability of the multi-purpose gyrotron. (author)

  18. Annual report of the Tandem Accelerator Center, University of Tsukuba, 1987

    International Nuclear Information System (INIS)

    1988-07-01

    This annual report covers the research activities and technical developments of the Tandem Accelerator Center, University of Tsukuba, in the period from April, 1987 to March, 1988. In the field of nuclear physics, the elastic and inelastic scattering of polarized protons from even-even medium weight nuclei was investigated systematically by light ion beam experiment. A QDQ type magnetic spectrograph for double scattering experiment was almost complete. The studies on heavy ion-induced fission reaction advanced by measuring anisotropy in fission angular distribution, and a view on the mechanism of the reaction was acquired. A new, ingenious technique enabled to identify prompt characteristics X-ray accompanying the fusion reaction induced by heavy ions. In the field of atomic and solid state physics, a strange dependence of equilibrium charge state on the atomic number of projectile heavy ions has been elucidated. The research on ion beam shadowing effect on the emission of ion-induced secondary electrons was continued. The Rutherford backscattering of O 4+ ions was applied to determine the composition of Y-Ba-Cu oxide film, and it shed light on the condition governing the nature of superconductive materials. The 12 UD Pelletron was operated quite satisfactorily. (Kako, I.)

  19. Annual report of the Tandem Accelerator Center, Nuclear and Solid State Research Project, University of Tsukuba

    International Nuclear Information System (INIS)

    1980-01-01

    This is the fifth annual report of the Tandem Accelerator Center, as well as the third of the Nuclear and Solid State Research Project at the University of Tsukuba. It contains the short descriptions of the activities during the period from April, 1979, to March, 1980. The 12 UD Pelletron has worked well and was utilized over 2900 hours as the time of beam on targets. The performance of the polarized ion source has been quite good, and it produced the beams of polarized protons and deuterons as well as of alpha particles. The sputter ion source (TUNIS) replaced the direct extraction duoplasmatron in most cases, and it produced the beams of isotopes of O, F, Si, Cl, Ni, Cu, etc., without gas injection. The construction of the second measuring room has been completed, and four beam courses are equipped with a general purpose scattering chamber, the devices for perturbed angular correlation, inner and outer shell ionization, and biological studies. The beam pulsing system was installed on the accelerator, and will be in operation soon. Further efforts have been made to develop detection and data processing systems. The examples of the recent researches mainly under the program of the NSSRP in various fields are enumerated. The exchange and collaboration with other institutions were active. (Kako, I.)

  20. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1993 - March 31, 1994

    International Nuclear Information System (INIS)

    1994-07-01

    In this annual report, the research activities and the technical developments carried out at the Tandem Accelerator Center, University of Tsukuba, for the period from April, 1993 to March, 1994 are described. The tandem accelerator worked with high stability, and provided with sufficient beam time for experiments till the middle of November, however, one of the charging chains broke on November 18. The replacement of the chain was finished in a short time, and experiments were continued to the end of December. From January, 1994, the operation of the accelerator was shut down to replace the cooling towers for building air conditioning and to reconstruct the cooling system for the accelerator. In this book, the activities in the accelerator and experimental facilities and the departments of the experiment and theory on nuclear physics, atomic and solid state physics, and ion beam application are reported. As the new development of experimental instruments, a new rf amplifier for the heavy ion postaccelerator was constructed, and with a liquid helium polarimeter, test experiments are in progress. (K.I.)

  1. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1996 - March 31, 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    The 12 UD Pelletron tandem accelerator has been operated successfully from April, 1996 to January, 1997. Although the operation of the accelerator became unstable in the middle of January, it was a short period. The research in the Tandem Accelerator Center covers wide fields, that is, polarization phenomena in nuclear reactions, the nonresonant breakup of Li-7, the further refinement of the CDCC theory, fusion and fission in heavy ion reactions, nuclear structure physics by means of in-beam {gamma} ray spectroscopy, solid state physics using fast ion bemas, Moessbauer effect, NMR, the application of accelerated ion beams to PIXE, and accelerator mass spectrometry. In addition, two major installations were carried out in this academic year. One is a small tandem accelerator which was moved from Electrotechnical Laboratory in Tsukuba, and the other is a system for the production and analysis of atomic clusters. The research activities at the accelerator and experimental facilities and on experimental nuclear physics, theoretical nuclear physics, atomic and solid state physics, cluster science, and ion beam application are reported in this book. Also the list of the publications by these groups is given. Ph. D. and M. Sc. theses are listed, and the speakers and the titles of seminars are reported. (K.I.)

  2. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1996 - March 31, 1997

    International Nuclear Information System (INIS)

    1997-06-01

    The 12 UD Pelletron tandem accelerator has been operated successfully from April, 1996 to January, 1997. Although the operation of the accelerator became unstable in the middle of January, it was a short period. The research in the Tandem Accelerator Center covers wide fields, that is, polarization phenomena in nuclear reactions, the nonresonant breakup of Li-7, the further refinement of the CDCC theory, fusion and fission in heavy ion reactions, nuclear structure physics by means of in-beam γ ray spectroscopy, solid state physics using fast ion bemas, Moessbauer effect, NMR, the application of accelerated ion beams to PIXE, and accelerator mass spectrometry. In addition, two major installations were carried out in this academic year. One is a small tandem accelerator which was moved from Electrotechnical Laboratory in Tsukuba, and the other is a system for the production and analysis of atomic clusters. The research activities at the accelerator and experimental facilities and on experimental nuclear physics, theoretical nuclear physics, atomic and solid state physics, cluster science, and ion beam application are reported in this book. Also the list of the publications by these groups is given. Ph. D. and M. Sc. theses are listed, and the speakers and the titles of seminars are reported. (K.I.)

  3. Relative biological effectiveness of the therapeutic proton beams at NIRS and Tsukuba University

    International Nuclear Information System (INIS)

    Ando, Koichi; Koike, Sachiko; Kawachi, Kiyomitsu

    1985-01-01

    Relative biological effectiveness (RBE) of proton beams dedicated to radiotherapy was examined using a method of simultaneous irradiation. Mice received i.v. transplantation of syngeneic fibrosarcoma (NFSa) cells. These mice were divided into 3 groups on the following day, and thorax was simultaneously irradiated with one of the following beams: 70MeV proton beam at National Institute of Radiological Sciences (NIRS), 250 MeV Proton beam at Tsukuba University (PARMS) and 60 Co γ ray. Ten to 13 days thereafter, lungs were removed for colony counts to give dose-cell survival relationships. RBE of NIRS proton was ranging from 1.01 to 1.12 with an average of 1.06 while that of PARMS proton was ranging from 1.03 to 1.09 with an average of 1.06 at surviving fraction of 0.01. The simultaneous irradiation for RBE study was found to be reliable at large dose-low survival regions. (author)

  4. Observation of stratospheric ozone with NIES lidar system in Tsukuba, Japan

    International Nuclear Information System (INIS)

    Nakane, H.; Hayashida, S.; Sasano, Y.; Sugimoto, N.; Matsui, I.; Minato, A.

    1992-01-01

    Lidars are expected to play important roles in an international monitoring network of the stratosphere such as the Network for the Detection of Stratospheric Change (NDSC). The National Institute for Environmental Studies (NIES) in Tsukuba constructed an ozone lidar system in March 1988 and started observation in August 1988. The lidar system has a 2-m telescope and injection locked XeCl and XeF excimer lasers which can measure ozone profiles (15-45 km) and temperature profiles (30-80 km). From December 1991, lidar observations have been carried out in which the second Stokes line of the stimulated Raman scattering of a KrF laser has been used. Ozone profiles obtained with the NIES lidar system are compared with the data provided by the SAGE II satellite sensor. Results showed good agreement for the individual and the zonal mean profiles. Variations of ozone with various time scales at each altitude can be studied using the data obtained with the NIES ozone lidar system. Seasonal variations are easily found at 20 km, 30 km, and 35 km, which are qualitatively understood as a result of dynamical and photochemical effects. Systematic errors of ozone profiles due to the Pinatubo stratospheric aerosols have been detected using multi-wavelength observation

  5. Development of a NIM module for time-to-digital conversion

    International Nuclear Information System (INIS)

    Lin Yanchang; Wang Xiaobin; Chen Shaomin; Gao Yuanning; Jiang Chunhua; Qian Wenbin

    2008-01-01

    A developed single slot wide NIM module for time-to-digital conversion (TDC) is presented in this paper. This TDC module consists of a CPLD based double edge trigger counter with logic function circuit, a high speed comparator based NIM-to-TTL logic level converter, a processor ARM based data access and communication control unit, and voltage regulators for power supply. There are two input groups available, separately for accepting start and stop signal between two input ports or just from the same input port in sequence. With a 50 MHz reference clock, the available input ranges from 0 to 81.91 μs, and the resolution can reach 10 ns level. This module was tested in a muon lifetime measurement experiment, showing good linearity, simple configuration, low power consumption, good reliability, low cost, and easy upgrade as well. (authors)

  6. Research on the effect of the external magnetic field in the joule balance at NIM

    Science.gov (United States)

    Xu, Jinxin; You, Qiang; Li, Zhengkun; Bai, Yang; Lu, Yunfeng; Zhang, Zhonghua; He, Qing

    2018-06-01

    The first determination of the Planck constant with the second generation of the joule balance, NIM-2, was completed in 2017 with an uncertainty of 2.4  ×  10‑7. Due to the movement of the magnet during the measurement process, the effect of the external field is a critical problem in NIM-2. At present, the electromagnet system is used in NIM-2. By taking the average of the results with positive and negative exciting currents, the uncertainty from the external field is reduced to 1.7  ×  10‑7, which is still the largest source in the uncertainty budget as all the other items are less than 1  ×  10‑7. In the near future, a permanent magnet system will be applied in NIM-2 and the main field cannot be reversed. Although the coupling of the external magnetic field in the permanent magnet system is about 40 times less than that in the electromagnet system, further reduction of this effect is still required in the permanent magnet system. In this paper, the effect of the external field is analyzed in both an electromagnet system and a permanent magnet system based on simulations and experiments. Then, the methods of magnetic shielding and compensation coils are proposed and simulated in the permanent magnet system. The results show that it may be possible to reduce the uncertainty of the external field to less than 2  ×  10‑8 in the permanent magnet system by employing the two methods.

  7. The Network Information Management System (NIMS) in the Deep Space Network

    Science.gov (United States)

    Wales, K. J.

    1983-01-01

    In an effort to better manage enormous amounts of administrative, engineering, and management data that is distributed worldwide, a study was conducted which identified the need for a network support system. The Network Information Management System (NIMS) will provide the Deep Space Network with the tools to provide an easily accessible source of valid information to support management activities and provide a more cost-effective method of acquiring, maintaining, and retrieval data.

  8. Nuclear Instrumentation Module (NIM) standard logic processor as a portal signal analyzer

    International Nuclear Information System (INIS)

    Minges, G.P.

    1978-01-01

    A general purpose electronic logic processor has been designed into a 2 wide NIM (Nuclear Instrumentation Module) bin module. The unit utilizes a microprocessor to achieve necessary versatility. The processor's first use is as a new generation signal analyzer for use in radiometric personnel and vehicle portal monitors. Significant improvements have been obtained in sensitivity and stability over existing analog discriminators. The new analyzer is presently being used to update personnel and vehicle portal monitoring systems

  9. 26Al and 36Cl AMS system at University of Tsukuba: A progress report

    International Nuclear Information System (INIS)

    Sasa, Kimikazu; Nagashima, Yasuo; Takahashi, Tsutomu; Seki, Riki; Tosaki, Yuki; Sueki, Keisuke; Bessho, Kotaro; Matsumura, Hiroshi; Miura, Taichi; He, Ming

    2007-01-01

    With the current AMS system on the 12UD Pelletron tandem accelerator at University of Tsukuba, we are able to measure the long-lived radioisotopes of 14 C, 26 Al, 36 Cl and 129 I by employing a molecular pilot beam method that stabilizes the terminal voltage with 0.1% accuracy. Several major improvements have been made to increase the sensitivity of the AMS system to 26 Al and 36 Cl radioisotopes. For 26 Al-AMS, the ions extracted from the ion source have been changed from Al - to AlO - by using an Al 2 O 3 target sample. In addition, 26 MgO - molecular ions are used as a pilot beam to control the terminal voltage through slit current feedback. Also, a fully-stripping AMS technique is used to achieve an effective detection limit of better than 5 x 10 -15 for the 26 Al/ 27 Al ratio. For 36 Cl-AMS, the terminal voltage has been increased from 9 MV to 10 MV, thereby increasing the energy of the 36 Cl 9+ beam to 100 MeV. This energy increment helps us to get a clearer separation between 36 Cl and 36 S in a new ΔE-E detector. In addition, the yield of 36 Cl 9+ is increased by 1.5 times as a result of the higher ion energy at the terminal stripper foil. The standard deviation of the fluctuations of the 36 Cl/ 35 Cl ratio is within ±2%, and the effective detection limit is better than 2.0 x 10 -14

  10. Effects of aging and uninephrectomy on renal changes in Tsukuba hypertensive mice.

    Science.gov (United States)

    Inui, Yosuke; Mochida, Hideki; Yamairi, Fumiko; Okada, Miyoko; Ishida, Junji; Fukamizu, Akiyoshi; Arakawa, Kenji

    2013-05-01

    Renal dysfunction is accelerated by various factors such as hypertension, aging and diabetes. Glomerular hyper-filtration, considered one of the major risk factors leading to diabetic nephropathy, is often encountered in diabetic patients. However, the interrelationship of these risk factors during the course and development of renal dysfunction has not been fully elucidated. In this study, the effects of aging and uninephrectomy (UNx)-induced hyperfiltration on renal changes were investigated in Tsukuba hypertensive mice (THM) carrying both human renin and angiotensinogen genes. In THM, the urinary albumin/creatinine (Alb/Cr) ratio was elevated with age without a concomitant increase in the plasma Cr concentration. Moreover, the urinary neutrophil gelatinase-associated lipocalin/Cr (NGAL/Cr) ratio, the renal monocyte chemoattractant protein-1 (MCP-1) mRNA expression and the renal collagen type I α 2 (COL1A2) mRNA expression were also increased with age. Age-related albuminuria in THM is likely caused by renal tubular damage, enhanced inflammatory response and tubulointerstitial fibrosis. Furthermore, following UNx, the urinary Alb/Cr ratio and the plasma Cr concentration were increased in THM. The urinary NGAL/Cr ratio and the renal MCP-1 and COL1A2 mRNA expression were not affected by UNx. These results suggested that UNx-induced albuminuria in THM was caused by glomerular dysfunction, rather than renal tubular injury. In conclusion, this study demonstrated for the first time the effects of aging and UNx on renal changes in THM. These findings strongly reinforce the significance of applying a diversity of therapeutic approaches to the management of renal dysfunction.

  11. Extrato aquoso de sementes de nim no controle de Liriomyza sativae (Diptera: Agromyzidae em meloeiro

    Directory of Open Access Journals (Sweden)

    Ewerton Marinho Costa

    2016-06-01

    Full Text Available RESUMO O controle da mosca minadora é imprescindível nas áreas de produção de melão dos estados do Rio Grande do Norte e Ceará. Portanto, o objetivo do trabalho foi avaliar o efeito de diferentes concentrações do extrato aquoso de sementes de nim (Azadirachta indica sobre a mosca minadora (Liriomyza sativae. O experimento foi conduzido em delineamento inteiramente casualizado, constituído por sete tratamentos: Testemunha absoluta (água destilada, testemunha positiva (inseticida Vertimec® 18 CE - Abamectina e cinco concentrações do extrato aquoso de sementes de nim (1; 5; 10; 15 e 20 g 100 mL-1 de água destilada, com 10 repetições (plantas de meloeiro. Os tratamentos foram aplicados via pulverização, com auxílio de um pulverizador manual. As avaliações foram divididas em duas etapas, na primeira, registrou-se a mortalidade larval e, na segunda, a mortalidade pupal, em cada um dos tratamentos. Foi verificado que houve aumento da mortalidade larval e pupal de L. sativaecom o aumento da concentração do extrato aquoso de sementes de nim. As concentrações de 15 e 20 g 100 mL-1 do extrato ocasionaram mortalidade larval de 91 e 91,8% com eficiência de controle de 89,7 e 90,6%, respectivamente. Todas as concentrações avaliadas ocasionaram significativa mortalidade pupal das larvas que sobreviveram, destacando-se as concentrações de 5; 10; 15 e 20 g 100 mL-1 com 99,4; 100; 100 e 100% de mortalidade, respectivamente.

  12. Tandem Accelerator Center, University of Tsukuba, annual report 1998. April 1, 1998 - March 31, 1999

    International Nuclear Information System (INIS)

    1999-07-01

    The operation of the 12 UD Pelletron tandem accelerators was very stable until December 12, 1998. A total beam time for experiments is 2383 hours. This report describes the activities at Tandem Accelerator Center of the University of Tsukuba in fiscal year 1998. The 32 reports are presented in the 4 categories; that are (1) Accelerator and Experimental Facilities (7 reports), (2) Nuclear Physics (12 reports), (3) Atomic and Solid State Physics, and Cluster Science (10 reports), (4) Ion Beam Application (3 reports). New development of experimental instruments were made on a proton polarimeter at very low energies, a detector of atomic cluster at low velocity, a long focal-plane position sensitive detector, and a liquid-helium-free superconducting solenoid for an Ecr ion source. In the field of nuclear physics, progresses were made in proton total-reaction cross sections, the continuum discretized coupled channel (CDCC) theory, (d, αX) reactions, 7 Li breakup reactions, hole states via (p, d) reaction, and nuclear structure physics by means of in-beam γ ray spectroscopy. New approaches were initiated on the precise measurement of proton-proton elastic scattering to search for magnetic monopole, and on perturbed angular correlations to measure nuclear g-factors in the pico second region. The investigation of ion-induced secondary electron is made in the binary-encounter electron emission from crystalline and non crystalline targets. An applicability of ion-induced Auger electrons to structure analysis was also demonstrated. An experiments of Br and I ions opened a new approach to the study of structural defects in amorphous silica. The study of deuteron implantation into silicon single crystal resulted in an interpretation of macroscopic migration. Microscopic migration was investigated on some metals. In atomic cluster physics, angular distributions of several noble-gas ions were measured to derive a new interaction potential. Mass spectra of semiconductor and 3d

  13. Jaume Gil, orguener valencià del temps del Magnànim.

    OpenAIRE

    Cortés Escrivà, Josepa

    1985-01-01

    Peripècia vital i professional de Jaume Gil (+València 1444), constructor d’orgues, que treballà en diverses ocasions per al rei Alfons el Magnànim fabricant alguns orgues destinats a la capella reial. S’inclou, així mateix, edició de l’inventari post mortem dels seus béns, entre ells alguns instruments musicals i vuit llibres de gramàtica, i les eines del seu ofici. Vital and professional vicissitudes of Jaume Gil (+Valencia 1444), organs builder, which worked on several occasions to King...

  14. Bilateral Comparison Between NIM and NMC Over the Temperature Range from 83.8058 K to 692.677 K

    Science.gov (United States)

    Sun, Jianping; Ye, Shaochun; Kho, Haoyuan; Zhang, Jintao; Wang, Li

    2015-08-01

    A bilateral comparison of local realization of the International Temperature Scale of 1990 between the National Institute of Metrology (NIM) and National Metrology Centre (NMC) was carried out over the temperature range from 83.8058 K to 692.677 K. It involved six fixed points including the argon triple point, the mercury triple point, the triple point of water, the melting point of gallium, the freezing point of tin, and the freezing point of zinc. In 2009, NMC asked NIM to participate in a bilateral comparison to link the NMC results to the Consultative Committee for Thermometry Key Comparison 3 (CCT-K3) and facilitate the NMC's calibration and measurement capabilities submission. This comparison was agreed by NIM and Asia Pacific Metrology Programme in 2009, and registered in the Key Comparison Database in 2010 as CCT-K3.2. NMC supplied two fused silica sheath standard platinum resistance thermometers (SPRTs) as traveling standards. One of them was used at the Ga, Sn, and Zn fixed points, while the other one was used at the Ar and Hg fixed points. NMC measured them before and after NIM measured them. During the comparison, a criterion for the SPRT was set as the stability at the triple point of water to be less than 0.3 mK. The results for both laboratories are summarized. A proposal for linking the NMC's comparison results to CCT-K3 is presented. The difference between NMC and NIM and the difference between NMC and the CCT-K3 average reference value using NIM as a link are reported with expanded uncertainties at each measured fixed point.

  15. First report of metronidazole resistant, nimD-positive, Bacteroides stercoris isolated from an abdominal abscess in a 70-year-old woman

    DEFF Research Database (Denmark)

    Otte, Erik; Nielsen, Hans Linde; Hasman, Henrik

    2017-01-01

    We here present the first case of a metronidazole resistant nimD positive Bacteroides stercoris. The isolate originated from a polymicrobial intra-abdominal abscess in a 70-year-old woman. The nimD gene was detected by use of whole-genome shotgun sequencing and the subsequent use of the ResFinder 2...

  16. Development of calibration facility for radon and its progenies at NIM (China)

    International Nuclear Information System (INIS)

    Liang, J.C.; Liu, H.R.; Zhang, M.; Zheng, P.H.; Guo, Q.J.; Yang, Z.J.; Li, Z.S.; Zhang, L.

    2015-01-01

    Accurate measurement of radon and its progenies is the basis to control the radon dose and reduce the risk of lung cancer caused. The precise calibration of measuring instrument is an important part of the quality control of measurements of the concentration of radon and radon progenies. To establish Chinese national standards and realise reliable calibrations of measuring instrument for radon and its progenies, a radon chamber with regulation capability of environmental parameters, aerosol and radon concentrations was designed and constructed at National Institute of Metrology (NIM). The chamber has a total volume of ∼20 m 3 including an exposure volume of 12.44 m 3 . The radon concentration can be controlled from 12 Bq m -3 to the maximum of 232 kBq m -3 . The regulation range of temperature, relative humidity and aerosol are 0.66-44.39 deg. C, 16.4-95 %RH and 10 2 -10 6 cm -3 , respectively. The main advantages of the NIM radon chamber with respect to maintaining a stable concentration and equilibrium factor of radon progenies in a wide range through automatic regulation and control of radon and aerosol are described. (authors)

  17. PENGARUH RASIO CAR, NPL, LDR, BOPO, DAN NIM TERHADAP KINERJA BANK UMUM DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Dwi Priyanto Agung Raharjo

    2015-10-01

    Full Text Available This research is performed on order to test the influence of the variable Capital Adequacy Ratio (CAR, Non Performing Loan (NPL, Loan to Deposit Ratio (LDR, BOPO (Operating Expenses / Operating Income, and Net Interest Margin (NIM, to return on Asset (ROA. The sample used in the study were 120 bank in Indonesia in 2010 and 2011. The data analysis technique used is multiple linear regression, t-statistic and F-statistics test with a significance level of 5%. During research period show as variable and data research was normal distributed. Based on test, multicolinearity, heterosscedasticity and autocorrelation classic assumption deviation has no founded, this indicate that the available data has fulfill the condition to use multi linear regression model. This result of research show that variable CAR, NIM, and LDR positive significant influence toward ROA. Variable NPL and BOPO negative significant influence toward ROA. Prediction capability from these seven variable toward ROA is 78,7 % where the balance 21,3% is affected to other factor which was not to be entered to research model.

  18. Designing a power supply for Nim-bin formatted equipment; Diseno de una fuente de alimentacion para equipos con formato Nim-bin

    Energy Technology Data Exchange (ETDEWEB)

    Banuelos G, L. E.; Hernandez D, V. M.; Vega C, H. R., E-mail: lebluis2012@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98060 Zacatecas, Zac. (Mexico)

    2016-09-15

    From an old Nuclear Chicago power supply that was practically in the trash, was able to recover the 19 inches casing, rear connectors and the housing where the circuits were. From here all mechanical parts were cleaned and the electronic design was started to replace the original voltage and current functions of this equipment. The cards for the ±6, ±12 and ±24 voltages were designed, simulated and tested with circuitry that does not rely on specialized components or that is sold only by the equipment manufacturer. In the handling of the current by each voltage to operate, was possible to tie with the specifications of the manufacturers like Ortec or Canberra where a model of power supply gives a power of 160 Watts. Basic tests were performed to show that the behavior is very similar to commercial equipment; such as the full load regulation index and the noise level in the supply voltages. So our Nim-bin voltage source is viable for use in our institution laboratories. (Author)

  19. New Style of Volcanic Eruption Activity Identified in Galileo NIMS data at Marduk Fluctus, Io

    Science.gov (United States)

    Davies, A. G.; Davies, R. L.; Veeder, G. J.; de Kleer, K.; De Pater, I.; Matson, D.

    2017-12-01

    Analysis of observations of Marduk Fluctus, Io, by the Galileo Near Infrared Mapping Spectrometer (NIMS) reveals a style of volcanic activity not previously seen on Io - a very short-duration, highly-changeable, powerful thermal event, similar to what might be expected from a strombolian-like explosion. Marduk Fluctus is a persistent active volcano characterised by ≈3600 km2 of silicate flows [1]. Between 1996 and 2001, NIMS obtained 44 observations of Marduk Fluctus at a wide variety of spatial and spectral resolutions. Six observations were obtained during Galileo orbit E4, with five nighttime observations obtained on 1996 Dec 19 in the space of less than three hours. Three of these observations were each separated by one minute. Compared to the previous observation obtained a few hours earlier, the first two of these three observations show an order of magnitude increase in spectral radiance (corrected for emission angle). Spectral radiance then dropped back to the background level one minute later. The emission angles for these five E4 observations are large (>70°), but even without the emission angle radiance correction the spike in activity is still a factor of five larger than the pre- and post-spike radiances. The NIMS spectrum of the central observation shows a shift in peak of thermal emission to short wavelengths characteristic of the exposure of a large area of incandescent lava. The rapid increase and decrease in activity suggests an equally rapid physical process, the most likely being a large strombolian explosion that generated small clasts that cooled rapidly. The presence of such events provide an additional volcanic process that can be imaged with the intent of determining lava composition from eruption temperature, an important constraint on internal composition and state. For this particular eruption type, eruption temperature can be constrained if non-saturated, multiple-wavelength IR observations are obtained simultaneously and with very

  20. Raman lidar measurement of water vapor and ice clouds associated with Asian dust layer over Tsukuba, Japan

    Science.gov (United States)

    Sakai, Tetsu; Nagai, Tomohiro; Nakazato, Masahisa; Matsumura, Takatsugu

    2004-03-01

    The vertical distributions of particle extinction, backscattering, depolarization, and water vapor mixing ratio were measured using a Raman lidar over Tsukuba (36.1°N, 140.1°E), Japan, on 23-24 April 2001. Ice clouds associated with the Asian dust layer were observed at an altitude of ~6-9 km. The relative humidities in the cloud layer were close to the ice saturation values and the temperature at the top of the cloud layer was ~-35°C, suggesting that the Asian dust acted as ice nuclei at the high temperatures. The meteorological analysis suggested that the ice-saturated region was formed near the top of the dust layer where the moist air ascended in slantwise fashion above the cold-frontal zone associated with extratropical cyclone.

  1. Galileo PPR at Io: High Resolution Scans Taken in Conjunction with SSA and NIMS Data

    Science.gov (United States)

    Rathbun, J. A.; Spencer, J. R.; Tamppari, L. K.; Martin, T. Z.; Barnard, L.; Travis, L. D.

    2003-01-01

    The Galileo Photopolarimeter-Radiometer (PPR), when used in the radiometry mode which is most often used at Io, is a long-wavelength infrared single-aperture photometer. It is sensitive to temperatures from about 60 to several hundred K, and is thus useful for studying the volcanoes and background temperatures on Io. PPR can take raster scan images when it is the primary instrument being used (these data were discussed last year, see Rathbun et al., 2002). It can also take data in ride-along mode in conjunction with another remote sensing instrument (either SSI or NIMS) producing one-dimensional temperature scans. The best data of this type were taken during the close approach flybys during orbits I24, I25, I27, I31, I32, and I33 and include measurements of the volcanoes Pele, Prometheus, Pillan, Zamama, Tvashtar, Daedalus, Amarani, Gish Bar, Isum, Emakong, Tupan, and Tohil.

  2. Use of nanostructure initiator mass spectrometry (NIMS to deduce selectivity of reaction in glycoside hydrolases

    Directory of Open Access Journals (Sweden)

    Kai eDeng

    2015-10-01

    Full Text Available Chemically synthesized nanostructure-initiator mass spectrometry (NIMS probes derivatized with tetrasaccharides were used to study the reactivity of representative Clostridium thermocellum β-glucosidase, endoglucanases and cellobiohydrolase. Diagnostic patterns for reactions of these different classes of enzymes were observed. Results show sequential removal of glucose by the β-glucosidase and a progressive increase in specificity of reaction from endoglucanases to cellobiohydrolase. Time-dependent reactions of these polysaccharide-selective enzymes were modeled by numerical integration, which provides a quantitative basis to make functional distinctions among a continuum of naturally evolved catalytic properties. Consequently, our method, which combines automated protein translation with high-sensitivity and time-dependent detection of multiple products, provides a new approach to annotate glycoside hydrolase phylogenetic trees with functional measurements.

  3. Low power CAMAC and NIM modular systems for spaceflight use on Shuttle and Spacelab missions

    Energy Technology Data Exchange (ETDEWEB)

    Trainor, J.H.; Kaminski, T.J.; Ehrmann, C.H.

    1977-02-01

    The advent of the Shuttle launch vehicle and Spacelab have resulted in adequate weight and volume such that experiment electronics can be implemented at relatively low cost using spaceflight versions of CAMAC and NIM modules. Studies of 10 modules by manufacturers have shown that power reduction overall by a factor of approximately 3 can be accomplished. This is adequate both from the point of view of consumption and temperature rise in vacuum. Our studies have shown that a stock of approximately 45 module types is required and a listing is given. The changes required in these modules in order to produce spaceflight versions are described. And finally, the further studies, prototyping and testing leading to eventual flight qualification are described.

  4. Duhovnost kao resurs snage i otpornosti obitelji u rizičnim okolnostima

    OpenAIRE

    Leutar, Ivan; Leutar, Zdravka

    2017-01-01

    Duhovnost se može shvatiti kao ljudsku potrebu za pronalaženjem krajnjeg smisla i svrhe u životu te želju da se živi integriranim životom. Istraživanja su pokazala da religiozne obitelji, u odnosu na one koje to nisu, za vrijeme trajanja nesigurnosti, neizvjesnosti i stresa imaju veću razinu vjere i nade u dobar ishod, njihovi članovi rjeđe izražavaju određene sociopatološke pojave. Cilj je rada dobiti uvid kako sudionici doživljavaju duhovnost u suočavanju s rizičnim okolnostima u obitelji, ...

  5. Report on NIM-NMC bilateral comparison: SPRT calibration comparison from -190°C to 420°C

    Science.gov (United States)

    Sun, Jianping; Ye, Shaochun; Wang, Li; Zhang, Jintao; Kho, Haoyuan

    2016-01-01

    A bilateral comparison of local realization of the International temperature scale of 1990 (ITS-90) between National Institute of Metrology (NIM) and National Metrology Centre (NMC) was carried out over the temperature range from -190°C to 420°C. It involved six fixed points including the argon triple point, the mercury triple point, the triple point of water, the melting point of gallium, the freezing point of tin and the freezing point of zinc. In 2009, NMC asked NIM to participate in a bilateral comparison to link the NMC results to the Consultative Committee for Thermometry Key comparison 3 (CCT-K3) and facilitate the NMC's Calibration and measurement capabilities (CMCs) submission. This comparison was agreed by NIM and Asia Pacific Metrology Programme (APMP) in 2009, and registered in the Key Comparison Database (KCDB) in 2010 as CCT-K3.2. NMC supplied two 25 Ω fused silica sheath standard platinum resistance thermometers (SPRTs) as traveling standards. One of them was used at the Ga, Sn and Zn fixed points, while the other one was used at the Ar and Hg fixed point. NMC measured them before and after NIM measurement. During the comparison, a criterion for the SPRT was set as the stability at the triple point of water to be less than 0.3 mK. The results for both laboratories are summarized. A proposal for linking the NMC's comparison results to CCT-K3 is presented. The difference between NMC and NIM and the difference between NMC and the CCT-K3 Average Reference Value (ARV) using NIM as a link are reported with expanded uncertainties at each measured fixed point. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  6. Who Leads Advocacy through Social Media in Japan? Evidence from the “Tsukuba Civic Activities Cyber-Square” Facebook Page

    Directory of Open Access Journals (Sweden)

    Sae Okura

    2016-11-01

    Full Text Available Although the importance of advocacy activities by civil society organizations (CSOs in policy and decision-making procedures has been greatly emphasized in the literature of political science and social policy, we have relatively little understanding of the relevance and impact of the leading actors who structure the diverse networks and discourses through social media; further recognition is needed in both fields. The purpose of this study is to analyze civil society organizations at the local government level involved in advocacy activities through the use of social media such as Facebook and Twitter. Our study focuses on a specific Japanese Facebook community page—the “Tsukuba Civic Activities Cyber-Square”—aimed at enhancing civil society activities in Japan. This page is operated by the municipal government of Tsukuba, in collaboration with the University of Tsukuba and Intel Corporation. Our findings indicate that social networking services such as Facebook can provide civil society organizations with: (1 more political opportunities to advocate; (2 more chances to connect with the local government; and (3 create opportunities to exert greater presence, despite their limited financial and political resources.

  7. A noise thermometry investigation of the melting point of gallium at the NIM

    Science.gov (United States)

    Zhang, J. T.; Xue, S.

    2006-06-01

    This paper describes a study of the melting point of gallium with the new NIM Johnson noise thermometer (JNT). The new thermometer adopts the structure of switching correlator and commutator with the reference resistor maintained at the triple point of water. The electronic system of the new thermometer is basically the same as the current JNT, but the preamplifiers have been improved slightly. This study demonstrates that examining the characteristics of the noise signals in the frequency domain is of critical importance in constructing an improved new thermometer, where a power spectral analysis is found to be critical in establishing appropriate grounding for the new thermometer. The new JNT is tested on measurements of the thermodynamic temperature of the melting point of gallium, which give the thermodynamic temperature of 302.9160 K, with an overall integration time of 190 h and a combined standard uncertainty of 9.4 mK. The uncertainty analysis indicates that a standard combined uncertainty of 3 mK could be achieved with the new thermometer over an integration period of 1750 h.

  8. Development of 1 MW gyrotron and progress of ECH system for the GAMMA 10 tandem mirror in Tsukuba

    International Nuclear Information System (INIS)

    Imai, T.; Kariya, T.; Minami, R.; Shidara, H.; Endo, Y.; Harigae, M.; Nakamura, M.; Sakagoshi, Y.; Murofushi, N.; Ichimura, M.; Nakashima, Y.; Yoshikawa, M.; Yamaguchi, Y.; Sakamoto, Keishi; Kubo, S.; Shimozuma, T.; Mutoh, T.; Takahashi, H.; Mitsunaka, Y.

    2008-10-01

    High power gyrotrons with TE 4,2 cavity at 28 GHz and with TE 18,6 cavity and a diamond window at 77 GHz have been developed for GAMMA 10 and LHD in the joint program of NIFS and University of Tsukuba. The maximum outputs of 570 kW at 28 GHz and 1.1 MW at 77 GHz were obtained corresponding to each design. The operations of more than 750 kW for 5 sec. and 810 kW for 3.5 sec. were achieved in the developing tubes at 77 GHz, which is the first high power-long pulse result of the 77 GHz tube. The experimental simulation of the effect of the stray RF in the 28 GHz tube indicates the stray RF is the one of the major causes limiting gyrotron performance. The output of more than 1 MW with 40% oscillation efficiency is expected from the design of the next 28 GHz gyrotron for GAMMA 10. Installation of the polarizer in the transmission line enhanced the performance of the ECH system in GAMMA 10, that is the first result which clearly showed ∼100% X mode excitation is a key to design the efficient fundamental ECH system of strong field side injection in mirror devices. (author)

  9. Rendimento e Características Físicas dos Óleos de Nim (Azadirachta indica e Mamona (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    Full Text Available A pesquisa objetivou avaliar o rendimento e a viscosidade de óleos de nim (Azadirachta indica e mamona (Ricinus communis. Os frutos de nim foram coletados no Núcleo de Pesquisa do Semiárido, em Patos, Paraíba, e os de mamona, às margens do Rio Espinharas, Patos e em Igaracy, Paraíba. Os frutos foram beneficiados no Laboratório de Tecnologia de Produtos Florestais, em Patos. Foram retiradas amostras de sementes para a determinação do teor de umidade e do rendimento em óleos. Os óleos foram extraídos com álcool etílico absoluto e empregados no preparo de soluções com os óleos de nim e mamona. Determinaram-se a densidade e a viscosidade das soluções. A mamona teve menor teor de umidade e rendimento em óleo que o nim. A densidade e a viscosidade do óleo de nim foram menores que o da mamona. Uma maior quantidade de óleos de mamona proporcionou aumento na densidade e na viscosidade das soluções preparadas.

  10. Balneoterapija/hidroterapija u bolesnika s reumatoidnim artritisom, ankilozantnim spondilitisom i psorijatičnim artritisom – deskriptivni pregled

    OpenAIRE

    GRAZIO, Simeon; DOKO, Ines

    2014-01-01

    Balneoterapija/hidroterapija neizostavni je dio rehabilitacije bolesnika s upalnim reumatskim bolestima. Kako se njena učinkovitost često dovodi u pitanje, cilj ovog rada je bio pretražiti literaturu koja govori o učinkovitosti balneoterapije/hidroterapije kod reumatoidnog artritisa, ankilozantnog spondilitisa i psorijatičnog artritisa. Računalnim putem pretražene su najpoznatije baze stručnih časopisa iz područja biomedicine (PubMed, Scopus, Ovid) u razdoblju od 1993. do 2013. s ključnim rij...

  11. The present status of medical application of particle accelerator. Started construction of a new medically dedicated proton accelerator facility in Tsukuba

    International Nuclear Information System (INIS)

    Sakae, Takeji; Maruhashi, Akira

    1999-01-01

    A new facility of PMRC starts the construction in the neighborhood of Tsukuba university hospital, in order to establish technical skill for practical use in the cancer treatment and to grope for new skill. The facility has a linac injection system, a compact synchrotron, two rotating gantry rooms and two fixed horizontal beam lines. The outline of the design arranged for the facility is reviewed. As one of the important technique for the treatment, investigation into target adjusting accuracy in respiration-gated proton irradiation is presented. (author)

  12. Approach to the open advanced facilities initiative for innovation (strategic use by industry) at the University of Tsukuba, Tandem Accelerator Complex

    International Nuclear Information System (INIS)

    Sasa, K.; Tagishi, Y.; Naramoto, H.; Kudo, H.; Kita, E.

    2010-01-01

    The University of Tsukuba, Tandem Accelerator Complex (UTTAC) possesses the 12UD Pelletron tandem accelerator and the 1 MV Tandetron accelerator for University's inter-department education research. We have actively advanced collaborative researches with other research institutes and industrial users. Since the Open Advanced Facilities Initiative for Innovation by the Ministry of Education, Culture, Sports, Science and Technology started in 2007, 12 industrial experiments have been carried out at the UTTAC. This report describes efforts by University's accelerator facility to get industrial users. (author)

  13. Efeito de produtos a base de óleo de nim em diferentes formulações no controle de Plutella xylostella (L.,1758) (Lepidoptera: Plutellidae), em couve

    OpenAIRE

    Mondego, Janaina Marques [UNESP

    2011-01-01

    Este trabalho teve por objetivo avaliar a eficiência de diferentes doses e formulações de óleo de nim, seu poder residual e a decomposição no armazenamento, visando o controle de Plutella xylostella (L.), em couve. Os experimentos foram conduzidos em laboratório, sob condições controlada de temperatura (25 ± 2°C) umidade relativa (70 ± 10%) e fotofase (12 horas). Foram utilizadas diferentes doses e formulações do produto a base de nim. As doses utilizadas para larvas de primeiro instar foram:...

  14. Primjena podvodne masaže zračnim mjehurićima kod oboljelih od multiple skleroze – opservacijska pilot-studija

    OpenAIRE

    RENDULIĆ SLIVAR, Senka; KRAML, Oto

    2010-01-01

    Podvodna masaža zračnim mjehurićima – biserna kupka, jedan je od oblika hidroterapije. Podatci iz nekih studija pokazuju da biserna kupka može dovesti do subjektivnog poboljšanja u aktivnostima svakodnevnog života. U radu je provedena usporedba primjene biserne kupke u bolesnika s multiplom sklerozom u specijalnoj bolnici za medicinsku rehabilitaciju i u kućnim uvjetima. U istraživanje je uključeno 15 ispitanika obaju spolova. Oni su prema uputama specijalista fizijatra tri tjedna svaki drugi...

  15. Characteristics of aerosol vertical profiles in Tsukuba, Japan, and their impacts on the evolution of the atmospheric boundary layer

    Science.gov (United States)

    Kudo, Rei; Aoyagi, Toshinori; Nishizawa, Tomoaki

    2018-05-01

    Vertical profiles of the aerosol physical and optical properties, with a focus on seasonal means and on transport events, were investigated in Tsukuba, Japan, by a synergistic remote sensing method that uses lidar and sky radiometer data. The retrieved aerosol vertical profiles of the springtime mean and five transport events were input to our developed one-dimensional atmospheric model, and the impacts of the aerosol vertical profiles on the evolution of the atmospheric boundary layer (ABL) were studied by numerical sensitivity experiments. The characteristics of the aerosol vertical profiles in Tsukuba are as follows: (1) the retrieval results in the spring showed that aerosol optical thickness at 532 nm in the free atmosphere (FA) was 0.13, greater than 0.08 in the ABL owing to the frequent occurrence of transported aerosols in the FA. In other seasons, optical thickness in the FA was almost the same as that in the ABL. (2) The aerosol optical and physical properties in the ABL showed a dependency on the extinction coefficient. With an increase in the extinction coefficient from 0.00 to 0.24 km-1, the Ångström exponent increased from 0.0 to 2.0, the single-scattering albedo increased from 0.87 to 0.99, and the asymmetry factor decreased from 0.75 to 0.50. (3) The large variability in the physical and optical properties of aerosols in the FA were attributed to transport events, during which the transported aerosols consisted of varying amounts of dust and smoke particles depending on where they originated (China, Mongolia, or Russia). The results of the numerical sensitivity experiments using the aerosol vertical profiles of the springtime mean and five transport events in the FA are as follows: (1) numerical sensitivity experiments based on simulations conducted with and without aerosols showed that aerosols caused the net downward radiation and the sensible and latent heat fluxes at the surface to decrease. The decrease in temperature in the ABL (-0.2 to -0

  16. Cyclosporine A, FK506, and NIM811 ameliorate prolonged CBF reduction and impaired neurovascular coupling after cortical spreading depression

    DEFF Research Database (Denmark)

    Hansen, Henning Piilgaard; Witgen, Brent Marvin; Rasmussen, Peter

    2011-01-01

    Cortical spreading depression (CSD) is associated with mitochondrial depolarization, increasing intracellular Ca(2+), and the release of free fatty acids, which favor opening of the mitochondrial permeability transition pore (mPTP) and activation of calcineurin (CaN). Here, we test the hypothesis...... and the specific CaN blocker FK506. Cortical spreading depression was induced in rat frontal cortex. Electrocortical activity was recorded by glass microelectrodes, CBF by laser Doppler flowmetry, and tissue oxygen tension with polarographic microelectrodes. Electrocortical activity, basal CBF, CMRO(2......), and neurovascular and neurometabolic coupling were unaffected by all three drugs under control conditions. NIM811 augmented the rise in CBF observed during CSD. Cyclosporine A and FK506 ameliorated the persistent decrease in CBF after CSD. All three drugs prevented disruption of neurovascular coupling after CSD...

  17. A Tale of Two Hot Spots: Charting Thermal Output Variations at Prometheus and Amirani from Galileo NIMS Data

    Science.gov (United States)

    Davies, A. G.

    2002-12-01

    Galileo Near Infrared Mapping Spectrometer (NIMS) data show that the active ionian volcanoes Prometheus and Amirani have significant thermal emission in excess of non-volcanic background emission in every geometrically appropriate NIMS observation. The 5 μm brightness of these volcanoes shows considerable variation from orbit to orbit. Like the flank eruptions on Kilauea, Hawai'i, which began in 1983, these ionian volcanoes exhibit periods of elevated activity. A study of the 5 μm thermal emission in all low-spatial resolution NIMS observations (both night and day-time) from June 1996 (Orbit G1) to May 2001 (Orbit C30) shows that the Prometheus thermal output (uncorrected for emission angle, e) ranges from 4 to 21 GW/μm, and Amirani shows greater variations, from 4 to 31 GW/μm. Correcting all thermal outputs for observations where estandard deviation of 7.3 GW/μm) and a larger average Amirani thermal output of 44 GW/μm (standard deviation of 26 GW/μm). Prometheus showed its greatest e-corrected thermal emission during November 1997 (33 GW/μm), more than four times that seen in June 1996 (orbit G1; see Davies et al., 2000, Icarus, 148, 212-225) and Amirani showed its greatest thermal emission during May 1997 (orbit G8), nearly 100 GW/μm, nearly five times that seen during orbit G1. Prometheus and Amirani spectra obtained at night show that the overall spectral shape of the thermal emission from 2 to 5 μm does not greatly change. The style of eruption is not resulting in disproportionately large areas at very high temperatures in relation to cooler crustal areas, such as seen at Pillan in 1997 and at Pele, indicating that the style of eruption is not changing, just the areal extent of activity. Scaling magma eruption rates derived from G1 NIMS data yields maximum and average volumetric eruption rates of 337 and 154 m3 s-1 for Amirani, and 128 and 52 m3 s-1 for Prometheus. The style and behavior of eruptions at Prometheus and Amirani are apparently very like

  18. Damage situation by the Great East Japan Earthquake and post-quake reconstruction project of the Tandem Accelerator Facility at the University of Tsukuba

    International Nuclear Information System (INIS)

    Sasa, Kimikazu

    2012-01-01

    The 12UD Pelletron tandem accelerator at the University of Tsukuba suffered serious damage from the Great East Japan Earthquake on 11 March 2011. On the day, the 12UD Pelletron tandem accelerator was in operation at 8 MV. The electricity supply went out during the earthquake. Fortunately, there were no causalties by the earthquake in the facility. However, all high voltage accelerating columns fell down in the accelerator tank. We decided to shut down the 12UD Pelletron tandem accelerator. At present, we have a plan to install a new middle-sized tandem accelerator instead of the broken 12UD Pelletron tandem accelerator at the 2nd target room connecting the beam line to existing facilities at the 1st target room. The construction of the new accelerator system will be completed by spring 2014. (author)

  19. Installation of high-resolution ERDA in UTTAC at the University of Tsukuba: Determination of the energy resolution and the detection limit for hydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Sekiba, D., E-mail: sekiba@tac.tsukuba.ac.jp [Institute of Applied Physics, University of Tsukuba, Tennodai 1-1-1, Tsukuba, Ibaraki 305-8573 (Japan); University of Tsukuba, Tandem Accelerator Complex (UTTAC), Tennodai 1-1-1, Tsukuba, Ibaraki 305-8577 (Japan); Chito, K.; Harayama, I. [Institute of Applied Physics, University of Tsukuba, Tennodai 1-1-1, Tsukuba, Ibaraki 305-8573 (Japan); Watahiki, Y.; Ishii, S. [University of Tsukuba, Tandem Accelerator Complex (UTTAC), Tennodai 1-1-1, Tsukuba, Ibaraki 305-8577 (Japan); Ozeki, K. [Department of Mechanical Engineering, Ibaraki University, Nakanarusawa 4-12-1, Hitachi, Ibaraki 316-8511 (Japan)

    2017-06-15

    A newly developed high-resolution elastic recoil detection analysis (HERDA) system installed at the 1 MV Tandetron in UTTAC at the University of Tsukuba is introduced. The effective solid angle of detector, energy resolution and detection limit for hydrogen are, for the first time, determined quantitatively by the measurements on an a-C:H (and D) film deposited on a Si substrate. In the case of a 500 keV {sup 16}O{sup +} as the incident beam, an energy resolution of ∼0.45 keV and a detection limit of ∼3.8 × 10{sup 20} atoms/cm{sup 3} (∼0.18 at.%) with a data acquisition time of ∼310 s are derived.

  20. Composition and structure of fresh ammonia clouds on Jupiter based on quantitative analysis of Galileo/NIMS and New Horizons/LEISA spectra

    Science.gov (United States)

    Sromovsky, L. A.; Fry, P. M.

    2018-06-01

    Ammonia gas has long been assumed to be the main source of condensables for the upper cloud layer on Jupiter, but distinctive spectral features associated with ammonia have been seen only rarely. Since both ammonia and NH4SH absorb in the 3 μm region, and widespread absorption in the 3 μm region was present (Sromovsky and Fry, 2010), identification of the 2 μm absorption feature of NH3 provided an opportunity to clearly establish its presence in Jovian clouds. Baines et al. (2002) succeeded in finding in Near Infrared Mapping Spectrometer (NIMS) observations one feature that had both 2 μm and 3 μm absorption, and many which were known to have absorption at 2.73 μm. They named these Spectrally Identifiable Ammonia Clouds (SIACs). They also argued that these were fresh ammonia clouds that would eventually succumb to some process that would obscure their absorption features. Detection of many more of the 2 μm features was later achieved by New Horizon's Linear Etalon Imaging Spectral Array (LEISA) instrument, which provided both the spatial and spectral resolution needed to identify these features. Here we report on the first quantitative modeling that uses NIMS spectra over a broad (1-5.2 μm) spectral range and LEISA spectra over a much narrower (1.25-2.5 μm) spectral range to constrain the cloud structure and composition of these rare cloud features and compare them to background clouds. We find that the absorption signature at 2 μm, which is well characterized in LEISA spectra, is relatively subtle and easily matched by model clouds containing spherical particles of ammonia ice with radii of 2-4 μm. The NIMS spectra, which cover both reflected sunlight as well as thermal emission regions are more difficult to model with cloud materials plausibly present in Jupiter's atmosphere. The best signal/noise spectra obtained from NIMS provide a relatively sparse sampling of the spectrum, which does not establish the detailed shape of the 3 μm absorption region

  1. Crescimento, esporulação e viabilidade de fungos entomopatogênicos em meios contendo diferentes concentrações do óleo de nim (Azadirachta indica

    Directory of Open Access Journals (Sweden)

    Marques Renata Paro

    2004-01-01

    Full Text Available A associação de extratos de origem vegetal com fungos entomopatogênicos pode aumentar a eficiência do controle biológico de pragas, reduzir custos e impactos ambientais. No presente trabalho, avaliou-se, através da concentração inibitória mínima, o efeito do óleo de nim (NIM-I-GO sobre o crescimento, esporulação e viabilidade de Metarhizium anisopliae, Beauveria bassiana e Paecilomyces farinosus. Utilizou-se o meio BDA, contendo diferentes concentrações de óleo de nim (C1: 5% de óleo de nim, e sucessivamente concentrações iguais a fraction one-half da concentração anterior, até C11: 0,0048% de óleo de nim. O óleo de nim reduziu o crescimento de colônias de B. bassiana e P. farinosus, que não diferiram significativamente do controle apenas na concentração C11, mas para M. anisopliae o mesmo efeito foi observado com 0,039% de óleo de nim (C8. A esporulação também foi significativamente reduzida pelo óleo de nim, exceto na concentração C11 para B. bassiana; contudo, não se verificou efeito do óleo na viabilidade de esporos dos fungos.

  2. On a Clear Day, You Can See ICS: The Dying Art of Incident Command and the Normal Accident of NIMS - A Policy Analysis

    Science.gov (United States)

    2013-03-01

    Commander ICS Incident Command System IMT Incident Management Team MACC Multi-Agency Coordination System MACS Multi-Agency Coordination System NIMS...as a nation to respond to the big (and little) ones. I do not propose that these three policy options are all-inclusive, as there are many more...Giuliani rose to the occasion and became known as “America’s Mayor” for his leadership during the events ( Economist , 2005). The city of New York

  3. A NIM (Nuclear Instrumentation Module) system conjugated with optional input for pHEMT amplifier for beta and gamma spectroscopy; Um sistema de modulos NIM conjugados com entrada opcional por amplificador pHEMT para espectroscopia beta e gama

    Energy Technology Data Exchange (ETDEWEB)

    Konrad, Barbara; Lüdke, Everton, E-mail: barbarakonradmev@gmail.com, E-mail: eludke@smail.ufsm.br [Universidade Federal de Santa Maria (LAE/UFSM), RS (Brazil). Lab. de Astrofisica e Eletronica

    2014-07-01

    This work presents a high speed NIM module (Nuclear Instrumentation Module) to detect radiation, gamma and muons, as part of a system for natural radiation monitoring and of extraterrestrial origin. The subsystem developed consists of a preamplifier and an integrated SCA (Single Channel Analyzer), including power supplies of ± 12 and ± 24V with derivations of +3.6 and ± 5V. The single channel analyzer board, consisting of discrete logic components, operating in window modes, normal and integral. The pulse shaping block is made up of two voltage comparators working at 120 MHz with a response time > 60 ns and a logic anticoincidence system. The preamplifier promotes a noise reduction and introduces the impedance matching between the output of anode / diode photomultiplier tubes (PMTs) and subsequent equipment, providing an input impedance of 1MΩ and output impedance of 40 to 140Ω. The shaper amplifier is non-inverting and has variable input capacitance of 1000 pF. The upper and lower thresholds of the SCA are adjustable from 0 to ± 10V, and the equipment is compatible with various types of detectors, like PMTs coupled to sodium iodide crystals. For use with liquid scintillators and photodiodes with crystals (CsI: Tl) is proposed to include a preamplifier circuit pHEMT (pseudomorphic High Electron Mobility Transistor) integrated. Yet, the system presents the possibility of applications for various purposes of gamma spectroscopy and automatic detection of events producing of beta particles.

  4. The differentiation of the character of solid lesions in the breast in the compression sonoelastography. Part II: Diagnostic value of BIRADS-US classification, Tsukuba score and FLR ratio

    Directory of Open Access Journals (Sweden)

    Katarzyna Dobruch-Sobczak

    2013-03-01

    Full Text Available Sonoelastography is a dynamically developing method of ultrasound examination used to differentiate the character of focal lesions in the breasts. The aim of the Part II of the study is to determine the usefulness of sonoelastography in the differentiation diagnosis of focal breast lesions including the evaluation of the diagnostic value of Tsukuba score and FLR ratio in characterizing solid lesions in the breasts. Furthermore, the paper provides a comparison of classic B-mode imaging and sonoelastography. Material and methods: From January to July 2010 in the Ultrasound Department of the Cancer Centre, The Institute of Maria Skłodowska-Curie, 375 breast ultrasound examinations were conducted. The examined group included patients who in B-mode examinations presented indications for pathological verification. They were 80 women aged between 17 and 83 (mean age was 50 with 99 solid focal lesions in the breasts. All patients underwent: the interview, physical examination, B-mode ultrasound examination and elastography of the mammary glands and axillary fossae. The visualized lesions were evaluated according to BIRADS-US classification and Tsukuba score as well as FLR ratio was calculated. In all cases, the histopathological and/or cytological verification of the tested lesions was obtained. Results: In the group of 80 patients, the examination revealed 39 malignant neoplastic lesions and 60 benign ones. The mean age of women with malignant neoplasms was 55.07 (SD=10.54, and with benign lesions – 46.9 (SD=15.47. In order to identify threshold values that distinguish benign lesions from malignant ones, a comparative analysis of statistical models based on BIRADS-US classification and Tsukuba score was conducted and the cut-off value for FLR was assumed. The sensitivity and specificity values for BIRADS-US 4/5 were 76.92% and 96.67% and for Tsukuba 3/4 – 64.1% and 98.33% respectively. The assumed FLR threshold value to differentiate between

  5. The differentiation of the character of solid lesions in the breast in the compression sonoelastography. Part II: Diagnostic value of BIRADS-US classification, Tsukuba score and FLR ratio.

    Science.gov (United States)

    Dobruch-Sobczak, Katarzyna

    2013-03-01

    Sonoelastography is a dynamically developing method of ultrasound examination used to differentiate the character of focal lesions in the breasts. The aim of the Part II of the study is to determine the usefulness of sonoelastography in the differentiation diagnosis of focal breast lesions including the evaluation of the diagnostic value of Tsukuba score and FLR ratio in characterizing solid lesions in the breasts. Furthermore, the paper provides a comparison of classic B-mode imaging and sonoelastography. From January to July 2010 in the Ultrasound Department of the Cancer Centre, The Institute of Maria Skłodowska-Curie, 375 breast ultrasound examinations were conducted. The examined group included patients who in B-mode examinations presented indications for pathological verification. They were 80 women aged between 17 and 83 (mean age was 50) with 99 solid focal lesions in the breasts. All patients underwent: the interview, physical examination, B-mode ultrasound examination and elastography of the mammary glands and axillary fossae. The visualized lesions were evaluated according to BIRADS-US classification and Tsukuba score as well as FLR ratio was calculated. In all cases, the histopathological and/or cytological verification of the tested lesions was obtained. In the group of 80 patients, the examination revealed 39 malignant neoplastic lesions and 60 benign ones. The mean age of women with malignant neoplasms was 55.07 (SD = 10.54), and with benign lesions - 46.9 (SD = 15.47). In order to identify threshold values that distinguish benign lesions from malignant ones, a comparative analysis of statistical models based on BIRADS-US classification and Tsukuba score was conducted and the cut-off value for FLR was assumed. The sensitivity and specificity values for BIRADS-US 4/5 were 76.92% and 96.67% and for Tsukuba 3/4 - 64.1% and 98.33% respectively. The assumed FLR threshold value to differentiate between benign and malignant lesions in the breasts equaled 3

  6. Charting thermal emission variability at Pele, Janus Patera and Kanehekili Fluctus with the Galileo NIMS Io Thermal Emission Database (NITED)

    Science.gov (United States)

    Davies, Ashley Gerard; Veeder, Glenn J.; Matson, Dennis L.; Johnson, Torrence V.

    2012-09-01

    Using the NIMS Io Thermal Emission Database (NITED), a collection of over 1000 measurements of radiant flux from Io’s volcanoes (Davies, A.G. et al. [2012]. Geophys. Res. Lett. 39, L01201. doi:10.1029/2011GL049999), we have examined the variability of thermal emission from three of Io’s volcanoes: Pele, Janus Patera and Kanehekili Fluctus. At Pele, the 5-μm thermal emission as derived from 28 night time observations is remarkably steady at 37 ± 10 GW μm-1, re-affirming previous analyses that suggested that Pele an active, rapidly overturning silicate lava lake. Janus Patera also exhibits relatively steady 5-μm thermal emission (≈20 ± 3 GW μm-1) in the four observations where Janus is resolved from nearby Kanehekili Fluctus. Janus Patera might contain a Pele-like lava lake with an effusion rate (QF) of ≈40-70 m3 s-1. It should be a prime target for a future mission to Io in order to obtain data to determine lava eruption temperature. Kanehekili Fluctus has a thermal emission spectrum that is indicative of the emplacement of lava flows with insulated crusts. Effusion rate at Kanehekili Fluctus dropped by an order of magnitude from ≈95 m3 s-1 in mid-1997 to ≈4 m3 s-1 in late 2001.

  7. EFEITO FUNGITÓXICO DO ÓLEO DE NIM SOBRE Metarhizium anisopliae var. acridum e Metarhizium anisopliae var. anisopliae

    Directory of Open Access Journals (Sweden)

    Álison Bruno da Silva Santos

    2009-01-01

    Full Text Available Plague control is based almost exclusively on application of chemical substances, however these products are toxic to men and animals and cause odd effects on environment quality. In Plague Integrated Management (PIM, the use of selected insecticides and entomopathogenic fungi should be considered as one viable strategy for plague control in agriculture. This work aimed to evaluate, in laboratory, the compatibility of the entomopathogenic fungi Metarhizium anisopliae var. acridum and Metarhizium anisopliae var. anisopliae with the oil of Nim. The addition of the product was made to the potato-dextrose-agar medium still liquid (±45°C, in a way that the final concentration obeyed 50% of the producer's recommendation. After fungi inoculation, the dishes were incubated in a cimatized room at 28°C, photophase of 12 hours and relative humidity of 75±5% for 12 day period. The number of conidia per colonie was counted with a Neubauer chamber. Statistic delineament was entirely in random, with two treatments (PDA with insecticide, and a control group (PDA without insecticide, and 9 repetitions for each treatment. The results showed that the insecticide inhibited conidial production in Metarhizium anisopliae var. anisopliae strains when compared to the control group. The diameter of Metarhizium anisopliae var. acridum colonies suffered significative reduction in its size, compared to control. The tested insecticide, in the concentration and formulation used, presented compatibility with the tested strains.

  8. A NIM (Nuclear Instrumentation Module) system conjugated with optional input for pHEMT amplifier for beta and gamma spectroscopy

    International Nuclear Information System (INIS)

    Konrad, Barbara; Lüdke, Everton

    2014-01-01

    This work presents a high speed NIM module (Nuclear Instrumentation Module) to detect radiation, gamma and muons, as part of a system for natural radiation monitoring and of extraterrestrial origin. The subsystem developed consists of a preamplifier and an integrated SCA (Single Channel Analyzer), including power supplies of ± 12 and ± 24V with derivations of +3.6 and ± 5V. The single channel analyzer board, consisting of discrete logic components, operating in window modes, normal and integral. The pulse shaping block is made up of two voltage comparators working at 120 MHz with a response time > 60 ns and a logic anticoincidence system. The preamplifier promotes a noise reduction and introduces the impedance matching between the output of anode / diode photomultiplier tubes (PMTs) and subsequent equipment, providing an input impedance of 1MΩ and output impedance of 40 to 140Ω. The shaper amplifier is non-inverting and has variable input capacitance of 1000 pF. The upper and lower thresholds of the SCA are adjustable from 0 to ± 10V, and the equipment is compatible with various types of detectors, like PMTs coupled to sodium iodide crystals. For use with liquid scintillators and photodiodes with crystals (CsI: Tl) is proposed to include a preamplifier circuit pHEMT (pseudomorphic High Electron Mobility Transistor) integrated. Yet, the system presents the possibility of applications for various purposes of gamma spectroscopy and automatic detection of events producing of beta particles

  9. Med humanističnim in poklicnim izobraževanjem ali kaj terja od nas prihodnost

    Directory of Open Access Journals (Sweden)

    Dušana Findeisen

    1996-12-01

    Full Text Available Dušana Findeisen piše o razmerju med humanističnim in poklicnim izobraževanjem v prihodnosti. Ker kvalifikacij, ki bodo potrebne na trgu dela čez petnajst let, ni mogoče z gotovostjo predvideti, lahko razmišljamo predvsem o tem, kakšne ljudi bomo potrebovali: katere bodo bistvene zmožnosti, ki jih bo treba zajeti med cilje izobraževalnih programov mladih in odraslih. Med bistvenimi usposobljenostmi navaja obvladovanje miselnih procesov, zmožnost spo­razumevanja, usposobljenost za dejavno življenje v skupnosti , razmerje do okolja itd. Opozarja tudi na potrebo po drugačnih didaktičnih postopkih in drugačnem vrednotenju, da bi zagotovili uravnoteženost izobraževanja. Humanistično izobraževanje bo moralo prodreti tudi v ozko usposabljanje odraslih, saj podjetja ne potrebujejo samo dobrih strokovnjakov, temveč ljudi, ki so se zmožni prilagajati in se razvijati.

  10. Seasonal changes in Fe species and soluble Fe concentration in the atmosphere in the Northwest Pacific region based on the analysis of aerosols collected in Tsukuba, Japan

    Directory of Open Access Journals (Sweden)

    Y. Takahashi

    2013-08-01

    Full Text Available Atmospheric iron (Fe can be a significant source of nutrition for phytoplankton inhabiting remote oceans, which in turn has a large influence on the Earth's climate. The bioavailability of Fe in aerosols depends mainly on the fraction of soluble Fe (= [FeSol]/[FeTotal], where [FeSol] and [FeTotal] are the atmospheric concentrations of soluble and total Fe, respectively. However, the numerous factors affecting the soluble Fe fraction have not been fully understood. In this study, the Fe species, chemical composition, and soluble Fe concentrations in aerosols collected in Tsukuba, Japan were investigated over a year (nine samples from December 2002 to October 2003 to identify the factors affecting the amount of soluble Fe supplied into the ocean. The soluble Fe concentration in aerosols is correlated with those of sulfate and oxalate originated from anthropogenic sources, suggesting that soluble Fe is mainly derived from anthropogenic sources. Moreover, the soluble Fe concentration is also correlated with the enrichment factors of vanadium and nickel emitted by fossil fuel combustion. These results suggest that the degree of Fe dissolution is influenced by the magnitude of anthropogenic activity, such as fossil fuel combustion. X-ray absorption fine structure (XAFS spectroscopy was performed in order to identify the Fe species in aerosols. Fitting of XAFS spectra coupled with micro X-ray fluorescence analysis (μ-XRF showed the main Fe species in aerosols in Tsukuba to be illite, ferrihydrite, hornblende, and Fe(III sulfate. Moreover, the soluble Fe fraction in each sample measured by leaching experiments is closely correlated with the Fe(III sulfate fraction determined by the XAFS spectrum fitting, suggesting that Fe(III sulfate is the main soluble Fe in the ocean. Another possible factor that can control the amount of soluble Fe supplied into the ocean is the total Fe(III concentration in the atmosphere, which was high in spring due to the high

  11. The differentiation of the character of solid lesions in the breast in the compression sonoelastography. Part II: Diagnostic value of BIRADS-US classification, Tsukuba score and FLR ratio

    OpenAIRE

    Dobruch-Sobczak, Katarzyna

    2013-01-01

    Sonoelastography is a dynamically developing method of ultrasound examination used to differentiate the character of focal lesions in the breasts. The aim of the Part II of the study is to determine the usefulness of sonoelastography in the differentiation diagnosis of focal breast lesions including the evaluation of the diagnostic value of Tsukuba score and FLR ratio in characterizing solid lesions in the breasts. Furthermore, the paper provides a comparison of classic B-mode imaging and son...

  12. Air concentration of radiocaesium in Tsukuba, Japan following the release from the Tokai waste treatment plant: comparisons of observations with predictions

    International Nuclear Information System (INIS)

    Igarashi, Yasuhito; Aoyama, Michio; Miyao, Takashi; Hirose, Katsumi; Komura, Kazuhisa; Yamamoto, Masayoshi

    1999-01-01

    On March 11, 1997 a fire and explosion accident occurred at the bituminization facility of the Power Reactor and Nuclear Fuel Development, Tokai, Japan. As a result of this accident, 134,137 Cs was detected in an air filter sample collected at the Meteorological Research Institute, Tsukuba during March 10 to 12. The 134,137 Cs air concentration was about 100 and 10 μBq m -3 , respectively. This result suggests that there was little radiation exposure of the residents in the area. The average 137 Cs air concentration during this period was about two orders of magnitude higher than 'baseline' air (sub-μBq m -3 ) during February to April, 1997, measured by ultra-low background γ-spectrometry. By a simple calculation using a Gaussian plume model with the measured data, we estimated the minimum emission of the radioactivity by the PNC accident to be in the range 60 MBq to around 600 MBq. The meteorological condition during the week of the accident are also described

  13. Diagramas de equilibrio para la extracción con solvente de aceite e insecticida de semilla molida de nim

    Directory of Open Access Journals (Sweden)

    R. Espinosa

    2006-01-01

    Full Text Available En este trabajo se construyeron diagramas de equilibrio para la extracción con hexano de aceite de la semilla molida de nim (GNSK y de la extracción posterior con etanol de insecticida de la GNSK sin aceite. Los datos experimentales fueron obtenidos a diferentes temperaturas, poniendo en contacto sólido y solvente en diferentes proporciones en frascos Erlenmeyer. Se suministró agitación y se mantuvo la temperatura controlada hasta alcanzar el equilibrio. La composición del extracto y del refinado se determinó separando los solventes por evaporación. Se propone ecuaciones para la curva de refinado y la curva de distribución. En ambas extracciones, la fracción de solución retenida dentro de la estructura celular del sólido molido aumenta con la temperatura. La concentración del extracto tiene más influencia en la cantidad de solución retenida para la extracción de insecticida que para la extracción de aceite. Para extractos diluidos, la concentración de soluto tiende a ser mayor en el extracto que en la solución retenida. Esta tendencia es más pronunciada cuando la temperatura aumenta. A temperaturas cercanas al punto de ebullición, hay mayor tendencia a la retención de solvente por el sólido, a cualquier concentración.

  14. Implementation of the National Incident Management System (NIMS)/Incident Command System (ICS) in the Federal Radiological Monitoring and Assessment Center(FRMAC) - Emergency Phase

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2007-01-01

    Homeland Security Presidential Directive HSPD-5 requires all federal departments and agencies to adopt a National Incident Management System (NIMS)/Incident Command System (ICS) and use it in their individual domestic incident management and emergency prevention, preparedness, response, recovery, and mitigation programs and activities, as well as in support of those actions taken to assist state and local entities. This system provides a consistent nationwide template to enable federal, state, local, and tribal governments, private-sector, and nongovernmental organizations to work together effectively and efficiently to prepare for, prevent, respond to, and recover from domestic incidents, regardless of cause, size, or complexity, including acts of catastrophic terrorism. This document identifies the operational concepts of the Federal Radiological Monitoring and Assessment Center's (FRMAC) implementation of the NIMS/ICS response structure under the National Response Plan (NRP). The construct identified here defines the basic response template to be tailored to the incident-specific response requirements. FRMAC's mission to facilitate interagency environmental data management, monitoring, sampling, analysis, and assessment and link this information to the planning and decision staff clearly places the FRMAC in the Planning Section. FRMAC is not a mitigating resource for radiological contamination but is present to conduct radiological impact assessment for public dose avoidance. Field monitoring is a fact-finding mission to support this effort directly. Decisions based on the assessed data will drive public protection and operational requirements. This organizational structure under NIMS is focused by the mission responsibilities and interface requirements following the premise to provide emergency responders with a flexible yet standardized structure for incident response activities. The coordination responsibilities outlined in the NRP are based on the NIMS

  15. Bioatividade de nanoformulações de nim sobre a traça-do-tomateiro Bioactivity of neem nanoformulations on tomato pinworm

    Directory of Open Access Journals (Sweden)

    Fátima Teresinha Rampelotti Ferreira

    2012-08-01

    Full Text Available O uso de plantas inseticidas é uma importante ferramenta para o manejo de insetos-praga. Visando ao controle de Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae, nanoformulações de nim foram avaliadas. Após a estimativa de uma CL50 para uma formulação de óleo comercial de nim, bioensaios de seleção foram realizados com 22 nanoformulações. Para isso, lagartas neonatas foram alimentadas sobre folíolos tratados com soluções das nanoformulações durante 10 dias. Com as duas nanoformulações mais promissoras, NC40 aquoso e NC40 pó (NC 40=nanocápsulas de Poli- β-hidroxibutirato, foi avaliado o efeito sobre o desenvolvimento e a longevidade do inseto. A CL50 para o óleo de nim foi estimada em 0,20% ou 1,31mgL-1 de azadiractina. As nanoformulações NC40 aquoso e NC40 pó afetaram o desenvolvimento do inseto.The use of insecticide plants is an important tool in the management of insect pests. Aiming to control Tuta absoluta (Meyrick (Lepidoptera: Gelechiidae, neem nanoformulations were evaluated. After estimating the LC50 for a commercial neem oil formulation, selection bioassays were performed with 22 nanoformulations. In order to do that, newly emerged caterpillars were fed on leaflets treated with nanoformulation solutions for 10 days. The effect on the development and longevity of the insect was evaluated with the two most promising nanoformulations, aqueous NC40 and powdered NC40 (NC 40 = Poly-β-hydroxibutirate nanocapsules. The LC50 for neem oil was estimated in 0.20% or 1.31mgL-1 of azadiractin. The nanoformulations aqueous NC40 and powdered NC40 affected the insect development.

  16. Atividade de extrato aquoso de folhas de nim (Azadirachta indica sobre Spodoptera frugiperda Activity of neem tree (Azadirachta indica leaves aqueous extract on Spodoptera frugiperda

    Directory of Open Access Journals (Sweden)

    Hélio Teixeira Prates

    2003-03-01

    Full Text Available A lagarta-do-cartucho do milho (Spodoptera frugiperda (J. E. Smith tem sido controlada com inseticidas sintéticos. Uma das caracteristicas do nim (Azadirachta indica A. Juss é sua atividade inseticida contra pragas, como sucedâneo aos sintéticos. O objetivo deste trabalho foi avaliar a atividade inseticida do extrato aquoso das folhas do nim sobre a lagarta-do-cartucho do milho, em laboratório. Bioensaios com diferentes concentrações de extrato em dieta artificial, tendo o inseticida chlorpyrifos como testemunha, revelaram, 15 dias após infestação com larvas, eficiência equivalente entre as concen- trações 3,60 a 10,00 mg mL-1. A análise de Probit mostrou CL50 = 2,67 mg mL-1; o extrato aquoso das folhas de nim apresenta, portanto, efeito inseticida sobre a lagarta-do-cartucho do milho.The fall armyworm (Spodoptera frugiperda (J. E. Smith has been controlled with synthetic insecticides bringing risk to the environment. Neem (Azadirachta indica A. Juss is reported to be a natural alternative to synthetic insecticides against many insect species. The objective of this work was to evaluate the activity of neem leaves aqueous extract on fall armyworm, in laboratory. Bioassays carried out using artificial feed with various extract concentrations, and chlorpyrifos as control, indicated, 15 days after larvae infestation, similar efficiency in concentrations from 3.60 to 10.00 mg mL-1. Probit analysis showed LC50 = 2.67 mg mL-1. Hence, aqueous extract from neem leaves are active against fall armyworm.

  17. Características dendrométricas de um povoamento de nim indiano (Azadirachta indica A. Juss no semiárido paraibano

    Directory of Open Access Journals (Sweden)

    Francisco Tibério de Alencar Moreira

    2012-11-01

    Full Text Available O Nim (Azadirachia indica A. Juss é uma espécie de múltiplo uso que pertence a família Meliaceae. Por possuir múltiplos usos, o nim tem despertado a atenção e seus produtos têm sido cada vez mais utilizados na área de agricultura. No entanto, aspectos dendrométricos relacionados ao crescimento da espécie ainda são escassos. O presente trabalho teve como objetivo avaliar o crescimento da espécie nim plantada em região semiárida do Nordeste brasileiro em dois diferentes espaçamentos. A coleta de dados foi realizada em duas áreas localizadas na Fazenda Laranjeiras, localizada no município de São José de Espinharas, Estado da Paraíba. No plantio-1 o espaçamento usado foi de 5 m x 5 m semeado no ano de 1996, em uma área de 2100 m2 e no plantio-2 o espaçamento usado foi de 4 m x 4 m em 1998, em uma área de 1600 m2. As variáveis medidas foram: DNB-Diâmetro a 0,30 cm do nível do solo (cm, HF-Altura do fuste comercial (m, HT-Altura total (m e DC-Diâmetro de copa (m. A partir destes dados foram calculados o volume cilíndrico (m3/ha, volume real (m3/ha, volume empilhado (st/ha e a área basal (m2/ha. O crescimento do nim indiano na região semiárida paraibana apresentou comportamento semelhante ao de outras áreas experimentais estudadas. Quando se pretende produzir madeira com finalidade energética o espaçamento mais indicado, entre os dois avaliados, é o de menor espaçamento.

  18. Efeito inseticida sistêmico de nanoformulações à base de nim sobre Bemisia tabaci (Hemiptera: Aleyrodidae biótipo B em tomateiro

    Directory of Open Access Journals (Sweden)

    Sheila Salles de Carvalho

    2015-01-01

    Full Text Available Este estudo avaliou a ação inseticida sistêmica e o efeito residual de nanoformulações à base de derivados de nim (Azadirachta indica A. Juss, Meliaceae sobre ninfas de Bemisia tabaci biótipo B (Hemiptera: Aleyrodidae, espécie-praga de diversas culturas de importância econômica. Suspensões coloidais contendo nanocápsulas carregadas com produtos derivados de A. indica foram preparadas utilizando polímeros biodegradáveis como poli-ε-caprolactona (PCL e poli-β-hidroxibutirato (PHB. A matriz encapsulada era composta por uma formulação comercial contendo uma quantidade enriquecida e conhecida dos limonoides azadiractina e 3-tigloilazadiractol (Azamax® 1,2 CE. Inicialmente foi estimada a CL50, para ninfas de B. tabaci, de soluções contendo óleo de nim, que foram aplicadas via água de irrigação (solo em tomateiro. Posteriormente, dois lotes de nanoformulações, com variação no tipo e quantidade dos polímeros e na quantidade do óleo comercial, foram testados quanto à ação sistêmica. As nanoformulações NC L5-2 (com nanocápsulas de PCL e NC L6-1 (com nanocápsulas de PHB, as mais eficazes entre as testadas, foram avaliadas quanto ao efeito residual. A CL50 estimada foi de 180,67 mg L–1 de azadiractina. Constatou-se também que a ação sistêmica de óleos e nanoformulações contendo compostos de nim dependem das condições ambientais em que são aplicados. O Azamax® não apresenta efeito deterrente sobre a oviposição, nem age sobre o desenvolvimento embrionário da mosca-branca quando aplicado via água de irrigação no solo no momento da infestação. As nanoformulações selecionadas são bioativas mesmo cerca de 30 dias após a aplicação, não diferindo do produto comercial.

  19. Some aspects of the distribution and dynamics of the benthic macroinvertebrate groups from Nimăieşti valley river

    Directory of Open Access Journals (Sweden)

    CUPŞA Diana

    2005-09-01

    Full Text Available In the Nimăieşti Valley river we found in a number of four sample sites a community of benthic macroinvertebrates represented by Oligochaeta, Ephemeroptera larva, Trichoptera larva, Chironomida larva and Hidracarina species. The communities structure vary depending on season and the sampling site acording to the water quality and trophic condition of the substrate. The greatest diversity was recorded during the summer months (may-august and comparing the sample sites, we found that the first three sampling sites are very similar from the point of view of the macroinvertebrate community, but the fourth sampling site the community is different because the river pases through the town of Beiuş and as a consequence the water quality is lower that at the other three sample sites.

  20. Toxicity of neem oil to Bemisia tabaci biotype B nymphs reared on dry bean Toxicidade de óleo de nim para ninfas de Bemisia tabaci biótipo B criadas em feijoeiro

    Directory of Open Access Journals (Sweden)

    Patricia Valle Pinheiro

    2009-04-01

    Full Text Available The objective of this work was to determine the most susceptible nymphal stage of Bemisia tabaci biotype B to neem (Azadirachta indica A. Juss. oil applied to dry bean (Phaseolus vulgaris L. in a screenhouse. A solution of commercial oil (Dalneem extracted from neem seeds was sprayed directly on each nymphal instar at 0, 0.1, 0.25, 0.5, 1 and 2% concentrations for lethal concentration (LC determination, and at 0, 0.5 and 1% concentrations for lethal time (LT determination. The number of living and dead nymphs was recorded five days after spraying for LC determination, and daily during six days for LT determination. The LC50 estimated for fourth instar nymphs occurred at 0.56% concentration. For all instars, LC50 and LC95 were estimated at 0.32 and 2.78% concentrations, respectively. The estimated values of LT50 at 1% concentration were 2.46, 4.45, 3.02 and 6.98 days for the first to fourth instars, respectively. The LT50 occurred at five days for 0.5% and at four days for 1% concentration in all instars. A mortality rate of over 80% was observed on the 6th day for the first to third instars at 1% concentration. The first three nymphal stages were more susceptible to neem oil when compared to the fourth nymphal stage.O objetivo deste trabalho foi determinar o estágio ninfal de Bemisia tabaci biótipo B mais suscetível ao óleo de nim (Azadirachta indica A. Juss. aplicado em feijoeiro (Phaseolus vulgaris L., em casa telada. Foram avaliados o tempo letal (TL e concentração letal (CL do óleo comercial de sementes de nim Dalneem. Para CL, concentrações de 0, 0,1, 0,25, 0,5, 1 e 2% do produto foram pulverizadas diretamente sobre as ninfas em cada ínstar. Para TL, o produto foi avaliado a 0, 0,5 e 1% de óleo de nim em cada ínstar. Ninfas vivas e mortas foram contadas cinco dias após a pulverização para CL e diariamente para TL durante seis dias. Para o quarto ínstar, a CL50 foi de 0,56% de óleo de nim. Considerando todos os ínstares, CL

  1. Time Evolution of Io’s volcanoes Pele and Pillan from 1996 - 2015, as derived from Galileo NIMS, Keck, Gemini, IRTF, and LBTI observations

    Science.gov (United States)

    de Pater, Imke

    2015-11-01

    We present highlights of our observations of Pele and Pillan on Io, and a multi-decade timeline of thermal emission intensities in both regions. Io was regularly observed by Galileo NIMS during 1996-2001. Since 2001 the satellite has been imaged semi-regularly with NIRC2, coupled to an adaptive optics system, on the 10-m Keck telescope. In 1997, Galileo NIMS observed a large and highly-variable eruption close to Pillan Mons; this eruption lasted several months [1]. Since that time no eruptions had been seen (but time coverage was scarce), until our Keck images on 14 August 2007 revealed an active and highly-energetic eruption at a location close to that of the 1997 eruptions. A one-temperature blackbody fit to the data revealed a (blackbody) temperature of 840 ± 40 K over an area of 17 km2, with a total power output of ~500 GW. Using Davies’ (1996) Io Flow Model [2] we find that the oldest lava present is less than 1-2 hours old, having cooled down from the eruption temperature of >1400 K to ~710 K. This young, hot lava suggests that an episode of lava fountaining was underway. Since 2007, several eruptions have been seen in the Pillan region. The 18 February 2015 eruption was discovered during a mutual occultation event with the NASA IRTF. This event was (serendipitously) subsequently imaged with the Large Binocular Telescope Interferometer (LBTI) on 8 March 2015 during a mutual event occultation, and again with the IRTF on 15 March. The site was imaged with the Keck and Gemini-N telescopes between 27 March and May 5, during which time the intensity gradually decreased. Interestingly, the precise location of the eruption had shifted to the north-west from Pillan Patera, where the initial (18 Feb) eruption had taken place. In contrast to the episodicity of Pillan, Pele has been remarkably consistent in its thermal emission during the Galileo era [1] through February 2002, when a blackbody temperature of 940 ± 40 K and an area of 6.5 km2 was measured. Since that

  2. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae e os predadores Phytoseiulus macropilis (Banks e Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Daniele Cristine Hoffmann Schlesener

    2013-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.

  3. Pengaruh Capital Adequacy Ratio (CAR, Beban Operasional Pendapatan Operasional (BOPO, Return on Asset (ROA dan Net Interest Margin (NIM terhadap Financing Deposit Ratio (FRD di PT. BPRS Bhakti Sumekar Sumenep (Periode 2011-2015

    Directory of Open Access Journals (Sweden)

    Cholida Noerainon

    2016-06-01

    Full Text Available The Bank is an industry whose business activities relying on public confidence so that the health of banks is done by maintaining the quality so that the bank can meet its obligations and maintain its performance. The purpose bank will be realized if the bank is able to significantly improve their performance optimal. To be able to function properly, the banks should have enough capital, maintaining its asset quality with a good, well-managed and operated by the precautionary principle thus generate enough profit to maintain the continuity of its business and maintain its liquidity so that it can meet its obligations at any time. the purpose of this study is the first: To determine the effect of the Capital Adequacy Ratio (CAR, Operating Expenses Towards Operating Income (OEOI, Return on Assets (ROA and Net Interest Margin (NIM simultaneously to the Financial to Deposit Ratio (FDR PT. BPRS Bhakti Sumekar Sumenep. Second: To determine the effect of the Capital Adequacy Ratio (CAR, Operating Expenses Towards Operating Income  (OEOI, Return on Assets (ROA and Net Interest Margin (NIM partially on Financial to Deposit Ratio (FDR PT. BPRS Bhakti Sumekar Sumenep. Third: To determine which variables are the most dominant influencing on Financial to Deposit Ratio (FDR at PT. BPRS Bhakti Sumekar Sumenep. In this research uses quantitative methods with the technique of multiple linear regression analysis with the help of SPSS analysis tools, while proving the hypothesis using a calculation T test and F test. The data used is secondary data namely quarterly publication report documentation results. The research results shows that the variables CAR, OEOI, ROA and NIM simultaneously no effect  towards FDR PT. BPRS Bhakti Sumekar Sumenep because Sig. > 0.05 and the value of Fcount

  4. Toxicidade de extratos de nim (Azadirachta indica ao ácaro-vermelho-do-cafeeiro Oligonychus ilicis Toxicity of neem extracts (Azadirachta indica to the coffee red mite Oligonychus ilicis

    Directory of Open Access Journals (Sweden)

    Sheila Abreu Mourão

    2004-08-01

    Full Text Available O objetivo deste trabalho foi estudar a toxicidade aguda e crônica de extratos de óleo de torta, de sementes e de folhas de Azadirachta indica A. Juss (nim a fêmeas do ácaro-vermelho-do-cafeeiro Oligonychus ilicis (McGregor (Acari: Tetranychidae. A mortalidade e a taxa instantânea de crescimento populacional de fêmeas adultas desse ácaro foram avaliadas em discos de folhas de cafeeiro com 3,5 cm de diâmetro, impregnados com resíduo seco dos extratos de nim e flutuando em água. As concentrações dos extratos de óleo de torta, sementes e folhas de nim que mataram 50% e 99% dos indivíduos de O. ilicis, após 72 horas de exposição, foram de 0,02, 15,9 e 121,4 mg/mL e de 10,9, 520,9 e 277,4 mg/mL, respectivamente. A taxa instantânea de crescimento populacional de O. ilicis diminuiu, linearmente, com o aumento da concentração dos extratos de óleo de torta, sementes e folhas de nim até 0,075, 15 e 144 mg/mL, respectivamente, a partir das quais as populações desse ácaro foram extintas.The objective of this work was to study the toxicity of extracts of oil cake, seeds and leaves of Azadirachta indica A. Juss (neem to the coffee red mite Oligonychus ilicis (McGregor (Acari: Tetranychidae. Concentration-mortality and instantaneous rate of populational growth were determined for adult females of the red mite on disks of coffee with 3.5 cm diameter, floating on water and impregnated with dry residues of the neem extracts. Concentrations of these extracts which caused 50% mortality of the individuals of O. ilicis were 0.02, 15.9 and 121.4 mg/mL; while 99% mortality of this mite was reached with 10.9, 520.9 and 277.4 mg/mL for oil cake, seeds and leaves extracts, respectively. The instantaneous rate of populational growth of O. ilicis dropped as the extract doses increased up to 0.075, 15 and 144 mg/mL for oil cake, seeds and leaves extracts, respectively.

  5. Eficiência e efeitos subletais de nim sobre Bonagota salubricola (Meyrick (Lepidoptera: Tortricidae Efficiency and sublethal effects of neem on Bonagota salubricola (Meyrick (Lepidoptera: Tortricidae

    Directory of Open Access Journals (Sweden)

    Daniel Bernardi

    2011-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência e os efeitos subletais de um inseticida à base de nim (10 g.L-1 de azadiractina A sobre a lagarta-enroladeira Bonagota salubricola em laboratório. Nos bioensaios, foi utilizado o produto à base de azadiractina NeemAzal-T/S® nas concentrações de 0,06%; 0,09%; 0,12%; 0,16%; 0,18% e 0,20% do produto comercial (p.c e uma testemunha (água destilada. A dieta artificial foi cortada em cubos e imersa nas caldas das respectivas concentrações do produto, e, em seguida, lagartas recém-eclodidas foram transferidas para tubos de vidro, contendo os cubos de dieta tratados. Quando a dieta artificial foi tratada com concentração de 0,20% do produto comercial, houve 100% da mortalidade aos 6 dias após a inoculação. Por outro lado, as concentrações de 0,16 e 0,18% prolongaram a fase larval, reduziram a viabilidade de pupas e afetaram negativamente a fecundidade do inseto.The objective of this study was to evaluate the efficiency of control and sublethal effects of neem insecticide (10 g.L-1 of azadirachtin A to the leafroller Bonagota salubricola at laboratory condition. In the bioassays, it was used an azadirachtin based product (NeemAzal-T/S® at concentrations of 0.06%, 0.09%, 0.12%, 0.16%, 0.18% and 0.20% of the commercial product (c.p. and a control (distilled water. The artificial diet was cut in cubes and immersed in the syrups of the respective product concentrations, soon afterwards recently-emerged caterpillars were transferred to glass tubes, containing the diet cubes treated. When the artificial diet was treated with a concentration of 0.20% of the commercial product, the mortality was 100% at the 6th day after inoculation. Additionally, concentrations of 0.16% and 0.18% extended the larval stages, reduced pupae viability and negatively affected the fecundity of the insect.

  6. Proceedings of the 5th workshop of 'quantum complex phenomena, -superconductivity, magnetism and phonon-' under the NIMS-RIKEN-JAEA cooperative research program on quantum beam science and technology

    International Nuclear Information System (INIS)

    Shamoto, Shin-ichi; Kodama, Katsuaki

    2012-08-01

    The 5th workshop of the NIMS-RIKEN-JAEA Cooperative Research Program 'Quantum Complex Phenomena, -Superconductivity, Magnetism and Phonon-' was held on January 23-24, 2012 at KKR Hakone Miyanoshita. This workshop is aimed to reveal the mechanism of quantum complex phenomena for the developments of next generation functional materials on the basis of 'Joint Research Agreement for the Pioneering R and D with Quantum Beam Technology' concluded by NIMS, RIKEN and JAEA on December 20, 2006. The neutron facilities in Tokai, i.e., the research reactor JRR-3 and the proton accelerator J-PARC (Japan Proton Accelerator Research Complex), were damaged by the Tohoku-Kanto earthquake on March 11, 2011. J-PARC members' devoted efforts for the recovery made it possible to successfully produce neutron beam in the midnight of January 24, just after this workshop. Also at JRR-3 all the repair works of the reactor facilities and buildings have been completed by the end of the fiscal year 2011. Yet, the safety analysis report is to be submitted and after its positive review by the national regulatory authority, the JRR-3 can undergo the regular periodic inspection to resume its operation. Under this circumstance, characteristic technologies, instruments, and distinguished researches of each institute about 'Superconductivity, Magnetism and Phonon' are introduced and discussed in addition to research outcomes of this Joint Research Agreement including a future prospect of this research area. This report includes abstracts and materials of the presentations in the workshop. (author)

  7. Efficacy evaluation of a commercial neem cake for control of Haematobia irritans on Nelore cattle Avaliação da eficácia de uma torta comercial de nim para o controle de Haematobia irritans em bovinos Nelore

    Directory of Open Access Journals (Sweden)

    Ana Carolina de Souza Chagas

    2010-12-01

    Full Text Available Much attention has been given to the development of botanical insecticides to provide effective natural control of cattle ectoparasites without harming animals, consumers, and environment. This study evaluated the efficacy of a commercial neem cake in controlling Haematobia irritans infestation on cattle. The study was conducted at the Embrapa Southeast Cattle Research Center (CPPSE, in São Carlos, SP, Brazil, from April to July 2008. The neem cake mixed in mineral salt in a 2% concentration was provided to 20 Nelore cows during nine weeks and had its efficacy evaluated by comparison of the infestation level against a control group. Fly infestations were recorded weekly by digital photographs of each animal from both groups and the number of flies was later counted in a computer-assisted image analyzer. Quantification of neem cake components by high-performance liquid chromatography revealed the presence of azadirachtin (421 mg.kg-1 and 3-tigloyl-azadirachtol (151 mg.kg-1 in the tested neem cake. Addition of the 2% neem cake reduced mineral salt intake in about 22%. The 2% neem cake treatment failed to reduce horn fly infestations on cattle during the 9-week study period.Muita atenção tem sido dada ao desenvolvimento de inseticidas vegetais buscando-se um efetivo controle de ectoparasitas de bovinos, sem prejudicar animais, consumidores e meio ambiente. Este estudo, realizado de abril a julho de 2008, na Embrapa Pecuária Sudeste, em São Carlos, SP, Brasil, avaliou a eficácia de uma torta comercial de nim (Azadirachta indica no controle da mosca-dos-chifres (Haematobia irritans em bovinos. A torta de nim, misturada ao sal mineral na concentração de 2%, foi fornecida a 20 vacas Nelore, durante nove semanas, e sua eficácia foi monitorada através de contagens semanais nos grupos tratado e controle. Infestações individuais foram registradas por meio de fotos digitais em todos os animais de ambos os grupos, e o número de moscas foi

  8. Editorial to NIM-B

    Science.gov (United States)

    McDaniel, Floyd Del; Doyle, Barney L.; Glass, Gary; Wang, Yongqiang; Antolak, Arlyn

    2018-01-01

    This special issue of Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms contains 7 selected papers that were presented at the 24th International Conference on the Application of Accelerators in Research and Industry (CAARI 2016). This conference was held in Fort Worth, Texas, USA, October 30 - November 4, 2016 and the Worthington Renaissance Hotel. CAARI 2016 had 5 plenary sessions, 79 oral sessions, 2 poster sessions, 401 presentations (10 plenary talks, 165 invited talks, 154 contributed talks, and 72 poster presentations), and 434 attendees (76 of which were students and 14 were accompanying persons) from 32 countries.

  9. Efficiency of neem oil nanoformulations to Bemisia tabaci (GENN. Biotype B (Hemiptera: AleyrodidaeEficiência de nanoformulações a base de óleo de nim sobre Bemisia tabaci (GENN. Biótipo B (Hemiptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Sheila Salles Carvalho

    2012-04-01

    Full Text Available The nanotechnology, through encapsulation of active ingredients, has showed an important way to avoid problems with quickly degradation of the pesticide molecules. Thus, neem (Azadirachta indica oil nanoformulations containing ?-ciclodextrin and poli-?-caprolactone (PCL were tested as to their control efficiency against eggs and nymphs of Bemisia tabaci (Genn. biotype B reared in soybean. The Lethal Concentration (LC50 was estimated using a commercial neem oil (Organic Neem® on first-instar nymphs to establish the adequate volume of the nanoformulations per treatment. After that, they were sprayed on eggs and first-instar nymphs in laboratory and greenhouse and on third-instar nymphs in greenhouse. The commercial neem oil and distilled water were used as controls. Egg viability was not affected by any treatment. Among six nanoformulations, only one was efficient against the first-instar nymphs in laboratory conditions. However, its effective period was not increased as expected. In greenhouse, first-instar nymphs were more affected by two nanoformulations which were significantly different of the commercial neem oil - the most effective one. No mortality differences among the formulations in the third-instar test were observed. The nanoformulations were less efficient to control the B. tabaci biotype B nymphs than the commercial neem oil. A nanotecnologia, através do encapsulamento de ingredientes ativos, tem-se revelado uma importante estratégia para evitar problemas com a rápida degradação de moléculas inseticidas. Assim, nanoformulações à base de óleo de nim (Azadirachta indica utilizando os polímeros ?-ciclodextrina e poli-?-caprolactona (PCL foram testadas quanto a sua eficiência de controle de ovos e ninfas de Bemisia tabaci (Genn. biótipo B mantidas em soja. Foi estimada a CL50 utilizando uma formulação comecial de óleo de nim (Organic Neem® sobre ninfas em 1º ínstar da qual se estipulou o volume das nanoformula

  10. Utjecaj jestivog filma od želatine, obogaćenog eteričnim uljem lovora, na kakvoću fileta kalifornijske pastrve (Onchorynchus mykiss) tijekom skladištenja u hladnjaku

    OpenAIRE

    Alparslan, Yunus; Baygar, Tuba; Baygar, Taçnur; Hasanhocaoglu, Hatice; Metin, Cansu

    2014-01-01

    U ovom je radu ispitan utjecaj filma od želatine, obogaćenog eteričnim uljem lovorovog lista, na kakvoću fileta kalifornijske pastrve (Onchorynchus mykiss) skladištene na (4±1) °C tijekom 26 dana. Fileti su ribe omotani u filmove od 8 %-tne želatine, koji su sadržavali 0; 0,1 ili 1 % (volumena po masi želatine) eteričnog ulja lovora, te pakirani u vakuumu. Tijekom skladištenja određivani su: senzorske značajke sirove i kuhane ribe, mikrobiološki parametri (ukupan broj živih stanica, te bro...

  11. Eficácia de extratos de nim para o controle do oídio do feijoeiro Effectiveness of neem extracts in controlling the powdery mildew of bean plant

    Directory of Open Access Journals (Sweden)

    Solange Monteiro de Toledo Piza Gomes Carneiro

    2007-03-01

    Full Text Available O nim, Azadirachta indica, vem sendo estudado nos últimos anos para o controle de fitopatógenos. O objetivo deste trabalho foi avaliar o efeito do óleo, do extrato de sementes e do extrato de folhas de nim no controle do oídio do feijoeiro, em casa de vegetação. Uma formulação comercial de óleo emulsionável de nim foi testada em concentrações entre 0,25 e 2,0%, em aplicações antes ou após o surgimento dos sintomas da doença. O extrato de sementes foi produzido em laboratório por meio da trituração das sementes em água destilada, sendo pulverizado 48 horas antes ou 24 horas após a inoculação do patógeno. Avaliou-se, após o surgimento dos sintomas, a eficiência de uma formulação comercial de extrato de folhas, nas concentrações de 0,25 e 0,5%. Verificou-se que o óleo de nim foi eficiente para o controle da doença quando aplicado antes ou depois do surgimento dos sintomas. O extrato de sementes controlou a doença nas três concentrações testadas. Por outro lado, o extrato de folhas não foi eficiente no controle do oídio do feijoeiro.The neem, Azadirachta indica, has been studied in the last years for the use in controlling plant pathogens. The objective of this work was to evaluate the effect of the neem oil, seed kernel extract and leaf extract on the control of the powdery mildew of the bean plant under green house conditions. The emulsified neem oil was tested for concentrations between 0.25 and 2.0% and sprayed before or after the appearance of the symptoms of the disease. The seed kernel extract was produced under laboratory conditions by grinding the kernels in distilled water, which was sprayed 48 hours before or 24 hours after the inoculation of the pathogen. It was also evaluated the efficiency of a commercial leaf extract at the concentrations of 0.25 and 0.5% which was sprayed after the appearance of the symptoms. The results of this work showed that the neem oil was efficient in the control of the

  12. Atividade da torta de nim sobre adultos do cascudinho dos aviários em condições de laboratório Activity of neem cake on adults of the lesser mealworm in laboratory

    Directory of Open Access Journals (Sweden)

    Victor Michelon Alves

    2012-05-01

    Full Text Available O cascudinho dos aviários é considerado um importante problema mundial no sistema de produção avícola, por infestar os aviários e ser potencial vetor de patógenos às aves e ao ser humano. O objetivo do trabalho foi avaliar em laboratório a atividade da torta de nim, Azadirachta indica A. Juss (Meliaceae como forma alternativa de controle de Alphitobius diaperinus Panzer (Coleoptera: Tenebrionidae. A torta foi aplicada diretamente no substrato (ração para aves ou cama de aviário na quantidade de 100g m-2 do produto. Foram verificados os efeitos letais e subletais da torta contra adultos do cascudinho dos aviários, sendo eles: ação inseticida, efeito na oviposição, repelência e efeito na alimentação. A utilização de torta de nim pareceu não afetar a sobrevivência dos insetos, porém, a avaliação do efeito repelente, atividade alimentar e oviposição foram influenciados, sendo observada redução de 23% na oviposição e 21% na atividade alimentar.The lesser mealworm is one the most important problem to avian production system, being a potential vector of avian and other animal pathogens. The objective of this study was to evaluate the neem cake (Azadirachta indica A. Juss (Meliaceae as an alternative to control the Alphitobius diaperinus Panzer (Coleoptera: Tenebrionidae. The neem cake was directly applied to substrates at 100g m-2 and were evaluated the lethal and sublethal effects to A. diaperinus adults, as mortality, oviposition, repellent effect and feeding. There was no effect on adult mortality, but were observed reduction of the oviposition (23%, repellent effect, and reduction of insect feeding (21%.

  13. JRCAT - A Nanotechnology Center in Tsukuba

    International Nuclear Information System (INIS)

    Tanaka, Kazunobu

    2000-01-01

    Joint Research Center for Atom Technology (JRCAT) and its Atom Technology Project are described. The project covers a wide range of research subjects; manipulation of atoms and molecules, formation of nanostructures of semiconductors, spin electronics and first-principles calculation of dynamic processes of atoms and molecules on solid-state surfaces. Several recent achievements on nanotechnology and nanoscience are roughly sketched

  14. Toxicidade aguda do sulfato de cobre e do extrato aquoso de folhas secas de nim para o caramujo (Pomacea canaliculata = Acute toxicity of copper sulfate and aqueous extract of dried neem leaves on snails (Pomacea canaliculata

    Directory of Open Access Journals (Sweden)

    Francine Perri Venturini

    2008-04-01

    Full Text Available Os caramujos podem se tornar um problema ambiental e econômico, podendo causar muitos prejuízos. O trabalho teve como objetivo estimar a toxicidade aguda do sulfato de cobre pentaidratado (CuSO4.5H2O e do extrato aquoso de folhas secas de nim para o P. canaliculata, em condição de laboratório. Para determinação da CL (I(50;96h, o caramujo foi exposto a seis concentrações crescentes de sulfato de cobre (0,0; 0,01; 0,03; 0,05; 0,07 e 0,1 mg L-1 e a seis concentrações crescentes de extrato aquoso de folhas secas denim (0,0; 100; 125; 150; 175 e 200 mL de extrato aquoso de folhas secas de nim L-1 de água, equivalente a 0,0; 1,18; 1,47; 1,77; 2,06; e 2,36 mg de azadiractina L-1, com três repetições e um tratamento-controle em um experimento no delineamento inteiramente casualizado(DIC. A CL (I(50;96h estimada para o caramujo foi de 0,07 mg de sulfato de cobre L-1, com limite inferior de 0,05 mg L-1 e limite superior de 0,1 mg L-1. A concentração letal 50% (CL (I50;96h estimada do extrato aquoso de folhas secas de nim (EAFSN para o caramujo foi de 142,75 mL L-1, equivalente a 1,68 mg L-1 de azadiractina, com limite inferior de 130,89 mL L-1 (1,54, mg L-1 e limite superior de 155,69 mL L-1 (1,83 mg L-1.Snails can become an environmental and economic problem, causing substantial losses. The objective of this work was to estimatethe acute toxicity of copper sulfate pentahydrate (CuSO4.5H2O and the aqueous extract of dried neem leaves on snails (P. canaliculata under laboratory conditions. In order to estimate the lethal concentration 50% (LC (I50;96h, snails were exposed to six increasing copper sulfate concentrations (0.0; 0.01; 0.03; 0.05; 0.07 and 0.1 mg L-1 and six increasing concentrations of aqueous extract of dried neem leaves 0.0; 100; 125; 150; 175 and 200 mL aqueous extract of dried neem leaves L-1 water, equivalent to (0.0; 1.18; 1.47; 1.77; 2.06; and 2.36 mg azadirachtin L-1, in triplicate and one control treatment in an

  15. The Synergy Effect of Ni-M (M = Mo, Fe, Co, Mn or Cr Bicomponent Catalysts on Partial Methanation Coupling with Water Gas Shift under Low H2/CO Conditions

    Directory of Open Access Journals (Sweden)

    Xinxin Dong

    2017-02-01

    Full Text Available Ni-M (M = Mo, Fe, Co, Mn or Cr bicomponent catalysts were prepared through the co-impregnation method for upgrading low H2/CO ratio biomass gas into urban gas through partial methanation coupling with water gas shift (WGS. The catalysts were characterized by N2 isothermal adsorption, X-ray diffraction (XRD, H2 temperature programmed reduction (H2-TPR, H2 temperature programmed desorption (H2-TPD, scanning electron microscopy (SEM and thermogravimetry (TG. The catalytic performances demonstrated that Mn and Cr were superior to the other three elements due to the increased fraction of reducible NiO particles, promoted dispersion of Ni nanoparticles and enhanced H2 chemisorption ability. The comparative study on Mn and Cr showed that Mn was more suitable due to its smaller carbon deposition rate and wider adaptability to various H2/CO and H2O/CO conditions, indicating its better synergy effect with Ni. A nearly 100 h, the lifetime test and start/stop cycle test further implied that 15Ni-3Mn was stable for industrial application.

  16. Detection of B. fragilis group and diversity of bft enterotoxin and antibiotic resistance markers cepA, cfiA and nim among intestinal Bacteroides fragilis strains in patients with inflammatory bowel disease.

    Science.gov (United States)

    Rashidan, Marjan; Azimirad, Masoumeh; Alebouyeh, Masoud; Ghobakhlou, Mehdi; Asadzadeh Aghdaei, Hamid; Zali, Mohammad Reza

    2018-04-01

    We compared frequency of the members of B. fragilis group in 100 and 20 colon biopsy specimens of inflammatory bowel disease (IBD) and non-IBD patients. Agar dilution and PCR were orderly used to detect minimal inhibitory concentration of ampicillin, imipenem, and metronidazole, and carriage of related resistance genes cepA, cfi, and nim. B. fragilis group was detected in 38% of IBD (UC: 36/89; CD:1/11) and 25% (5/20) of non-IBD patients. While B. vulgatus (UC: 20/36, CD: 1/2, control: 1/6); B. fragilis (UC: 18/36, CD: 1/2, control: 5/6); B. ovatus (UC: 2/36); B. caccae (UC: 1/36); and B. eggerthii (UC: 1/36) were characterized, colonization of B. thetaiotamicron, B. merdae, B. distasonis, B. stercoris and B. dorei species was not detected in these specimens. Co-existence of B. fragilis + B. vulgatus (5 patients) and B. vulgatus + B. caccae (1 patient) was detected just in UC patients. bft was detected among 31.5% (6/19) of B. fragilis strains in the IBD and 40% (2/5) in the non-IBD groups. Nearly, 73.6% of the strains from the patient group and 80% in control group harbored cepA; 31.5% and 20% in the patients and control groups harbored cfiA, and none of them harbored nim determinant. Co-occurrence of the cepA and cfiA was orderly detected in 10.5% (2/19) and 20% (1/5) of the strains in these groups. The resistance rates were detected as 95.8% (23/24 (to ampicillin (MIC range of ≤0.5-≥16 μg/ml), 0% to metronidazole and 29.1% to imipenem (7/24, MIC range ≤4-32 μg/ml). Nearly 25% (6/24) of the strains were resistant to ampicillin and imipenem, simultaneously. No statistically significant difference was detected between the IBD and control groups for drug resistance phenotypes. Statistical analysis showed significant associations between resistance to ampicillin or imipenem and carriage of cepA or cfiA, respectively (p value = 0.0007). PCR results on the extracted plasmids confirmed their roles in carriage of cfiA and cepA. These

  17. Estudio de las escenas: Jesús es condedado a muerte y Jesús ante Poncio Pilato, del conjunto pictórico de la iglesia del Santísimo Cristo de Benigànim. Estado de conservación, propuesta de intervención y presupuesto económico de restauración.

    OpenAIRE

    LLOPIS SERRANO, PAULA

    2015-01-01

    Este trabajo final de grado expone el estudio técnico, del estado de conservación, la propuesta de intervención, y el presupuesto de restauración de les dos escenas pertenecientes al conjunto pictórico de la Iglesia del Santísimo Cristo de Benigpànim. El estudio prevé un enfoque, tanto documental como analítico, determinando la técnica pictórica, el estado de conservación en el que se encuentra, y las posibles intervenciones anteriores. This final course work explains the technical work...

  18. Ressenya a Delle Donne, Fulvio & Torró, Jaume (eds. L’immagine di Alfonso il Magnanimo tra letteratura e storia, tra Corona d’Aragona e Italia - La imatge d’Algons el Magnànim en la literatura i la Historiografia entre la Corona d’Aragó i Itàlia, Florència, SISMEL -Edizioni del Galluzzo , 2016, XII + 300 p. ISBN: 978-88-8450-691-7

    Directory of Open Access Journals (Sweden)

    Marta Marfany Simó

    2016-12-01

    Full Text Available Review to Delle Donne, Fulvio & Torró, Jaume (eds. L’immagine di Alfonso il Magnanimo tra letteratura e storia, tra Corona d’Aragona e Italia - La imatge d’Algons el Magnànim en la literatura i la Historiografia entre la Corona d’Aragó i Itàlia, Firenze, SISMEL -Edizioni del Galluzzo , 2016, XII + 300 p. ISBN: 978-88-8450-691-7

  19. GALILEO NIMS SPECTRAL IMAGE CUBES: JUPITER OPERATIONS

    Data.gov (United States)

    National Aeronautics and Space Administration — The natural form of imaging spectrometer data is the spectral image cube. It is normally in band sequential format, but has a dual nature. It is a series of 'images'...

  20. GALILEO NIMS SPECTRAL IMAGE TUBES: JUPITER OPERATIONS

    Data.gov (United States)

    National Aeronautics and Space Administration — The natural form of imaging spectrometer data is the spectral image cube. It is normally in band sequential format, but has a dual nature. It is a series of 'images'...

  1. Atividade inseticida in vitro do óleo de sementes de nim sobre Lutzomyia longipalpis (Diptera: Psychodidae In vitro insecticidal activity of seed neem oil on Lutzomyia longipalpis (Diptera: Psychodidae

    Directory of Open Access Journals (Sweden)

    Michelline V. Maciel

    2010-03-01

    Full Text Available Lutzomyia longipalpis é o principal vetor da Leishmaniose visceral no Brasil. O objetivo deste trabalho foi avaliar o efeito do óleo de sementes de nim (Azadirachta indica sobre ovos, larvas e adultos do vetor. Os insetos foram capturados no campo e mantidos no laboratório a ± 27 °C e 80% de umidade relativa. Cinco tratamentos com diferentes concentrações foram realizados, usando-se dois controles negativos, um com água destilada e outro com Tween 80 (3% e um controle positivo com cipermetrina. Os ovos foram borrifados com o óleo em diferentes concentrações e avaliou-se o número de larvas eclodidas por 10 dias consecutivos. A mortalidade das larvas foi observada até a pupação, e a mortalidade dos adultos foi observada após 24, 48, e 72 horas. A análise estatística foi feita pelo teste de Tukey a 5% de probabilidade. No teste com ovos, a maior concentração obteve 65,16 ± 3,24% de eficácia. O teste com larvas apresentou 67,75 ± 2,21% de eficácia na concentração de 100 mg.mL-1. Com adultos, a eficácia na concentração de 100 mg.mL-1 foi de 96,64 ± 4,11%, após 24 horas. A análise fitoquímica revelou a presença de triterpenos. Esses resultados demonstram o potencial uso desse óleo no controle deste vetor.Lutzomyia longipalpis is the main vector of visceral leishmaniasis in Brazil. The objective was to evaluate the effect of oil from (Azadirachta indica neem seeds on eggs, larvae and adults of the vector. The insects were captured in the field and kept in the laboratory at ± 27 °C and 80% relative humidity. Five treatments with different concentrations were performed using two negative controls (distilled water and Tween 80 and a positive control. The eggs were sprayed with the oil at different concentrations and the number of hatched larvae evaluated for 10 days. Mortality of larvae was observed to pupation and adult mortality was observed after 24, 48, and 72 hours. Statistical analysis was performed by Tukey test

  2. Manejo da lagarta-do-cartucho em milho com formulações de nim e Bacillus thuringiensis subsp. aizawai Management of fall armyworm in corn with commercial neem and Bacillus thuringiensis subsp. aizawai

    Directory of Open Access Journals (Sweden)

    Marcileyne Pessôa Leite de Lima

    2009-07-01

    Full Text Available A lagarta-do-cartucho, Spodoptera frugiperda, principal praga do milho, é comumente controlada com inseticidas sintéticos. Assim, na busca de alternativas eficientes e de baixo impacto ambiental, testou-se em campo as formulações comerciais de nim Natuneem® (10mL L-1 em 2005 e 15mL L-1 em 2006 e Neemseto® (5 e 10mL L-1 em 2005, e 10 e 15mL L-1 em 2006 e do inseticida biológico Bta (Xentari® 10g L-1 em 2005 e 2006, aplicados aos 15, 30 e 45 e aos 15, 25 e 35 dias, após a emergência das plantas, em 2005 e 2006, respectivamente. Antes de cada pulverização foram atribuídas notas de 0 a 5 para as injúrias foliares. Em 2005, somente Neemseto® 10mL L-1 foi eficiente aos 30 dias. Em 2006, Neemseto® 15mL L-1 e Bta 10g L-1, com notas médias de 0,93 e 0,98, diferiram da testemunha, com nota 2,38, na avaliação realizada aos 35 dias. Em casa-de-vegetação, plantas de milho foram pulverizadas com os inseticidas Natuneem®, Neemseto® e Xentari® e posteriormente infestadas, artificialmente, com lagartas recém-eclodidas. Após 10 dias, verificou-se que os tratamentos foram igualmente eficientes, diferindo da testemunha, tanto em relação às notas, quando ao número de lagartas sobreviventes.The fall armyworm (Spodoptera frugiperda is the main pest of corn in Brazil and the use of synthetic insecticides is the most commonly applied method to its control. Thus, searching for efficient and low environment impact alternatives, commercial formulations of the neem Natuneem® (10mL L-1 in 2005 and 15mL L-1 in 2006 and Neemseto® (5 and 10mL L-1 in 2005, and 10 and 15mL L-1 in 2006 and biological insecticide Bta Xentari® (10g L-1 in 2005 and 2006 applied at 15, 30 and 45 and at 15, 25 and 35 days after plant emerge in 2005 and 2006, respectively, were tested. Evaluations consisted of using a scale of foliar injury from 0 to 5 r before each spray. In 2005, only Neemseto® 10mL L-1 was efficient at 30 days. In 2006, Neemseto® 15mL L-1 and Bta

  3. Efeito de derivados de nim aplicados por pulverização sobre a mosca-branca em meloeiro Effects of neem derivatives sprayed on melon crop to control silverleaf whitefly

    Directory of Open Access Journals (Sweden)

    Ervino Bleicher

    2007-03-01

    Full Text Available A mosca-branca é uma das principais pragas do meloeiro na região Nordeste do Brasil. Estudou-se neste trabalho o efeito de extratos aquosos de folhas e de sementes de nim (Azadirachta indica A. Juss. e uma formulação à base de azadiractina comparados com o inseticida buprofezin, aplicados por pulverização, sobre ninfas da mosca-branca, Bemisia tabaci biotipo B, em melão cv. Torreon, sob condições de casa de vegetação. Três experimentos independentes foram realizados no delineamento inteiramente casualizado, com sete tratamentos e número variável de cinco a sete repetições. Cada planta constituiu uma unidade experimental. No primeiro experimento, os tratamentos foram: testemunha absoluta (água, Neemazal® (1,2% de azadiractina nas doses 12; 24; 48; 96 e 192 ppm de azadiractina. No segundo: testemunha absoluta (água, extrato de semente a 1; 2; 4; 8 e 16 g/100ml. No terceiro, o extrato de folhas foi aplicado nas mesmas proporções que o de sementes. Para cada experimento aplicou-se como testemunha positiva, o produto comercial Applaud® (buprofezin na dose de 1,5g. p.c./L, que corresponde a 0,375 g de ingrediente ativo(i.a/L de calda. A azadiractina foi eficiente em todas as doses causando redução de até 98% na média de ninfas vivas. Quando aplicado acima de 24 ppm, este composto apresentou desempenho semelhante ao inseticida padrão buprofezin. Os extratos de sementes a 1; 2; 4; 8 e 16g/100 ml reduziram significativamente a média de ninfas vivas, não diferindo da ação do inseticida padrão. Os extratos de folha não foram eficientes no controle de ninfas.Whitefly is one of the main pests of melon in the Northeast area of Brazil. In this research, the effect of leaf and seed aqueous extracts of the neem plant (Azadirachta indica A. Juss. and a formulation containing azadirachtin compared to buprofezin were studied as a spray application against nymphs of the silverleaf, Bemisia tabaci biotype B, whitefly in greenhouse

  4. Toxicidade aguda do sulfato de cobre e do extrato aquoso de folhas secas de nim para o caramujo (Pomacea canaliculata - DOI: 10.4025/actascibiolsci.v30i2.3615 Acute toxicity of copper sulfate and aqueous extract of dried neem leaves on snails (Pomacea canaliculata - DOI: 10.4025/actascibiolsci.v30i3.3615

    Directory of Open Access Journals (Sweden)

    Robinson Antonio Pitelli

    2008-05-01

    Full Text Available Os caramujos podem se tornar um problema ambiental e econômico, podendo causar muitos prejuízos. O trabalho teve como objetivo estimar a toxicidade aguda do sulfato de cobre pentaidratado (CuSO4.5H2O e do extrato aquoso de folhas secas de nim para o P. canaliculata, em condição de laboratório. Para determinação da CL (I(50;96h, o caramujo foi exposto a seis concentrações crescentes de sulfato de cobre (0,0; 0,01; 0,03; 0,05; 0,07 e 0,1 mg L-1 e a seis concentrações crescentes de extrato aquoso de folhas secas de nim (0,0; 100; 125; 150; 175 e 200 mL de extrato aquoso de folhas secas de nim L-1 de água, equivalente a 0,0; 1,18; 1,47; 1,77; 2,06; e 2,36 mg de azadiractina L-1, com três repetições e um tratamento-controle em um experimento no delineamento inteiramente casualizado (DIC. A CL (I(50;96h estimada para o caramujo foi de 0,07 mg de sulfato de cobre L-1, com limite inferior de 0,05 mg L-1 e limite superior de 0,1 mg L-1. A concentração letal 50% (CL (I50;96h estimada do extrato aquoso de folhas secas de nim (EAFSN para o caramujo foi de 142,75 mL L-1, equivalente a 1,68 mg L-1 de azadiractina, com limite inferior de 130,89 mL L-1 (1,54, mg L-1 e limite superior de 155,69 mL L-1 (1,83 mg L-1.Snails can become an environmental and economic problem, causing substantial losses. The objective of this work was to estimate the acute toxicity of copper sulfate pentahydrate (CuSO4.5H2O and the aqueous extract of dried neem leaves on snails (P. canaliculata under laboratory conditions. In order to estimate the lethal concentration 50% (LC (I50;96h, snails were exposed to six increasing copper sulfate concentrations (0.0; 0.01; 0.03; 0.05; 0.07 and 0.1 mg L-1 and six increasing concentrations of aqueous extract of dried neem leaves 0.0; 100; 125; 150; 175 and 200 mL aqueous extract of dried neem leaves L-1 water, equivalent to (0.0; 1.18; 1.47; 1.77; 2.06; and 2.36 mg azadirachtin L-1, in triplicate and one control treatment in an

  5. NEEM OIL ANTIFEEDANT AND INSECTICIDAL EFFECTS ON Oebalus poecilus (HEMIPTERA: PENTATOMIDAE MALES AND FEMALES EFEITO INSETICIDA E DETERRENTE DO ÓLEO DE NIM EM MACHOS E FÊMEAS DE Oebalus poecilus (HEMIPTERA: PENTATOMIDAE

    Directory of Open Access Journals (Sweden)

    Patricia Valle Pinheiro

    2010-10-01

    Full Text Available

    The antifeedant and insecticidal effects of two commercial neem (Azadirachta indica oil formulations (Dalneem and Nim-I-Go to Oebalus poecilus were evaluated on irrigated rice. To evaluate the antifeedant effect, both formulations were tested at 1% and 2% (v/v concentration levels. The insecticidal effect was evaluated at 0.5%, 1%, 2%, and 4% (v/v concentrations of Dalneem, by ingestion. Both experiments were conducted with four replications by treatment, containing one panicle and adult insects segregated by gender (two insects per plot for the antifeedant effect and five for the insecticidal effect. Both products were efficient, reducing the damage caused by insects. Insects fed less on the panicles treated with neem oil, causing lower number of feeding sheaths per panicle and lower percentage of damaged grains than the control. Spikelets weight was higher in panicles treated with neem oils. Females caused significantly higher damage than males in controls, for numbers of feeding sheaths and for the feeding deterrence index. Only at the 4% (v/v concentration level, Dalneem caused adult mortality higher than in the control. Results showed that neem oil formulations, at >= 1% (v/v concentration, can be used to reduce the quantitative and qualitative damages caused by O. poecilus in lowland rice.

    KEY-WORDS: Small rice stink bug; Azadirachta indica; qualitative damages; Oryza sativa;

  6. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1986-01-01

    From November, 1985 to January, 1986, the accelerator was shut down for reconstructing and realigning the accelerator tubes. Thereafter, the beam transmission improved considerably, especially for polarized ion beam. The total chain operation time was 2735 hr, and the beam acceleration time was 2254 hr in academic year 1985. A new prebuncher was tested, and improvement was found in the beam width and beam utilization factor. A postbuncher was installed in the high energy beam line, and tested with beam. The construction of a new polarized ion source is in progress. Its ECR positive ion source has been completed and tested. Also a new Wien filter was installed, and the spin filter was calibrated. A new data taking and analyzing system ''SHINE'' has been developed, and its first version has been completed and used for experimental work. The CAMAC system has been used for the interface between the VAX 11 computer and the electronic modules for data acquisition. The experimental techniques for detectors, nuclear polarization work, heavy ion-induced nuclear physics, the study on charge exchange, the ion-induced emission of secondary electrons, ion backscattering spectrometry, application of Moessbauer effect and NMR and so on are reported. (Kako, I.)

  7. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1983-01-01

    The 12 UD Pelletron tandem accelerator has been operated for seven years without serious trouble since the first beam was obtained in February, 1976. In the last year, the tank was opened five times for minor repair, but the operation of 3977 hours has been attained. The construction of a heavy ion post accelerator with interdigital-H type structure has been continued. The research works described in this report were carried out mainly using the beam from a Lamb-shift type polarized ion source or a sputtering ion source. To the Lamb-shift type polarized ion source, a fast spin-reversal system was newly added, and successfully tested. In the sputtering ion source, the beam intensity was increased. A combination of an ionization chamber and a position-sensitive solid state detector was tested to be used for the study on heavy ion nuclear reaction. The characteristics of avalanche along the anode wire in a gas counter were studied. The accelerator and experimental facilities, the development of experimental equipment, and the researches on nuclear physics, atomic and solid state physics, and biological and medical science are reported. (Kako, I.)

  8. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1984-01-01

    The 12 UD Pelletron tandem accelerator was operated very stably through the period covered by this annual report. It was shut down for two weeks to inspect the SF 6 gas transfer system. The construction of a heavy ion post accelerator with interdigital-H structure has been completed, and chlorine ions have been accelerated to 2 MeV per charge. Effort was exerted to develop radiation detectors and a polarimeter. A windowless Si(Li) X-ray detector for PIXE was constructed, and the K X-ray of oxygen was able to be detected with high efficiency. The use of incombustible gas for ionization chambers was tested to detect the heavy ions of low Z and low energy, and nitrogen was available. A time-zero detector for heavy ion mass identification using two microchannel plates and a more elaborate high efficiency gamma detection system with six NaI (Tl) detectors and two Ge(Li) detectors were constructed. VAX 11/750-VAX 11/780 computer system was installed. Most of the research works were conducted, using the beam from the Lamb-shift polarized ion source. The studies on fusion reaction using heavy ions have been continued. The accelerator and experimental facilities, and the researches in the fields of nuclear physics, atomic and solid state physics, and biology and medical science are reported. (Kako, I.)

  9. Annual report of the Tandem Accelerator Center, University of Tsukuba

    International Nuclear Information System (INIS)

    1987-01-01

    During the academic year 1986, from April 1986 to March 1987, efforts have been paid to the improvement of ion sources, both for polarized- and heavy-ion beams, carbon stripper foils and detection systems, as well as to the construction of new beam lines and new scattering chambers. In the field of nuclear physics with light-ion beams, the elastic scattering of polarized deuterons has been studied extensively and systematically. The spin-flip of polarized protons during inelastic scattering was investigated. The study of heavy-ion induced nuclear reactions has also progressed steadily. The measurement of characteristic X-rays and γ-rays in coincidence with fusion-evaporation residues and projectile-like products has provided interesting new results. The study of nuclear structure through γ-rays provided more systematical knowledge about those of Ba isotopes. Studies on fission and other reactions are in progress. The collaboration between theoretical and experimental nuclear physicists has become tighter, especially in the study of nuclear structure. In atomic physics, it has become possible to estimate the mean number of electrons inside of solids through the collision of Cu ions incident on foils of various elements. In the field of solid state physics, the study of channeling and shadowing with secondary electrons has led to a generel rule between the channeling and lattice constants. Rutherford backscattering studies using heavy-ion beams have been developed for the stoichiometry of materials applied for infrared imaging, as well as the application studies for the recovery of radiation damage of material to be used in fusion reactors. For the application in medical science, the breaks and repair of DNA strands after α-irradiation were investigated. Without accelerated beams, Moessbauer studies of thin foils and the study of polarons and bipolarons in quasi-one-dimensional conductors were pursued. (author)

  10. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae e os predadores Phytoseiulus macropilis (Banks e Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae Effects of neem on tetranychus urticae Koch (Acari: Tetranychidae and the predators Phytoseiulus macropilis (Banks and Neoseiulus Californicus (Mcgregor (Acari: phytoseiidae

    Directory of Open Access Journals (Sweden)

    Daniele Cristine Hoffmann Schlesener

    2013-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.The aim of the present study was to evaluate the efficiency of control and adverse effects of two neem based products: Azamax TM (Azadirachtin A/B 12g/L and Neemseto TM (Azadirachtin A/B, Nimbin and Salanin 2,389 g/L over two-spotted spider mite Tetranychus urticae and the predators Phytoseiulus macropilis and Neoseiulus californicus in laboratory. Effects over the mortality, fecundity, eggs and biological persistence of the two-spotted spider mite when treated with neem based products were evaluated. For the phytoseiids the effects on mortality and fecundity were evaluated. The maximum mortality of two-spotted spider mites rates observed were 89.7% and 91.5% for Azamax TM and Neemseto TM respectively, on the 0.5% concentration after reapplying the product on the seventh day. Adverse effects were also observed over the fecundity and viability of the eggs when treated with

  11. Comunicação científica eficiência de inseticidas à base de nim no controle de Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae Efficiency of neem insecticides in the control of Grapholita molesta (Busck, 1916 (Lepidoptera: Tortricidae

    Directory of Open Access Journals (Sweden)

    Oderlei Bernardi

    2010-03-01

    Full Text Available O objetivo foi avaliar a eficiência de inseticidas à base de nim no controle da mariposa-oriental G. molesta em laboratório. A dieta artificial foi cortada em cubos e imersa nas caldas dos respectivos tratamentos; em seguida, lagartas recém-eclodidas foram transferidas para tubos de vidro, contendo os cubos de dieta tratados. Os produtos testados foram: NeemAzal-T/S®, Dalneem emulsionável®, Organic Neem® e Natuneem Agrícola® na concentração de 0,5% do produto comercial (p.c. em comparação com o inseticida químico fenitrotion (Sumithion 500 CE® a 0,15% p.c. e uma testemunha (água. Os inseticidas NeemAzal-T/S® e Dalneem emulsionável® apresentaram a mortalidade de 100% das lagartas, sendo eficientes no controle do inseto em condições de laboratório. Organic Neem® e Natuneem Agrícola® demonstraram menor atividade inseticida, ocasionando mortalidade de 73,5% e 22,5%, respectivamente; no entanto, afetaram significativamente a viabilidade larval.The objective was to evaluate the efficiency of neem insecticides in the control of oriental fruit moth Grapholita molesta at laboratory. The artificial diet was cut in cubes and immersed in the syrups of the respective treatments, soon afterwards, recently-emerged caterpillars were transferred, for glass tubes, containing the diet cubes treated. The tested products were: NeemAzal-T/S®, Dalneem emulsionável®, Organic Neem® and Natuneem Agrícola® in the concentration of 0.5% of the commercial product (p.c. compared with the chemical insecticide fenitrotion (Sumithion 500 CE® to 0.15% p.c. and a witness (water. The insecticides NeemAzal-T/S® and Dalneem emulsionável® presented a mortality of 100% of the caterpillars being efficient in the control of the insect in laboratory conditions. Organic Neem® and Natuneem Agrícola® demonstrated lower insecticidal activity, causing mortality of 73.5% and 22.5% respectively, however, significantly affect the larval viability.

  12. ONEČIŠĆENJE MORA PLASTIČNIM OTPADOM

    OpenAIRE

    Kovač, Nikolina; Serdarušić, Ana

    2017-01-01

    Onečišćenje okoliša jedan je od najvećih problema s kojim se susreće današnje društvo. Iako se počelo sve više govoriti o zagađenju okoliša i koliko ono utječe kako na ljude, tako i na biljni i životinjski svijet, još nema dovoljne osviještenosti čovjeka o tom izuzetno bitnom problemu za našu budućnost. Iako postoje razna onečišćenja okoliša, mi ćemo se osvrnuti na onečišćenje mora. Do onečišćenja mora može doći na razne načine kao npr. otpadnim vodama, balastnim vodama, pogonskim uljima, naf...

  13. List of unrestricted NIM publications issued from 1966 to 1977

    International Nuclear Information System (INIS)

    Glen, H.W.

    1977-01-01

    This publication lists the 632 unrestriced reports, 232 papers, and 17 patents published by the National Institute for Metallurgy from 1966 (the year of its inception) to 1st April, 1977. For ease of reference, these publications are also classified under the research programmes that gave rise to them [af

  14. List of unrestricted NIM reports and papers published during the first decade of NIM'S existence (1966 to 1975)

    International Nuclear Information System (INIS)

    Paynter, J.C.; Glen, H.W.

    1976-01-01

    This publication lists the 554 unrestricted reports and 200 papers published by the National Institute for Metallurgy during the first ten years of its existence. For ease of reference, these publications are also classified under the research programmes that gave rise to them [af

  15. USE OF OIL AND AQUEOUS EXTRACT OF NEEM SEEDS, AZADIRACHTIN AND ACEPHATE TO CONTROL COWPEA BLACK APHID ÓLEO E EXTRATO AQUOSO DE SEMENTES DE NIM, AZADIRACTINA E ACEFATO NO CONTROLE DO PULGÃO-PRETO DO FEIJÃO-DE-CORDA

    Directory of Open Access Journals (Sweden)

    Fernando Henrique Teixeira Gomes

    2010-05-01

    ="font-size: small;"> 1.0% was the most efficient azadiracthin trademark (91.35%. Azadiracthin products were efficient to control cowpea black aphid, under greenhouse conditions.

    KEY-WORDS: Vigna unguiculata; Azadiracta indica; Aphis craccivora Koch; botanical insecticides; alternative control.

     

    Avaliou-se a eficácia de diferentes formulações comerciais e extrato aquoso da semente de nim (Azadiracta indica, no controle do pulgão-preto (Aphis craccivora em feijão-de-corda (Vigna unguiculata. A unidade experimental constou de uma planta cultivada em um copo plástico de 300 mL, em casa-de-vegetação. Os tratamentos foram: 1 testemunha absoluta (água; 2 acefato (Orthene® 750 BR, 1,0 g do produto comercial (p. c. L-¹; 3 Natuneem® (10 mL p. c. L-1; 4 Neenmazal T/S® 1,0% (10 mL p. c. L-1; e 5 Extrato aquoso da semente (100 g L-1. A infestação, com seis fêmeas adultas e ápteras, foi realizada 15 dias após o plantio (DAP e a aplicação por pulverização aos 17 DAP. A avaliação foi realizada dois dias após a aplicação dos tratamentos, contando-se os pulgões vivos. Todos os compostos à base de

  16. Informe científico de investigador: Rendtorff Birrer, Nicolás Maximiliano (2012)

    OpenAIRE

    Rendtorff Birrer, Nicolás Maximiliano

    2012-01-01

    Desarrollo mi trabajo en el Centro de tecnología de recursos Minerales y cerámica (CETMIC) perteneciente a la CIC y al CONICET, en el grupo de materiales cerámicos liderado por el Dr. E Aglietti. Al mismo tiempo coordino las actividades del sub-grupo de materiales cerámicos tradicionales y participo de diversas colaboraciones científicas nacionales e internacionales. En particular con el Advance ceramic processing group, NIMS, Tsukuba Japón, con el grupo de materiales cerámicos del IFLP (CONI...

  17. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1994 - March 31, 1995

    International Nuclear Information System (INIS)

    1995-10-01

    During the period from April 1994 to March 1995, the tandem accelerator was operated successfully to provide sufficient beam time for experiments. The following research activities are described in this annual report: 1)nuclear reaction studies aiming at the (p, n) threshold effect on the elastic scattering of protons on light nuclei, the measurement of the cross section of non-resonant breakup of 7 Li, the establishment of a new analyzing-power standard by the 12 C(d vector, p) 13 C reaction and the evaluation of the fission time scale for a hot compound nucleus; 2)nuclear structure physics by means of in-beam γ ray spectroscopy; 3)theoretical studies on nuclear collective motions and the structure of odd-odd nuclei; 4)radiation effects of low energy deuterons in silicon; 5)dynamics of collisions between heavy ions and C 60 clusters; 6)detailed investigation of the lattice disorder and some other properties of the surface of solid by ion-induced secondary electron spectroscopy; 7)the migration mechanism of self interstitial atoms by the measurement of internal friction for W specimens after the proton bombardment at low temperature; 8)Moessbauer studies on Fe/MgF 2 thin films; 9)the mechanism of phase transition and electron transport phenomena by NMR method; 10)elemental analyses by PIXE, ion luminescence and Rutherford back scattering; 11)tests of 14 C measurement for geophysical samples by accelerator mass spectrometry. In addition to these research works, the constructions of the ion source dedicated to the accelerator mass spectrometry and the irradiation system for PIXE with beams of submillimeter size have been continued as new technical developments. (J.P.N.)

  18. Proceedings of the 1977 linear accelerator meeting in Japan, Tsukuba, November 30 - December 1, 1977

    International Nuclear Information System (INIS)

    Tanaka, Jiro; Sato, Isamu

    1978-03-01

    Linear accelerators are now diversifying in usage, including the fields beyond nuclei and elementary particles. In the meeting, reflecting these recent developments, the following were discussed and report made are presented: beam blow-up, beam loading and bunched-beam structure, and single bunches occurrence and measurement. (Mori, K.)

  19. Atmospheric Radionuclides from the FDNPP Accident-Four years' observations in Tsukuba, Japan and immediate resuspension

    Science.gov (United States)

    Igarashi, Yasuhito; Kajino, Mizuo; Zaizen, Yuji; Adachi, Kouji; Mikami, Masao

    2015-04-01

    The accident of Fukushima Dai-Ichi Nuclear Power Plant (FDNPP) of the Tokyo Electric Power Corporation arisen by the hit of great earthquake and tsunami in March 11, 2011, emitted abundant fresh radioactive material to the atmospheric environment. With 4-years' observation for the Fukushima radioactivity at the Meteorological Research Institute, Japan (MRI) the persisting resuspension has been observed. The resuspension seems still in difficulty to give forecast by computer modeling; the observations are indispensable bodies of the research even in the future. As a primary approach, immediate re-suspension factors were roughly estimated with modeled deposition amounts by the first plume to the Kanto district and the observed minimum activity concentration between two plume events, i.e. Mar 17 09JST to Mar. 20 09JST, by assuming mass closure between re-suspension from the contaminated surface and outflow by horizontal advection and turbulence vertical mixing as follows: Diki ΔCi- Δ2Ci- Δz = U Δx + Kz Δz2 , where i indicates radionuclides namely 137Cs and 131I, Diindicates modeled total (gas+aerosol) cumulative deposition (Bq/m2) by Mar 17 09JST, ki is the re-suspension factor (/s), U and Kz are modeled space- and time- averaged horizontal wind speed (m/s) and vertical turbulent diffusivity (m2/s), respectively, Ci indicates time-averaged observed concentration of radionuclides (9.75×10-4 and 3.14×10-1 Bq/m3 for 137Cs and 131I, respectively), and Δx and Δz are horizontal and vertical length of space where the above mass closure is obtained. In order to obtain the horizontal and vertical gradient terms on the right hand of the equation, concentrations outside the space are assumed zero (no inflow to the space). The re-suspension factors for 137Cs and 131I are 7.0×10-6 and 5.3×10-4 (/s), respectively, for the smallest volume of space (Δx and Δz are 3 km and 100 m, respectively). Those for 137Cs and 131I varied 1.6×10-6-1.5×10-5 (6.1×10-6 on average) and 5.3×10-4-1.3×10-3 (4.6×10-4 on average), respectively, for the various spaces of horizontally plus-minus zero, one, or two grids from the grid center (i.e. Δx = 3, 9, or 15 km) and vertically plus zero, one, or two grids from the bottom (Δz = 100, 200 or 400 m). In summary, the immediate re-suspension factors for 137Cs and 131I are estimated in the order of 10-6-10-5 (/s) and 10-4-10-3 (/s) respectively and then that of 131I is approximately two orders of magnitude larger than that of 137Cs.

  20. Atmospheric Radionuclides from the Fukushima Nuclear Accident-Two years observations in Tsukuba, Japan

    Science.gov (United States)

    Igarashi, Yasuhito; Kajino, Mizuo; Zaizen, Yuji; Adachi, Koji; Mikami, Masao; Kita, Kazuyuki; Hatano, Yuko

    2013-04-01

    The accident of Fukushima Dai-Ichi Nuclear Power Plant of the Tokyo Electric Power Corporation arisen by the hit of great earthquake and tsunami in March 11, 2011, emitted abundant fresh radioactive material to the atmospheric environment. The amount has been estimated to be at least a few-tenth of those from the Chernobyl accident (by NISA, etc.). By this large-scale contamination, atmospheric environments over Japan, especially the eastern part, were seriously impacted with such a massive amount of the anthropogenic radionuclides (e.g. typical hotspots). So the persisting aftermath is one of the concerns. Although the heavy primary emission seems to be terminated until April of 2011, 2ndary emissions from contaminated ground surface, coppices, fields, roads, any burnings of the contaminated materials generated the resuspension of radionuclides into the atmosphere. With 2-years observation for the Fukushima radioactivity at the Meteorological Research Institute, Japan (MRI) such persisting resuspension is considered in this presentation. The resuspension seems still in difficulty to give forecast by computer modeling; the observations are indispensable bodies of the research even in the future. The MRI has carried out observations of the atmospheric radionuclides, which are long-lived with potentials of environmental and health impacts, for more than 50 years. Aiming at to clarify temporal change in concentration of anthropogenic radionuclides in the atmosphere and its control factors, the observations have continued over the long period. The long-lasting impacts of the Fukushima accident are addressed with our long-term time series of the atmospheric radioactivity as a reference.

  1. Simulation of CO2 concentrations at Tsukuba tall tower using WRF ...

    Indian Academy of Sciences (India)

    1School of Environmental Studies, Jadavpur University, Kolkata 700 032, India. ... nental or coastal sites is challenging because of coarse horizontal resolution of ... Here the regional Weather Research and Forecasting (WRF) model coupled .... at nine-towers regional networks during North ..... ond case, it falls to ≥0.57.

  2. Annual report of the Tandem Accelerator Center, Nuclear and Solid State Research Project, University of Tsukuba

    International Nuclear Information System (INIS)

    1981-01-01

    During the academic year 1980 - 1981, the 12 UD Pelletron tandem accelerator in UTTAC has experienced several troubles. The accelerator tank had to be opened six times including the scheduled overhaul. Due to these troubles, both the beam time and the chain operation time were reduced by 20% as compared with the preceding year. However, the beam pulsing system was completed, and pulsed beam has been in use. The polarized ion source and the sputter ion source have worked well. A heavy ion booster with interdigital H-structure was designed, and has been under construction. Special efforts have been exerted on the detectors and detector systems. The examples of the achievements mainly associated with the Nuclear and Solid State Research Project are enumerated as follows. The complete experiment on d-p system provided the data on nuclear three body problem. The information about the mechanism of two-nucleon transfer reaction (p,t) was obtained. The mechanisms of (p,p) and (p,d) reactions were clarified. The experiment on the measurement of the magnetic moment of β-emitting products with polarized beam began. The properties of very highly excited states were clarified by the study of heavy ion-induced reactions. A new model for heavy ion fusion reaction was proposed. The mechanism of inner shell ionization was clarified by passing heavy ions through solids. (Kako, I.)

  3. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1997 - March 31, 1998

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-06-01

    This report briefly described the investigations performed during the period from April 1997 to March 1998 in Tandem Accelerator Center. The 12 UD Pelletron tandem accelerator was reconstructed and the first beam test was carried out in Nov. 1997. In nuclear physics, the measurement of total reaction cross sections, the non-resonant breakup of {sup 7}Li and {sup 9}Be, the investigation of hole states via (p,d) reaction, nuclear structure physics by means of in-beam {gamma} ray spectroscopy and the study of the three dimensional cranking model have been performed. In interdisciplinary fields, the development of AMS system has been continued. The trace element analysis of mineral samples has been carried out by means of PIXE with the proton beam which was focused on the sample as narrow as 50 {mu}m{sup 2}. The hydrogen analysis using H({sup 19}F,{alpha}{gamma}) reaction has been started aiming at the extension of the measurement of depth profile down to a few tens of {mu}m deep region. (M.N.)

  4. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1995 - March 31, 1996

    International Nuclear Information System (INIS)

    1996-10-01

    This annual report includes the research activities from April, 1995 to March, 1996. The 12 UD Pelletron tandem accelerator has been operated successfully to provide sufficient beam time for experiments. The stable operation of the accelerator brought out steady advances in many investigations continued as long range projects. Those are polarization phenomena in nuclear reactions, the nonresonant breakup of Li-7, further refinement of continuum discretized coupled channels theory, fusion and fission in heavy ion reactions, nuclear structure physics by means of in-beam γ ray spectroscopy, solid state physics using fast ion beams, Moessbauer effect, NMR, and the application of accelerated ion beams to PIXE and accelerator mass spectrometry. As the new developments of experimental instruments, an ion source for micro-cluster beams and a pulsing system for low velocity cluster ions have been successfully constructed. A beam line producing proton micro-beam has been constructed. In this report, the accelerator and experimental facilities, the experiments and theories of nuclear physics, atomic and solid state physics, ion beam applications, publications, theses and seminars, and personnel are reported. (K.I.)

  5. Annual report of the Tandem Accelerator Center, Nuclear and Solid State Research Project, University of Tsukuba

    International Nuclear Information System (INIS)

    1982-01-01

    After the satisfactory and busy operation of the 12 UD tandem accelerator for five years, the accelerating tubes showed the symptom of deterioration mainly due to stain, so that a few tubes were changed. In spite of this trouble, the operation over 3000 hours was maintained. The development of peripheral apparatus around the tandem accelerator and detectors was made. Above all, a beam pulsing system was successfully installed. The experimental works on nuclear physics were directed to the studies on polarization phenomena and heavy ion-induced reactions. The importance of the two-step process in the reaction mechanism was established. As the remarkable theoretical progress, a self-consistent collective coordinate method for the large amplitude collective motion was successfully developed, and the boson expansion theory was refined. The yield of X-ray and radiative electron capture and the equilibrium charge state in the collision of heavy ions were studied in detail. By the back scattering of 18 MeV alpha particles channeled in solid state, the shift of resonant peak energy was clearly observed, thus the influence of lattice effect in crystals was shown. (Kako, I.)

  6. Proceedings of the meeting on the planning of the photon factory accelerators, Tsukuba, October 25, 1977

    International Nuclear Information System (INIS)

    Ando, Masami; Ohta, Toshiaki

    1978-03-01

    For Photon Factory Accelerators planned in the National Laboratory for High Energy Physics, designs of a 2.5 GeV electron Linac and a 2.5 GeV storage ring are approaching to the final stage. Contents of the meeting with future users of the synchrotron radiation experimental facilities are presented: the injector and storage ring; and requirements for the beams in soft and hard x-ray regions. (Mori, K.)

  7. Annual report of the Tandem Accelerator Center, Nuclear and Solid State Research Project, University of Tsukuba

    International Nuclear Information System (INIS)

    1979-01-01

    During the academic year of 1978 to 1979, the 12 UD pelletron tandem accelerator has operated successfully. Ion species used were polarized p, polarized d, α(from the polarized ion source), p, d, 16 O and 18 O (from the direct extraction ion source), and C, O, Cu and Au (from the sputtering ion source). Improvements were made in the detector and data acquisition system. The data handling system 'SHINE' was completed and is in full operation. Research works are reported in individual summaries under the following chapters: accelerator and beam transport system, general equipments nuclear physics, atomic and solid-state physics, and biological and medical science and others. (Mori, K.)

  8. Current status of X-ray system at SHI Tsukuba facility

    International Nuclear Information System (INIS)

    Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.

    1992-01-01

    Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)

  9. Practice and Experience of Task Management of University Students: Case of University of Tsukuba, Japan

    Science.gov (United States)

    Fukuzawa, Ryoko; Joho, Hideo; Maeshiro, Tetsuya

    2015-01-01

    This paper reports the results of a survey that investigated the practice and experience of task management of university students. A total of 202 tasks identified by 24 university students were analyzed. The results suggest that participants had a reasonable sense of priority of tasks, that they tend to perceive a task as a big chunk, not a…

  10. Annual report of the Tandem Accelerator Center, University of Tsukuba. April 1, 1997 - March 31, 1998

    International Nuclear Information System (INIS)

    1998-06-01

    This report briefly described the investigations performed during the period from April 1997 to March 1998 in Tandem Accelerator Center. The 12 UD Pelletron tandem accelerator was reconstructed and the first beam test was carried out in Nov. 1997. In nuclear physics, the measurement of total reaction cross sections, the non-resonant breakup of 7 Li and 9 Be, the investigation of hole states via (p,d) reaction, nuclear structure physics by means of in-beam γ ray spectroscopy and the study of the three dimensional cranking model have been performed. In interdisciplinary fields, the development of AMS system has been continued. The trace element analysis of mineral samples has been carried out by means of PIXE with the proton beam which was focused on the sample as narrow as 50 μm 2 . The hydrogen analysis using H( 19 F,αγ) reaction has been started aiming at the extension of the measurement of depth profile down to a few tens of μm deep region. (M.N.)

  11. Multipurpose beam pulsing system for the 12UD Pelletron tandem accelerator at the University of Tsukuba

    Energy Technology Data Exchange (ETDEWEB)

    Furuno, Kohei; Fukuchi, Yasuhiko; Kimura, Takashige; Maeoka, Hidenobu; Ishii, Satoshi; Aoki, Takayoshi

    1983-10-01

    A beam pulsing system has been developed for a 12 MV tandem accelerator. The system consists of a pre-acceleration chopper, a klystron buncher and a post-acceleration chopper. The pre-acceleration chopper comprises a slow chopper and a fast travelling-wave chopper. Pulsed beams with widths in the range from 10 ..mu..s to --2 s are obtained with the slow chopper, and the repetition periods can be varied from 70 ..mu..s to 4s. The fast chopper produces ion bursts having widths between 0.05 and 0.8 ..mu..s with a duty factor of --10%. The buncher is operated with the two choppers to obtain beam pulses as narrow as a few nanoseconds. Time-of-flight measurements yielded pulse widths 2-4 ns (FWHM) wide for ions in the mass range 1 <= A <= 28. The ratio of the dark to peak ion current was usually of the order of 10/sup 4/.

  12. Non-Indigenous Marine Species (NIMS) in Biofouling on RAN Vessels: Threat Analysis

    Science.gov (United States)

    2015-09-01

    Gulf of Mexico, and its range extends from the Caribbean to Brazil and Hawaii. It was first recorded in Australia on the German barque “Gorch Flock” in...4.2.2.10 Paracaprella pusilla (caprellid) P. pusilla is a tropical species native to Rio de Janeiro, Brazil and now common along the Atlantic coast...is found predominately in mangrove areas common to this region. This species was identified on HMAS Wewak (May 2004) on its return to HMAS Cairns

  13. EVALUATION OF CO-PRODUCT OF VERMICULITE AS SUBSTRATE IN SEEDLINGS PRODUCTION OF NIM

    Directory of Open Access Journals (Sweden)

    G. H. Silva

    2014-09-01

    Full Text Available This study evaluated the effect of different doses of organic matter and fertilizer PK neem seedlings grown in co-product of vermiculite. At the end of the experiment, the seedlings were separated into root, stem and leaves, then the material was placed in an oven and subsequent weighing. The parameters evaluated were: height, diameter, number of leaves, root length, IQD (Dickson quality index and TDM (total dry mass. The design used in the experiment was the DIC with seven levels of organic matter (OM (0, 5, 10, 15, 20, 25, 30% and three fertilization PK (Phosphorus and Potassium (PK0, PK100, PK300 with four replications. For doses of OM and fertilization was applied polynomial regression grade 2 at 5% of probability. The results of the analysis of variance showed that there were significant positive quadratic effect among all levels of treatment with OM on all variables. However, all variables were not statistically different for PK and PK + OM in all parameters evaluated. Thus the species under study shows no demand of chemical fertilizer in their early growth stages. The IQD values at a dose of 20% of OM indicate higher rates of development. The dose of 5% of OM in co-product of vermiculite is enough to produce seedlings of nem of good quality.

  14. Comparisons between digital gamma-ray spectrometer (DSPec) and standard nuclear instrumentation methods (NIM) systems

    International Nuclear Information System (INIS)

    Vo, D.T.; Russo, P.A.; Sampson, T.E.

    1998-03-01

    Safeguards isotopic measurements require the best spectrometer systems with excellent resolution, stability and throughput. Up until about a year ago, gamma ray spectroscopy has always been done using the analog amplifier, which processes the pulses from the preamplifier to remove the noise, reject the pile up signals, and shape the signals into some desirable form before sending them to the analog to digital converter (ADC) to be digitized. In late 1996, EG and G Ortec introduced a digital gamma ray spectrometer (DSPec) which uses digital technology to analyze the preamplifiers' pulses from all types of germanium and silicon detectors. Considering its performance, digital based spectroscopy may become the way of future gamma ray spectroscopy

  15. Vacuum Radiance-Temperature Standard Facility for Infrared Remote Sensing at NIM

    Science.gov (United States)

    Hao, X. P.; Song, J.; Xu, M.; Sun, J. P.; Gong, L. Y.; Yuan, Z. D.; Lu, X. F.

    2018-06-01

    As infrared remote sensors are very important parts of Earth observation satellites, they must be calibrated based on the radiance temperature of a blackbody in a vacuum chamber prior to launch. The uncertainty of such temperature is thus an essential component of the sensors' uncertainty. This paper describes the vacuum radiance-temperature standard facility (VRTSF) at the National Institute of Metrology of China, which will serve to calibrate infrared remote sensors on Chinese meteorological satellites. The VRTSF can be used to calibrate vacuum blackbody radiance temperature, including those used to calibrate infrared remote sensors. The components of the VRTSF are described in this paper, including the VMTBB, the LNBB, the FTIR spectrometer, the reduced-background optical system, the vacuum chamber used to calibrate customers' blackbody, the vacuum-pumping system and the liquid-nitrogen-support system. The experimental methods and results are expounded. The uncertainty of the radiance temperature of VMTBB is 0.026 °C at 30 °C over 10 μm.

  16. A 13-Bits wilkinson analog-digital converter for NIM acquisition system

    International Nuclear Information System (INIS)

    Acosta Toledo, R.; Osorio Deliz, J.; Arista Romeu, E.; Fernandez, J.

    1994-01-01

    A new 13-bits Wilkinson analog-digital converter is described. The aim of this work is to describe the circuits of sample and hold, memory condensator loading and releasing PROM based control memory logic, zero level detection and correction. The converter is designed for the digital measurement of the peak amplitudes of pulses with statistical or periodical time distribution. The analog-digital converter may be used in spectrometric systems, multi-channel analysers or any similar PC based system

  17. A guide to using the BL-6A2 synchrotron facilities at the photon factory, Tsukuba, Japan

    International Nuclear Information System (INIS)

    1992-08-01

    The Photon Factory (PF) consists of a 2.5 GeV electron/positron linear accelerator, a 2.5 GeV storage ring as a dedicated synchrotron light source, beam lines and experimental stations, to serve users synchrotron radiation (SR) for experiment. The 2.5 GeV linear accelerator is used as an injector for both PF ring and the accumulating ring (AR). It is currently capable of injecting positrons or electrons. The AR has been partly used as a high energy synchrotron radiation source from its bending magnets, and partly augmented with a new insertion device to produce elliptically polarized radiation. It has been operated for the users of synchrotron radiation at the energy from 5.8 to 6.5 GeV. With the electron beam in the storage ring for SR research, the instability of the beam is inevitable arising from ions or charged dust trapped by the beam. Therefore, positrons are used instead of electrons in order to completely overcome the difficulty. The wiggler produces vertically polarized radiation in the range of photon energy. The superconducting NbTi is well suitable to obtain high magnetic field. (K.I.)

  18. The status of Tsukuba BNCT trial: BPA-based boron neutron capture therapy combined with X-ray irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, T., E-mail: tetsu_tsukuba@yahoo.co.jp [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, Tennodai 1-1-1, Tsukuba (Japan)] [Department of Radiation Oncology, Graduate School of Comprehensive Human Science, University of Tsukuba, Tennodai 1-1-1, Tsukuba (Japan); Nakai, K. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, Tennodai 1-1-1, Tsukuba (Japan); Nariai, T. [Department of Neurosurgery, Tokyo Medical and Dental University, Yushima 1-5-45, Bunkyo-ku, Tokyo (Japan); Kumada, H.; Okumura, T.; Mizumoto, M.; Tsuboi, K. [Department of Radiation Oncology, Graduate School of Comprehensive Human Science, University of Tsukuba, Tennodai 1-1-1, Tsukuba (Japan); Zaboronok, A.; Ishikawa, E.; Aiyama, H.; Endo, K.; Takada, T.; Yoshida, F.; Shibata, Y.; Matsumura, A. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, Tennodai 1-1-1, Tsukuba (Japan)

    2011-12-15

    The phase II trial has been prepared to assess the effectiveness of BPA (250 mg/kg)-based NCT combined with X-ray irradiation and temozolomide (75 mg/m{sup 2}) for the treatment of newly diagnosed GBM. BPA uptake is determined by {sup 18}F-BPA-PET and/or {sup 11}C-MET-PET, and a tumor with the lesion to normal ratio of 2 or more is indicated for BNCT. The maximum normal brain point dose prescribed was limited to 13.0 Gy or less. Primary end point is overall survival.

  19. A clinical trial protocol for second line treatment of malignant brain tumors with BNCT at University of Tsukuba

    Energy Technology Data Exchange (ETDEWEB)

    Aiyama, H. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Nakai, K., E-mail: knakai@Neurosurg-tsukuba.com [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Yamamoto, T. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan)] [Department of Radiation Oncology, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Nariai, T. [Department of Neurosurgery, Tokyo Medical and Dental University, 1-5-45 Yushima, Bunkyouku (Japan); Kumada, H. [Department of Radiation Oncology, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Ishikawa, E. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Isobe, T. [Department of Radiation Oncology, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan); Endo, K.; Takada, T.; Yoshida, F.; Shibata, Y.; Matsumura, A. [Department of Neurosurgery, Graduate School of Comprehensive Human Science, University of Tsukuba, 1-1-1 Tennodai, Tsukuba (Japan)

    2011-12-15

    We have evaluated the efficacy and safety of boron neutron capture therapy (BNCT) for recurrent glioma and malignant brain tumor using a new protocol. One of the two patients enrolled in this trial is a man with recurrent glioblastoma and the other is a woman with anaplastic meningioma. Both are still alive and no severe adverse events have been observed. Our findings suggest that NCT will be safe as a palliative therapy for malignant brain tumors. - Highlights: Black-Right-Pointing-Pointer Boron neutron capture therapy (BNCT) for recurrent glioma and malignant brain tumor. Black-Right-Pointing-Pointer Two cases with recurrent glioblastoma and anaplastic meningioma. Black-Right-Pointing-Pointer No severe adverse events have been observed using BNCT. Black-Right-Pointing-Pointer BNCT has a possibility of a safe palliative therapy for malignant brain tumors.

  20. Proceedings of the meeting on applications of microprocessors in accelerator controls and physics experiments, Tsukuba, March 15, 1978

    International Nuclear Information System (INIS)

    Shibata, Shinkichi; Katoh, Tadahiko

    1978-05-01

    The microprocessor was first made public in 1971. In the ensuing few years, its performance has risen, cost lowered and interface more in IC, so it is now easily incorporated in instrumentation and control. Since it is used as electronic component unlike the case of a minicomputer, it has so much larger influence. It differs from the conventional electronic components in that software is required. In the National Laboratory for High Energy Physics, microprocessors are used for performance improvements of the measuring and control instruments and for labor saving. For new component not to induce new other problems, support system and standardization are proceeding for utilization development etc. The present meeting was intended for discussions by people in the field of usage, planning, and means of joint uses for software and hardware. (Mori, K.)

  1. Science on form. Proceedings of the first international symposium, University of Tsukuba, Japan, November 26-30, 1985

    Energy Technology Data Exchange (ETDEWEB)

    Ishizaka, Shozo; Kato, Yoshihiro; Takaki, Ryuji; Toriwaki, Jun-ichiro [eds.

    1987-01-01

    The purpose of the Symposium was to discuss interdisciplinal science aspects of form. 'Form' depends on the material and the changes. But, it is the form that appears evident at once and endures. Form is absorbed from every field as media of information. One part of the work covers the description of non-periodic phenomena, morphogenesis or evolution. Irreducible stubborn facts as diseases or social problems, or whatever else that could not be analyzed are integrally challenged to be systematized by computer simulation. The other part covers the finding of laws for determining how systems behave. Attention should be paid to pattern recognition, image processing and pattern formation. The Symposium proceeded with no parallel sessions, and participants from various fields made exciting discussions in an interdisciplinal atmosphere. (Auth.).

  2. A clinical trial protocol for second line treatment of malignant brain tumors with BNCT at University of Tsukuba

    International Nuclear Information System (INIS)

    Aiyama, H.; Nakai, K.; Yamamoto, T.; Nariai, T.; Kumada, H.; Ishikawa, E.; Isobe, T.; Endo, K.; Takada, T.; Yoshida, F.; Shibata, Y.; Matsumura, A.

    2011-01-01

    We have evaluated the efficacy and safety of boron neutron capture therapy (BNCT) for recurrent glioma and malignant brain tumor using a new protocol. One of the two patients enrolled in this trial is a man with recurrent glioblastoma and the other is a woman with anaplastic meningioma. Both are still alive and no severe adverse events have been observed. Our findings suggest that NCT will be safe as a palliative therapy for malignant brain tumors. - Highlights: ► Boron neutron capture therapy (BNCT) for recurrent glioma and malignant brain tumor. ► Two cases with recurrent glioblastoma and anaplastic meningioma. ► No severe adverse events have been observed using BNCT. ► BNCT has a possibility of a safe palliative therapy for malignant brain tumors.

  3. PREFACE: The International Conference on Superconductivity and Magnetism (ICSM2008) (Side, Turkey, 25-29 August 2008) The International Conference on Superconductivity and Magnetism (ICSM2008) (Side, Turkey, 25-29 August 2008)

    Science.gov (United States)

    Gencer, Ali; Grasso, Gianni

    2009-03-01

    Birmingham University R Huebener Tubingen University K Kadowaki NIMS, Tsukuba University M A R LaBlanch UO, CA E Inger Boren E Ozdas Hacettepe University H Ozkan METU, Ankara R Penko ASG V Vlasov Argonne National Laboratory Scientific Programme Committee E H Brandt Max-Planck-Institute, Stuttgart W Goldacker FZ Karlsruhe C Ferdeghini CNR INFM, Genova D M Hampshire Durham University Y Oner ITU, Instanbul B Aktas GYTE, Gebze B Ramaev GYTE, Gebze E Ozdas Hacettepe University—Coordinator M A Aksan Inonu University—Abstract Handling Local Organizing Committee S Safran Ankara University—General Secretary E Ertekin Ankara University—Registrar A Kilic Nigde University U Kolemen G O Pasa University K Guven Kirikkale University—Transport and Accommodation B Ozkurt Mersin University Ö Çiçek Renko D Bumin Boren S Altin Inonu University O Nane Çukurova University Editorial Board for Proceedings A Gencer Ankara University—Guest Editor G Grasso Columbus Superconductors SpA, Genova—Guest Editor B Aktas GYTE, Gebze I Belenli Hakkari University M A Aksan Inonu University—Scientific Secretary M I J Probert York University M E Yakinci Inonu University A Bozbey TOBB, University of Economics and Technology Finance Director S Kervan Nevsehir University Bursary Coordinator H Agil Ankara University

  4. PREFACE: International Conference on Superconductivity and Magnetism-ICSM2008

    Science.gov (United States)

    Gencer, Ali; Grasso, Gianni

    2009-03-01

    Karlsruhe C E Gough Birmingham University R Huebener Tubingen University K Kadowaki NIMS, Tsukuba University M A R LaBlanch UO, CA E Inger Boren E Ozdas Hacettepe University H Ozkan METU, Ankara R Penko ASG V Vlasov Argonne National Laboratory Scientific Programme Committee E H Brandt Max-Planck-Institute, Stuttgart W Goldacker FZ Karlsruhe C Ferdeghini CNR INFM, Genova D M Hampshire Durham University Y Oner ITU, Instanbul B Aktas GYTE, Gebze B Ramaev GYTE, Gebze E Ozdas Hacettepe University—Coordinator M A Aksan Inonu University—Abstract Handling Local Organizing Committee S Safran Ankara University—General Secretary E Ertekin Ankara University—Registrar A Kilic Nigde University U Kolemen G O Pasa University K Guven Kirikkale University—Transport and Accommodation B Ozkurt Mersin University Ö Çiçek Renko D Bumin Boren S Altin Inonu University O Nane Çukurova University Editorial Board for Proceedings A Gencer Ankara University—Guest Editor G Grasso Columbus Superconductors SpA, Genova—Guest Editor B Aktas GYTE, Gebze I Belenli Hakkari University M A Aksan Inonu University—Scientific Secretary M I J Probert York University M E Yakinci Inonu University A Bozbey TOBB, University of Economics and Technology Finance Director S Kervan Nevsehir University Bursary Coordinator H Agil Ankara University

  5. Ogrodja JavaScript in orodja za razvoj za odjemalca: primerjava in ovrednotenje z empiričnim modelom

    OpenAIRE

    Podbojec, Damir

    2017-01-01

    V magistrskem delu je predstavljen razvoj JavaScripta skozi čas, moderna ogrodja JavaScript, ki se uporabljajo za razvoj dinamičnih spletnih aplikacij, in orodja za razvoj za odjemalca, ki pospešujejo in pripomorejo k celotnemu razvojniškemu procesu. Analizirana je arhitektura današnjih dinamičnih spletnih aplikacij ter osnovne funkcionalnosti ogrodij JavaScript in orodij za razvoj za odjemalca. V namen lažje diferenciacije med ogrodji in lažje izbire ogrodij za razvoj dinamičnih spletnih apl...

  6. Filling the Gap Between NIMS/ICS and the Law Enforcement Initial Response in the Age of the Urban Jihad

    Science.gov (United States)

    2010-09-01

    the “crisis typology ” and thus the effectiveness of a given crisis response (p. 250). The intensity of a crisis is increased when multiple problems...alley and opened fire on several police officers who had rushed to the scene; police unit “ Tourist 1 Mobile” reported by radio that “police driver...2009, p. 6; Pradhan & Balachandran, 2009, p. 36). Within seconds, 10 people were killed and 20 injured. Officers in nearby police unit, “ Tourist 1

  7. Cyclosporine A, FK506, and NIM811 ameliorate prolonged CBF reduction and impaired neurovascular coupling after cortical spreading depression

    DEFF Research Database (Denmark)

    Hansen, Henning Piilgaard; Witgen, Brent Marvin; Rasmussen, Peter

    2011-01-01

    Cortical spreading depression (CSD) is associated with mitochondrial depolarization, increasing intracellular Ca(2+), and the release of free fatty acids, which favor opening of the mitochondrial permeability transition pore (mPTP) and activation of calcineurin (CaN). Here, we test the hypothesis...

  8. Uso de CLAE no controle de qualidade em produtos comerciais de Nim: reprodutibilidade da ação inseticida

    OpenAIRE

    Forim,Moacir Rossi; Matos,Andréia Pereira; Silva,Maria Fátima das Graças Fernandes da; Cass,Quézia Bezerra; Vieira,Paulo Cezar; Fernandes,João Batista

    2010-01-01

    The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC) a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluat...

  9. Analiza kvalitete procesa sušenja u klasičnim komornim sušionicama

    OpenAIRE

    Sedlar, Tomislav; Pervan, Stjepan

    2010-01-01

    U radu su dani rezultati ispitivanja kvalitete sušenja u klasičnoj komornoj sušionici. Ispitivanje se temelji na novoj metodologiji kojom se prikazuje razina uspješnosti procesa sušenja na temelju analize kvalitete tog procesa u klasičnoj komornoj sušionici, korištenjem znanstveno unaprijeđene verzije liste provjere u svakodnevnoj praktičnoj primjeni. Za verificiranje nove metodologije ispitivanja izabrano je poduzeće koje se specijaliziralo za izradu lamel parketa i klasičnog parketa. U s...

  10. Prevalence of myopia and its risk factors in urban school children in Delhi: the North India Myopia Study (NIM Study.

    Directory of Open Access Journals (Sweden)

    Rohit Saxena

    Full Text Available Assess prevalence of myopia and identify associated risk factors in urban school children.This was a cross-sectional study screening children for sub-normal vision and refractive errors in Delhi. Vision was tested by trained health workers using ETDRS charts. Risk factor questionnaire was filled for children with vision 11 years children (p 5 hours per day (p 2 hours / day (p 2 hours in a day.Myopia is a major health problem in Indian school children. It is important to identify modifiable risk factors associated with its development and try to develop cost effective intervention strategies.

  11. Prevalence of myopia and its risk factors in urban school children in Delhi: the North India Myopia Study (NIM Study).

    Science.gov (United States)

    Saxena, Rohit; Vashist, Praveen; Tandon, Radhika; Pandey, R M; Bhardawaj, Amit; Menon, Vimala; Mani, Kalaivani

    2015-01-01

    Assess prevalence of myopia and identify associated risk factors in urban school children. This was a cross-sectional study screening children for sub-normal vision and refractive errors in Delhi. Vision was tested by trained health workers using ETDRS charts. Risk factor questionnaire was filled for children with vision 11 years) children (phistory (p 5 hours per day (p 2 hours / day (p video/mobile games (p 2 hours in a day. Myopia is a major health problem in Indian school children. It is important to identify modifiable risk factors associated with its development and try to develop cost effective intervention strategies.

  12. Research of Fine Art Management Based on the International Network of Fine Arts Universities: Report of the Exhibition "FINE ART / UNIVERSITY SELECTION" under the Sponsorship of Agency of Cultural Affairs, Government of Japan, Fiscal Year 2013-2017

    OpenAIRE

    HOSHI, Mika

    2017-01-01

    Art and Design Research for the Future: Innovation and Art & Design ; September 26, 2017Conference: Tsukuba Global Science Week 2017Date: September 25-27, 2017Venue: Tsukuba International Congress CenterSponsored: University of Tsukuba

  13. The "Stunde Null (Zero Hour)" for Japanese Art History in Germany

    OpenAIRE

    EGUCHI, Minami

    2017-01-01

    Art and Design Research for the Future: Innovation and Art & Design ; September 26, 2017Conference: Tsukuba Global Science Week 2017Date: September 25-27, 2017Venue: Tsukuba International Congress CenterSponsored: University of Tsukuba

  14. Intraoperative boron neutron capture therapy for malignant gliomas. First clinical results of Tsukuba phase I/II trial using JAERI mixed thermal-epithermal beam

    International Nuclear Information System (INIS)

    Matsumura, A.; Yamamoto, T.; Shibata, Y.

    2000-01-01

    Since October 1999, a clinical trial of intraoperative boron neutron capture therapy (IOBNCT) is in progress at JRR-4 (Japan Research Reactor-4) in Japan Atomic Energy Research Institute (JAERI) using mixed thermal-epithermal beam (thermal neutron beam I: TNB-I). Compared to pure thermal beam (thermal neutron beam II: TNB-II), TNB-I has an improved neutron delivery into the deep region than TNB-II. The clinical protocol and the preliminary results will be discussed. (author)

  15. International Symposium on Space Technology and Science (27th) (ISTA) Panel Discussion on Space Solar Power Systems, held in Tsukuba, Japan on 10 July 2009

    Science.gov (United States)

    2010-01-01

    Long term evaluation of change of the width of  forest  area(Rondonia,  Amazon )> Imagery data of “Himawari” Three‐dimensional situation of rain of...disaster relief, global environmental concerns, preservation and  care of  territorial  land and search for the natural resources, and also take

  16. Proton Beam Therapy for Patients With Medically Inoperable Stage I Non-Small-Cell Lung Cancer at the University of Tsukuba

    International Nuclear Information System (INIS)

    Nakayama, Hidetsugu; Sugahara, Shinji; Tokita, Mari; Satoh, Hiroaki; Tsuboi, Koji; Ishikawa, Shigemi; Tokuuye, Koichi

    2010-01-01

    Purpose: To evaluate in a retrospective review the role of proton beam therapy for patients with medically inoperable Stage I non-small-cell lung cancer (NSCLC). Patients and Methods: From November 2001 to July 2008, 55 medically inoperable patients with Stage I NSCLC were treated with proton beam therapy. A total of 58 (T1/T2, 30/28) tumors were treated. The median age of study participants was 77 years (range, 52-86 years). A total dose of 66 GyE in 10 fractions was given to peripherally located tumors and 72.6 GyE in 22 fractions to centrally located tumors. Results: The rates (95% confidence interval) of overall and progression-free survival of all patients and of local control of all tumors at 2 years were 97.8% (93.6-102.0%), 88.7% (77.9-99.5%), and 97.0% (91.1-102.8%), respectively. There was no statistically significant difference in progression-free rate between T1 and T2 tumors (p = 0.87). Two patients (3.6%) had deterioration in pulmonary function, and 2 patients (3.6%) had Grade 3 pneumonitis. Conclusion: Proton beam therapy was effective and well tolerated in medically inoperable patients with Stage I NSCLC.

  17. Highly stable ni-m f6-nh2o/onpyrazine2(solvent)x metal organic frameworks and methods of use

    KAUST Repository

    Eddaoudi, Mohamed; Adil, Karim; Belmabkhout, Youssef; Cadiau, Amandine

    2016-01-01

    Provided herein are metal organic frameworks comprising metal nodes and N-donor organic ligands. Methods for capturing chemical species from fluid compositions comprise contacting a metal organic framework characterized by the formula [MaMbF6-n(O/H2

  18. Spolne i dobne razlike u zdravstvenom statusu sportaša u pojedinačnim i momčadskim sportovima

    OpenAIRE

    Sindik, Joško; Šarac, Jelena; Grgurinović, Tonći; Tomić, Darko; Paušek, Drago; Missoni, Saša

    2016-01-01

    Main goal of this study was to determine the differences between the athletes who are actively engaged in team vs. individual sports, stratified by age groups and sex, in BMI (Body Mass Index) and other chosen biochemical health indicators. Second goal is directed on forecasting the criterium BMI, on the base of predictors (i.e. chosen morphological and biochemical health indicators, except body height and body mass), for the athletes from team and individual sports, s...

  19. REPELÊNCIA E DETERRÊNCIA ALIMENTAR DE VAQUINHAS POR ÓLEOS DE NIM E CINAMOMO APLICADOS EM FOLHAS DE FEIJOEIRO

    Directory of Open Access Journals (Sweden)

    BRUNO HENRIQUE SARDINHA DE SOUZA

    2014-01-01

    Full Text Available This work aimed to evaluate the repellent and deterrent effect of the application of concentra- tions of neem and chinaberry oil on bean leaves on the leaf beetles Diabrotica speciosa (Germar and Cero- toma arcuata (Olivier. The concentrations of neem oil tested were 0.625, 1.25, 2.50, 5.00, 10.00 and 20,00 mL, corresponding respectively to 1, 2, 4, 8, 17 and 33 ppm of azadirachtin A and the concentrations of china- berry oil used were the same used to neem oil, corresponding, however, to 1.875, 3.75, 7.50, 15.00, 30.00 and 60.00 mg mL-1 of chinaberry extract, respectively. For the free-choice tests, glass containers were used as are- nas, whereas for the no-choice tests Petri dishes were used, where in both one insect per treatment was released in the center. Attractiveness was evaluated in predetermined time periods, in addition to the leaf consumption, at the end of the experiment. Neem oil is repellent to D. speciosa and C. arcuata, with more efficient results at the 5.00, 10.00 and 20.00 mL concentrations. All concentrations of neem oil reduce leaf consumption of both insects, except in the no-choice test with D. speciosa, in which only the 10.00 and 20.00 mL concentrations are deterrent. Chinaberry oil provides high repellent activity on both leaf beetle species, and the 10.00 and 20.00 mL concentrations stood out. The 10.00 and 20.00 mL concentrations of chinaberry oil are deterrent to D. spe- ciosa and C. arcuata.

  20. UTJECAJ POSTTRAUMATSKOG STRESNOG POREMEĆAJA NA SINONAZALNE SIMPTOME, BOL I KVALITETU ŽIVOTA U PACIJENATA S KRONIČNIM RINOSINUITISOM

    OpenAIRE

    Shejbal, Dražen

    2015-01-01

    Kronični rinosinuitis (KRS) i posttraumatski stresni poremećaj (PTSP) bolesti su koje snažno utječu na kvalitetu života. Etiologija KRS je multifaktorijalna, s različitim upalnim mehanizmima koji izazivaju bolest. PTSP karakteriziran je stalnim i intenzivnim psihološkim stres reakcijama prema prethodnom traumatskom događaju koji je prouzročio bolest. Budući da su obje bolesti u Hrvatskoj i razvijenim zemljama učestale, očekivani komorbiditet je velik. KRS se dijagnosticira na temelju...

  1. ALELOPATIA DO NIM NOS ASPECTOS FISIOLÓGICOS DA GERMINAÇÃO DE SEMENTES DE MARACUJÁ EM DISTINTOS PERÍODOS DE ARMAZENAMENTO

    Directory of Open Access Journals (Sweden)

    Naedja Nara de Araujo Neves

    2008-01-01

    Full Text Available The passion fruit tree (Passiflora edulis Sims f. flavicarpa Deg. is a fruitful tree whose the propagation usually is made for seeds. With the objective to study the possible effects allelopathy of neem in the physiologic aspects in germination of seeds of passion fruit in the different periods of storage. Was carried at UFERSA. For the acquisition of powder of neem, it was used plants located in institution. In the obtaining of seeds of passion fruits, it was used in natura fruits bought in the local supermarket; this seeds were extracted of fruits for fermentation. It was placed 50g of seeds of passion fruits together with each measure of powder of leaves of neem (0; 0,25; 0,50; 0,75; 1,0 g of powder of leaves of neem / 50 g of seeds of passion fruits. It was utilized the randomized design in esquire of portions subdivides, where the portions was composed of five dosages of powder of leaves neem.

  2. Highly stable ni-m f6-nh2o/onpyrazine2(solvent)x metal organic frameworks and methods of use

    KAUST Repository

    Eddaoudi, Mohamed

    2016-10-13

    Provided herein are metal organic frameworks comprising metal nodes and N-donor organic ligands. Methods for capturing chemical species from fluid compositions comprise contacting a metal organic framework characterized by the formula [MaMbF6-n(O/H2O)w(Ligand)x(solvent)y]z with a fluid composition and capturing one or more chemical species from the fluid composition.

  3. Incidence and progression of myopia and associated factors in urban school children in Delhi: The North India Myopia Study (NIM Study.

    Directory of Open Access Journals (Sweden)

    Rohit Saxena

    Full Text Available To evaluate the incidence and progression of myopia and factors associated with progression of myopia in school going children in Delhi.Prospective longitudinal study of 10,000 school children aged 5 to 15 years screened after an interval of 1 year to identify new myopes (Spherical Equivalent≤ -0.5D and progression of myopia in previously diagnosed myopic children. Association between risk factors and progression was analyzed using adjusted odds ratio.Of the 9,616 children re-screened (97.3% coverage, annual incidence of myopia was 3.4%with mean dioptric change of -1.09 ± 0.55. There was a significant higher incidence of myopia in younger children compared to older children (P = 0.012 and among girls compared to boys (P = 0.002. Progression was observed in 49.2%children with mean dioptric change of -0.27 ± 0.42 diopters. The demographic and behavioral risk factors were analyzed for children with progression (n = 629 and adjusted odds ratio values were estimated. Hours of reading-writing/week (p 2 hours in a day were protective with an inverse association with progression of myopia (P< 0.001.Myopia is an important health issue in India and is associated with long hours of reading and screen time with use of computers and video games. An annual eye vision screening should be conducted, and outdoor activities be promoted to prevent the increase of myopia among school children.

  4. Prikaz knjige Srećka Stopića: Sinteza nanočestica metala ultrazvučnim raspršivanjem u uslovima pirolize / Review of a book by Srećko Stopić: Synthesis of metallic nanosized particles by ultrasonic spray pyrolysis / Обзор книги Сречка Стопича «Синтез наночастиц металлов ультразвуковым распылительным пиролизом»

    Directory of Open Access Journals (Sweden)

    Milena D. Stopić

    2015-10-01

    оторого отслеживаются в режиме онлайн. Сбор наночастиц проводится в электростатическом поле. Рост производственных объемов порошковых изделий, изготовленных методом ультразвукового распылительного пиролиза способствовал успешному внедрению данного метода для синтеза порошка серебра из раствора серебра нитрата. / Nanotehnologija pripada ključnim inovativnim tehnologijama za proizvodnju prahova. Raspršivanje prahova ultrazvučnom pirolizom višestruko je korišćeno za formiranje čestica nanoprahova metala, oksida i kompozita. Ovaj rad odnosi se na nanočestice srebra, bakra i zlata, formiranih ultrazvučnom pirolizom korišćenjem horizontalnog i vertikalnog reaktora. Direktna sinteza nanočestica na bazi Ru-TiO2 i RuO2-TiO2 sa strukturom sastavljenom od jezgra i ljuske dalje je ispitivana. Molarni udeli prekursora, tip rastvarača i procesna temperatura imaju odlučujuću ulogu u formiranju čestica sa ovom kombinovanom strukturom. Zatim, ispitivan je uticaj reakcionih parametara (temperatura, vreme zadržavanja, koncentracija rastvora i frekvencija ultrazvuka na morfološke karakteristike pripremanih nanočestica. Uvećanje temperature od 150°C do 1000°C vodi od jednog nepravilnog oblika do proizvodnje sfernih čestica. Nakon toga, bio je predložen model formiranja metalnih nanočestica od kapi aerosola. Korišćenjem procesa raspršivanja preko ultrazvučne pirolize idealno sferne čestice dobijene su na temperaturi ispod tačke topljenja. Uređaj za određivanje raspodele veličine čestica korišćenjem različite pokretljivosti čestica u elektrostatičkom polju korišćen je za on-line analizu tokom proizvodnje čestica. Sakupljanje nanočestica izvršeno je u elektrostatičkom polju. Uve

  5. Participation in the ARGUS experiment at the DORIS Collider at Desy, Hamburg, Germany and participation in the AMY experiment at the TRISTAN Collider in Tsukuba, Japan: 1986 progress report

    International Nuclear Information System (INIS)

    Darden, C.

    1987-01-01

    Progress is reported on the AMY and ARGUS detectors, as well as plans for the next funding period. The AMY detector is reported as well on the way to completion, but not yet ready to take data. The ARGUS detector is reported to have completed its fourth year of operation. Some upsilon 1S decay data are discussed. 37 refs

  6. The synthesis and properties of nanoscale ionic materials

    KAUST Repository

    Rodriguez, Robert Salgado; Herrer, Rafael; Bourlinos, Athanasios B.; Li, Ruipeng; Amassian, Aram; Archer, Lynden A.; Giannelis, Emmanuel P.

    2010-01-01

    In this article we discuss the effect of constituents on structure, flow, and thermal properties of nanoscale ionic materials (NIMs). NIMs are a new class of nanohybrids consisting of a nanometer-sized core, a charged corona covalently attached

  7. Muusikamaailm : "Let the Peoples Sing 1999". Bruckneri päevad Viinis. Festival Huddersfieldis. Kolmelt pianistide konkursilt / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Rahvusvahelise raadiokonkursi "Let the Peoples Sing" võitjatest. A. Bruckneri 175. sünniaastapäeva puhul toimunud Bruckneri päevadest Viinis. Kaasaegse muusika festivalist Huddersfieldist. Pianistide konkurssidest - Dino Ciani nim. konkursist Milanos, 7. Schuberti-nim. konkursist Dortmundis ja Ferruccio Busoni nim. konkursist Itaalias Bolzanos

  8. Maakondade rahvakultuuri aastapreemiad 2001

    Index Scriptorium Estoniae

    2002-01-01

    Fr. R. Kreutzwaldi nim mälestusmedali ja Kreutzwaldi-stipendiumi statuudid, lk. 89-00. Hendrik Lindepuu sai Jõgevamaa kirjanduspreemia; Mari Vallisoo sai Juhan Liivi nim. luuleauhinna, Elle-Eha Are sai Viljandimaa kultuuripreemia ja Contra B. Kangro nim. kirjanduspreemia. F. R. Kreutzwaldi mälestusmedali sai Aarand Roos

  9. PUJALTE CASTELLÓ, Nieves. Lo valenciano visto por los viajeros del siglo XVIII y XIX. Valencia: Institució Alfons el Magnánim, Diputació de València, 2012, 189 pp. y 28 ils.

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Sorroche Cuerva

    2013-01-01

    Full Text Available La aceleración de los procesos históricos desde finales del siglo XVIII, tiene en algunos ámbitos un reflejo de su concatenación y sus consecuencias más evidentes. La transición de los ideales ilustrados a la más profunda simbología romántica, generó una dualidad de perspectivas que se puede percibir perfectamente en los períodos de transición entre siglos que se acentúa en intensidad con la dinámica ya señalada de rápida sucesión.

  10. El síndic municipal a Corts a la Corona d'Aragó, durant el regnat d'Alfons el Magnànim: el cas de Lleida

    Directory of Open Access Journals (Sweden)

    Martí i Sentañes, Esther

    2004-12-01

    Full Text Available This paper underscores the importance that the local attorney had at the Courts, as a representative of the King's Estate. In spite of the fact that this figure has not been whoolly studied up to now, it furnishes us with a lot of information. Analyzing the Memorials given to these messengers by the government of the city—in this case Lleida—, it is possible to study the relationship between Lleida and the catalan Courts and, especially, what happened into the King's Estate and the arrangements that the city kept up with the Crown.

    Es ressalta la importància del síndic municipal enviat a les Corts, com a representant del braç reial, una figura poc estudiada fins el moment, malgrat que ens aporta molta informació. A partir de l’estudi deis memorials que la ciutat—en aquest cas Lleida— facilita a aquests missatgers, a l’article s'estudien les relacions d'aquest nucli urbà i les Corts catalanes, fent especial insistència en els assumptes i les relacions que es desencadenen dins del braç reial, com també les negociacions que es mantenen amb la Corona.

  11. The use of HPLC in the control of Neem commercial products quality: reproduction of the insecticide action; Uso de CLAE no controle de qualidade em produtos comerciais de Nim: reprodutibilidade da acao inseticida

    Energy Technology Data Exchange (ETDEWEB)

    Forim, Moacir Rossi; Matos, Andreia Pereira; Silva, Maria Fatima das Gracas Fernandes da; Cass, Quezia Bezerra; Vieira, Paulo Cezar; Fernandes, Joao Batista, E-mail: mrforim@ufscar.b [Universidade Federal de Sao Carlos (DQ/UFSCar), SP (Brazil). Dept. de Quimica

    2010-07-01

    The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC) a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluated the azadirachtin quantitative variation among various Neem's extracts and seeds showing the importance of quality control for reproduction of the insecticide efficiency, using S. frugiperda as target insect. (author)

  12. Uso de CLAE no controle de qualidade em produtos comerciais de Nim: reprodutibilidade da ação inseticida The use of HPLC in the control of Neem commercial products quality: reproduction of the insecticide action

    Directory of Open Access Journals (Sweden)

    Moacir Rossi Forim

    2010-01-01

    Full Text Available The Neem tree, Azadirachta indica, provides many useful compounds that are used as pesticides. However, the efficiency in field of products like neem oil can be committed because they have not been observed reproductive content of secondary metabolic like azadirachtin. Based on reverse-phase high-performance liquid chromatography (HPLC a new method was developed to permit the rapid quantitative analysis of azadirachtin from seeds, extracts and oil of Neem. In the present study it was evaluated the azadirachtin quantitative variation among various Neem's extracts and seeds showing the importance of quality control for reproduction of the insecticide efficiency, using S. frugiperda as target insect.

  13. Structure, energetic and phase transition of multi shell icosahedral bimetallic nanostructures: A molecular dynamics study of NimPdn (n + m = 55 and 147)

    International Nuclear Information System (INIS)

    Hewage, Jinasena W.

    2015-01-01

    Structure, energetic and thermodynamic properties of multi shell icosahedral bimetallic nickel–palladium nanostructures with the size of 55 and 147 atoms were studied by using the molecular dynamics simulations and the microcanonical ensemble version of multiple histogram method. In 55 atoms icosahedra, two core–shell motifs, Ni 13 Pd 42 and Pd 13 Ni 42 with their isomers Pd 13 (Pd 29 Ni 13 ) and Ni 13 (Ni 29 Pd 13 ) were considered. Similarly in 147 atoms icosahedra, all mutations corresponding to the occupations of either nickel atoms or palladium atoms in the core, inner shell or outer shell and their isomers generated by interchanging thirteen core atoms with thirteen atoms of the other type in the inner and outer shells were considered. It is found that the nickel-core clusters are more stable than the palladium-core clusters and cohesive energy increases with the nickel composition. Phase transition of each cluster was studied by means of constant volume heat capacity. The trend in variation of melting temperature is opposite to the energy trend and special increase in melting points was observed for nickel-core isomers compared to the palladium-core isomers. Helmholtz free energy change with temperature for shell to core interchange of thirteen atoms revealed the thermodynamic stability of the formation of Ni core Pd shell structures and the surface segregation of palladium. - Highlights: • Nanostructures of Ni m Pd n clusters for m + n = 55 and 147 have been studied. • Structures favor the formation of nickel-core surrounded by palladium atoms. • In general, it appears the increase of cohesive energy with the nickel composition. • Calculated thermodynamic parameters confirm the energetic results. • Results show also the palladium segregation on the surface

  14. Avaliação da utilização de Nim (Azadirachta indica) para o controle parasitário em bovinos de produção leiteira em sistema orgânico.

    OpenAIRE

    Silva, Claudia Bezerra da; Brito, Guilherme Rodrigues; Sanavria, Argemiro; Soares, João Paulo Guimarães

    2009-01-01

    As infestações parasitárias são responsáveis por sérios prejuízos econômicos na pecuária leiteira por causarem danos para a saúde animal. O controle de ectoparasitos com produtos químicos convencionais tem sido realizado de forma indiscriminada, ocasionando o desenvolvimento acelerado de resistência aos princípios ativos, contaminação do ambiente e dos produtos de origem animal, provocando preocupação na sociedade e órgãos governamentais. Desta forma, o uso de métodos alternativos, como o de ...

  15. Improvement of energy conversion efficiency and power generation in direct borohydride-hydrogen peroxide fuel cell: The effect of Ni-M core-shell nanoparticles (M = Pt, Pd, Ru)/Multiwalled Carbon Nanotubes on the cell performance

    Science.gov (United States)

    Hosseini, M. G.; Mahmoodi, R.

    2017-12-01

    In this study, core@shell nanoparticles with Ni as a core material and Pt, Pd and Ru as shell materials are synthesized on multiwalled carbon nanotube (MWCNT) as catalyst support using the sequence reduction method. The influence of Ni@Pt, Ni@Pd and Ni@Ru core@shell nanoparticles on MWCNT toward borohydride oxidation in alkaline solution is investigated by various three-electrode electrochemical techniques. Also, the impact of these anodic electrocatalysts on the performance of direct borohydride-hydrogen peroxide fuel cell (DBHPFC) is evaluated. The structural and morphological properties of electrocatalysts are studied by X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HR-TEM) and X-ray photoelectron spectroscopy (XPS). The results of three electrode investigations show that Ni@Pd/MWCNT has excellent catalytic activity since borohydride oxidation current density on Ni@Pd/MWCNT (34773.27 A g-1) is 1.37 and 9.19 times higher than those of Ni@Pt/MWCNT (25347.27 A g-1) and Ni@Ru/MWCNT (3782.83 A g-1), respectively. Also, the energy conversion efficiency and power density of DBHPFC with Ni@Pd/MWCNT (246.82 mW cm-2) increase to 34.27% and 51.53% respect to Ni@Pt/MWCNT (162.24 mW cm-2) and Ni@Ru/MWCNT (119.62 mW cm-2), respectively. This study reveals that Ni@Pd/MWCNT has highest activity toward borohydride oxidation and stability in fuel cell.

  16. Morphology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae (Lepidoptera: Noctuidae) fed on neem-treated leaves; Morfologia do canal alimentar de lagartas de Spodoptera frugiperda (J E Smith) (Lepidoptera: Noctuidae) alimentadas com folhas tratadas com nim

    Energy Technology Data Exchange (ETDEWEB)

    Correia, Alicely A.; Wanderley-Teixeira, Valeria; Oliveira, Jose V. de; Torres, Jorge B. [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Programa de Pos-Graduacao em Entomologia Agricola]. E-mail: aliceliac@yahoo.com.br; valeria@dmfa.ufrpe.br; Teixeira, Alvaro A.C. [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Morfologia e Fisiologia Animal

    2009-01-15

    Research involving plants with insecticide activity evolved significantly in the last decades. Among these plants, the neem tree, Azadirachta indica, is commonly used against several insects, mainly Lepidoptera. The neem efficiency depends on the target insect and on the concentration used. A barrier against potential toxic agents ingested together with the food is the alimentary canal. Thus, this research aimed to describe the histology of the alimentary canal of Spodoptera frugiperda (J E Smith) larvae fed on leaves treated with neem (Neemseto{sup R}) at a concentration of 0.5% and 1.0% and non treated, at different intervals (48, 96, 144, 192 and 240 h), by quantifying the regenerative cells and analyzing the secretion of the mesenteron histochemically. Larvae were immobilized at low temperatures (-4 deg C), the alimentary canal was removed, fixed in Bouein's aqueous, embedded in paraplast and historesin, sectioned and stained with hematoxylin-eosin and periodic acid- Schiff. The histology of the alimentary canal of S. frugiperda was similar to other lepidopterans. Neem effects on morphology were seen only in the mesenteron, depending on the time and concentration used, such as: epithelium, reduction on regenerative cells and on the secretory activity in this region, confirmed by the histochemistry in both neem concentrations. These alterations were observed after 96 h at 1.0%, and 144 h at 0.5%. These results indicate that neem (Neemseto{sup R}), at the concentrations studied, may be effective to control S. frugiperda because it promotes meaningful morphological alterations in the mesenteron. (author)

  17. Developing institutional repository at National Institute for Materials Science : Researchers directory service “SAMURAI” and Research Collection Library

    Science.gov (United States)

    Takaku, Masao; Tanifuji, Mikiko

    National Institute for Materials Science (NIMS) has developed an institutional repository “NIMS eSciDoc” since 2008. eSciDoc is an open source repository software made in Germany, and provides E-Science infrastructures through its flexible data model and rich Web APIs. NIMS eScidoc makes use of eSciDoc functions to benefit for NIMS situations. This article also focuses on researchers directory service “SAMURAI” in addition to NIMS eSciDoc. Successfully launched in October 2010, SAMURAI provides approximately 500 researchers' profile and publication information.

  18. One-step self-assembled nanomicelles for improving the oral bioavailability of nimodipine.

    Science.gov (United States)

    Luo, Jing-Wen; Zhang, Zhi-Rong; Gong, Tao; Fu, Yao

    2016-01-01

    Our study aimed to develop a self-assembled nanomicelle for oral administration of nimodipine (NIM) with poor water solubility. Using Solutol(®) HS15, the NIM-loaded self-assembled nanomicelles displayed a near-spherical morphology with a narrow size distribution of 12.57 ± 0.21 nm (polydispersity index =0.071 ± 0.011). Compared with Nimotop(®) (NIM tablets), the intestinal absorption of NIM from NIM nanomicelle in rats was improved by 3.13- and 2.25-fold in duodenum and jejunum at 1 hour after oral administration. The cellular transport of NIM nanomicelle in Caco-2 cell monolayers was significantly enhanced compared to that of Nimotop(®). Regarding the transport pathways, clathrin, lipid raft/caveolae, and macropinocytosis mediated the cell uptake of NIM nanomicelles, while P-glycoprotein and endoplasmic reticulum/Golgi complex (ER/Golgi) pathways were involved in exocytosis. Pharmacokinetic studies in our research laboratory have showed that the area under the plasma concentration-time curve (AUC0-∞) of NIM nanomicelles was 3.72-fold that of Nimotop(®) via oral administration in rats. Moreover, the NIM concentration in the brain from NIM nanomicelles was dramatically improved. Therefore, Solutol(®) HS15-based self-assembled nanomicelles represent a promising delivery system to enhance the oral bioavailability of NIM.

  19. Foreword: Focus on Superconductivity in Semiconductors

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2008-01-01

    Full Text Available Since the discovery of superconductivity in diamond, much attention has been given to the issue of superconductivity in semiconductors. Because diamond has a large band gap of 5.5 eV, it is called a wide-gap semiconductor. Upon heavy boron doping over 3×1020 cm−3, diamond becomes metallic and demonstrates superconductivity at temperatures below 11.4 K. This discovery implies that a semiconductor can become a superconductor upon carrier doping. Recently, superconductivity was also discovered in boron-doped silicon and SiC semiconductors. The number of superconducting semiconductors has increased. In 2008 an Fe-based superconductor was discovered in a research project on carrier doping in a LaCuSeO wide-gap semiconductor. This discovery enhanced research activities in the field of superconductivity, where many scientists place particular importance on superconductivity in semiconductors.This focus issue features a variety of topics on superconductivity in semiconductors selected from the 2nd International Workshop on Superconductivity in Diamond and Related Materials (IWSDRM2008, which was held at the National Institute for Materials Science (NIMS, Tsukuba, Japan in July 2008. The 1st workshop was held in 2005 and was published as a special issue in Science and Technology of Advanced Materials (STAM in 2006 (Takano 2006 Sci. Technol. Adv. Mater. 7 S1.The selection of papers describe many important experimental and theoretical studies on superconductivity in semiconductors. Topics on boron-doped diamond include isotope effects (Ekimov et al and the detailed structure of boron sites, and the relation between superconductivity and disorder induced by boron doping. Regarding other semiconductors, the superconducting properties of silicon and SiC (Kriener et al, Muranaka et al and Yanase et al are discussed, and In2O3 (Makise et al is presented as a new superconducting semiconductor. Iron-based superconductors are presented as a new series of high

  20. Earth and environmental sciences by accelerator mass spectrometry (AMS) with the large tandem accelerator

    International Nuclear Information System (INIS)

    Sasa, K.; Takahashi, T.; Sueki, K.

    2008-01-01

    A multi-nuclide AMS system on the 12UD Pelletron tandem accelerator at the University of Tsukuba (Tsukuba AMS system) has been able to measure environmental levels of long lived radioisotopes of 14 C, 26 Al, 36 Cl and 129 I by employing a molecular pilot beam method. In addition, we have been developing 32 Si and 41 Ca AMS systems for future research programs. Recently, the performance of 36 Cl AMS was improved in AMS technique. The standard deviation is within ±2%, and the background is better than 5 x 10 -15 for the 36 Cl/Cl ratio. At present, our Tsukuba AMS research group has focused its activities especially on the measurement of 36 Cl. We have measured more than 500 samples in year including earth and environmental sciences with the Tsukuba AMS system. A detailed description of the Tsukuba AMS system is given and earth and environmental applications are also described briefly. (author)

  1. Tartu noored akordionistid tegid Prantsusmaal ilma / Endel Jukk

    Index Scriptorium Estoniae

    Jukk, Endel

    2004-01-01

    36. noorte akordionistide konkursil Pariisi eeslinnas Argenteuil'is saavutas karika Tambet Anja Elleri nim. Tartu Muusikakoolist (õpetaja Uno Arro) ja kuldmedali Liis Jõgar Luunjast (õpetaja Lehte Anja)

  2. One-step self-assembled nanomicelles for improving the oral bioavailability of nimodipine

    Directory of Open Access Journals (Sweden)

    Luo JW

    2016-03-01

    Full Text Available Jing-Wen Luo, Zhi-Rong Zhang, Tao Gong, Yao Fu Key Laboratory of Drug Targeting and Drug Delivery Systems, Ministry of Education, West China School of Pharmacy, Sichuan University, Chengdu, Sichuan, People’s Republic of China Abstract: Our study aimed to develop a self-assembled nanomicelle for oral administration of nimodipine (NIM with poor water solubility. Using Solutol® HS15, the NIM-loaded self-assembled nanomicelles displayed a near-spherical morphology with a narrow size distribution of 12.57±0.21 nm (polydispersity index =0.071±0.011. Compared with Nimotop® (NIM tablets, the intestinal absorption of NIM from NIM nanomicelle in rats was improved by 3.13- and 2.25-fold in duodenum and jejunum at 1 hour after oral administration. The cellular transport of NIM nanomicelle in Caco-2 cell monolayers was significantly enhanced compared to that of Nimotop®. Regarding the transport pathways, clathrin, lipid raft/caveolae, and macropinocytosis mediated the cell uptake of NIM nanomicelles, while P-glycoprotein and endoplasmic reticulum/Golgi complex (ER/Golgi pathways were involved in exocytosis. Pharmacokinetic studies in our research laboratory have showed that the area under the plasma concentration–time curve (AUC0–∞ of NIM nanomicelles was 3.72-fold that of Nimotop® via oral administration in rats. Moreover, the NIM concentration in the brain from NIM nanomicelles was dramatically improved. Therefore, Solutol® HS15-based self-assembled nanomicelles represent a promising delivery system to enhance the oral bioavailability of NIM. Keywords: nanomicelles, stability, nimodipine, oral bioavailability, transport mechanism 

  3. Synthesis and evaluation of mesoporous carbon/lipid bilayer nanocomposites for improved oral delivery of the poorly water-soluble drug, nimodipine.

    Science.gov (United States)

    Zhang, Yanzhuo; Zhao, Qinfu; Zhu, Wufu; Zhang, Lihua; Han, Jin; Lin, Qisi; Ai, Fengwei

    2015-07-01

    A novel mesoporous carbon/lipid bilayer nanocomposite (MCLN) with a core-shell structure was synthesized and characterized as an oral drug delivery system for poorly water-soluble drugs. The objective of this study was to investigate the potential of MCLN-based formulation to modulate the in vitro release and in vivo absorption of a model drug, nimodipine (NIM). NIM-loaded MCLN was prepared by a procedure involving a combination of thin-film hydration and lyophilization. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), specific surface area analysis, differential scanning calorimetry (DSC) and X-ray diffraction (XRD) were employed to characterize the NIM-loaded MCLN formulation. The effect of MCLN on cell viability was assessed using the MTT assay. In addition, the oral bioavailability of NIM-loaded MCLN in beagle dogs was compared with that of the immediate-release formulation, Nimotop®. Our results demonstrate that the NIM-loaded MCLN formulation exhibited a typical sustained release pattern. The NIM-loaded MCLN formulation achieved a greater degree of absorption and longer lasting plasma drug levels compared with the commercial formulation. The relative bioavailability of NIM for NIM-loaded MCLN was 214%. MCLN exhibited negligible toxicity. The data reported herein suggest that the MCLN matrix is a promising carrier for controlling the drug release rate and improving the oral absorption of poorly water-soluble drugs.

  4. Eesti Teatriliidu aastapreemiad 1996

    Index Scriptorium Estoniae

    1997-01-01

    Aleksander Kurtna nim. preemia sai Anne Lange (T. S. Elioti, J. B. Priestley, W. Shakespeare'i, A. Milleri, E. J. Dunsany ja T. Kushneri näidendite tõlkimise eest); Priit Põldroosi nim. preemia sai Lilian Tamm (Vellerand) raamatu 'Linda Rummo. Elust ja lavaelust' koostamise eest

  5. Aktjorski duet dvuhh rezhissjorov / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2006-01-01

    Raikini-nim. Vene Riiklik Teater "Satirikon" ja Pushkini-nim. teater toovad Tallinna ühisprojekti - Belgia näitekirjaniku A. Nothombi "Vaenlase kosmeetika", kus peaosa mängib Konstantin Raikin, lavastab Roman Kozak. Lisatud ka arvustusi vene ajakirjandusest

  6. Canopy Dynamics in Nanoscale Ionic Materials Probed by NMR

    Science.gov (United States)

    Mirau, Peter

    2013-03-01

    Nanoscale ionic materials (NIMs) are hybrids prepared from ionically functionalized nanoparticles (NP) neutralized by oligomeric polymer counter-ions. NIMs are designed to behave as liquids under ambient conditions in the absence of solvent and have no volatile organic content, making them useful for a number of applications. We have used NMR relaxation and pulse-field gradient NMR to probe local and collective canopy dynamics in NIMs based on silica nanoparticles (NP), fullerols and proteins in order to understand the relationship between the core and canopy structure and the bulk properties. The NMR studies show that the canopy dynamics depend on the degree of neutralization, the canopy radius of gyration and molecular crowding at the ionically modified NP surface. The viscosity in NIMs can be directly controlled with the addition of ions that enhance the exchange rate for polymers at the NP surface. These results show that NIMs for many applications can be prepared by controlling the dynamics of the NP interface.

  7. Bulk and Thin film Properties of Nanoparticle-based Ionic Materials

    Science.gov (United States)

    Fang, Jason

    2008-03-01

    Nanoparticle-based ionic materials (NIMS) offer exciting opportunities for research at the forefront of science and engineering. NIMS are hybrid particles comprised of a charged oligomeric corona attached to hard, inorganic nanoparticle cores. Because of their hybrid nature, physical properties --rheological, optical, electrical, thermal - of NIMS can be tailored over an unusually wide range by varying geometric and chemical characteristics of the core and canopy and thermodynamic variables such as temperature and volume fraction. On one end of the spectrum are materials with a high core content, which display properties similar to crystalline solids, stiff waxes, and gels. At the opposite extreme are systems that spontaneously form particle-based fluids characterized by transport properties remarkably similar to simple liquids. In this poster I will present our efforts to synthesize NIMS and discuss their bulk and surface properties. In particular I will discuss our work on preparing smart surfaces using NIMS.

  8. EFICIÊNCIA DOS ÓLEOS DE NIM (Azadirachta indica A. Juss. E MAMONA (Ricinus communis L. NA RESISTÊNCIA DA MADEIRA DE SUMAÚMA (Ceiba pentandra (L. Gaerth. A FUNGOS XILÓFAGOS EM SIMULADORES DE CAMPO

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-01-01

    Full Text Available The research aimed to evaluate the efficiency of neem (Azadirachta indica and castor oil plant (Ricinus communis oils for the improvement of Ceiba pentandra wood resistance to xilophagous fungi in soil bed condition (field simulator. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employed in the preparation of oil solutions. Wood samples with dimensions of 1.5 x 0.5 x 15 cm (radial x tangential x longitudinal were treated to reach a nominal retention of 10 to 16 kg of solution/m³ of wood. The samples were submitted to the action of natural micro-flora of three soils; forest, agricultural use and natural pasture soils, for 180 days. Among the tested soils, the agricultural presented greater biological activity, which damaged the samples even more. Among the tested solutions, the pure neem oil provided increased protection to samples. The prepared solutions using neem and castor oil plant oils did not protect the wood from the attack of xylophagous fungi existing in the ground.

  9. Potential of Metarrhizium anisopliae and Beauveria bassiana isolates and Neem oil to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae); Potencial de isolados de Metarhizium anisopliae e Beauveria bassiana e do oleo de Nim no controle do pulgao Lipaphis erysimi (Kalt.) (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Araujo Junior, Jose M. de; Marques, Edmilson J.; Oliveira, Jose V. de [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia - Entomologia], e-mail: jma_junior@yahoo.com.br, e-mail: emar@depa.ufrpe.br, e-mail: vargasoliveira@uol.com.br

    2009-07-15

    This work aimed to determine the efficiency of the entomopathogenic fungi Metarrhizium anisopliae and Beauveria bassiana to control the aphid Lipaphis erysimi (Kalt.) (Hemiptera:Aphididae) in kale Brassica oleracea var acephala D.C., as well as their compatibility with a neem oil formulation (Neemseto{sup R}). Ten isolates of both fungi were tested and the most pathogenic ones were B. bassiana CG001 and M. anisopliae CG30 with 90% and 4.4 days, and 64% and 3.8 days of mortality and median lethal time, respectively. Bioassays with neem at concentrations of 0.5, 1.0 and 2.0% were done either by leaf discs dipping or spraying the aphids on the leaf discs. The neem spraying treatment at 2.0% provided 90% mortality. The use of B. bassiana isolate CG001 or M. anisopliae isolate CG30 with neem at 0.125, 0.25, and 0.5%, demonstrated that these isolates could have their spore viability or colony growth affected when exposed to neem concentrations higher than 0.25%. In absolute values, the isolates B. bassiana CG001 and M. anisopliae CG30 are the most virulent to L. erysimi, and could be utilized in the management of this pest. (author)

  10. License - DGBY | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available rch Institute, National Agriculture and Food Research Organization (NARO) 2-1-12 Kannondai, Tsukuba, Ibaraki...t a license for use of this database or any part thereof not licensed under the license. National Food Resea

  11. ONRASIA Scientific Information Bulletin, Volume 15, Number 4, October-December 1990

    Science.gov (United States)

    1990-12-01

    31 (2) Food industry- yogurt fermentation , flesh Biotechnology Master Plan comprising some (particularly fish) freshness estimation, food $60 million...used in making polymer fibers strains or mutants to determine the role of of high modulus and high strength. In TSUKUBA FERMENTATION ...Development Laboratories 4-105 Tsinghua University, Beijing 1-030 Tsukuba Fermentation Institute 4-003 University of Melbourne 4-121 University of New England

  12. Results of atmospheric diffusion experiments, vol.3

    International Nuclear Information System (INIS)

    Kakuta, Michio; Hayashi, Takashi; Adachi, Takashi.

    1988-02-01

    An extensive study on 'Emergency monitoring and prediction code system' has been carried in JAERI since 1980. Six series of field experiments on atmospheric diffusion were conducted to develop and verify the prediction models for environmental concentration distribution following accidental release of radioactivity. Results of field experiments (Inland complex terrain, surface and elevated point sources) conducted in 15 - 19th October 1984 (TSUKUBA84) and in 6 - 10th November 1985 (TSUKUBA85) are contained in this volume. (author)

  13. Stemcell Information: SKIP000266 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available School of Comprehensive Human Sciences, University of Tsukuba 国立大学法人 筑波大学大学院 人間総合科学研究科 遺伝医学... Graduate School of Comprehensive Human Sciences, University of Tsukuba 国立大学法人 筑波大学大学院 人間総合科学研究科 遺伝医学

  14. The Relationship between a New Biomarker of Vagal Neuroimmunomodulation and Survival in Two Fatal Cancers

    Directory of Open Access Journals (Sweden)

    Y. Gidron

    2018-01-01

    Full Text Available Background. The vagus nerve may slow tumor progression because it inhibits inflammation. This study examined the relationship between a new vagal neuroimmunomodulation (NIM index and survival in fatal cancers. Method. We retroactively derived markers of vagal nerve activity indexed by heart rate variability (HRV, specifically the root mean square of successive differences (RMSSD, from patients’ electrocardiograms near diagnosis. The NIM index was the ratio of RMSSD to C-reactive protein levels (RMSSD/CRP. Sample 1 included 202 Belgian patients with advanced pancreatic cancer (PC, while sample 2 included 71 Belgian patients with non-small cell lung cancer (NSCLC. In both samples, we examined the overall survival, while in sample 2, we additionally examined the survival time in deceased patients. Results. In PC patients, in a multivariate Cox regression controlling for confounders, the NIM index had a protective relative risk (RR of 0.68 and 95% confidence interval (95% CI of 0.51–0.92. In NSCLC patients, the NIM index also had a protective RR of 0.53 and 95% CI of 0.32–0.88. Finally, in NSCLC, patients with a higher NIM index survived more days (475.2 than those with lower NIM (285.1 (p<0.05. Conclusions. The NIM index, reflecting vagal modulation of inflammation, may be a new independent prognostic biomarker in fatal cancers.

  15. The synthesis and properties of nanoscale ionic materials

    KAUST Repository

    Rodriguez, Robert Salgado

    2010-02-17

    In this article we discuss the effect of constituents on structure, flow, and thermal properties of nanoscale ionic materials (NIMs). NIMs are a new class of nanohybrids consisting of a nanometer-sized core, a charged corona covalently attached to the core, and an oppositely charged canopy. The hybrid nature of NIMs allows for their properties to be engineered by selectively varying their components. The unique properties associated with these systems can help overcome some of the issues facing the implementation of nanohybrids to various commercial applications, including carbon dioxide capture,water desalinization and as lubricants. Copyright © 2010 John Wiley & Sons, Ltd.

  16. EP&R Standards Project Report: Technical Review of National Incident Management Standards

    Energy Technology Data Exchange (ETDEWEB)

    Stenner, Robert D.

    2007-04-24

    The importance and necessity for a fully developed and implemented National Incident Management System (NIMS) has been demonstrated in recent years by the impact of national events such as Hurricane Katrina in 2005. Throughout the history of emergency response to major disasters, especially when multiple response organizations are involved, there have been systemic problems in the consistency and uniformity of response operations. Identifying national standards that support the development and implementation of NIMS is key to helping solve these systemic problems. The NIMS seeks to provide uniformity and consistency for incident management by using common terminology and protocols that will enable responders to coordinate their efforts to ensure an efficient response.

  17. Intra-connected three-dimensionally isotropic bulk negative index photonic metamaterial

    International Nuclear Information System (INIS)

    Guney, Durdu; Koschny, Thomas; Soukoulis, Costas

    2010-01-01

    Isotropic negative index metamaterials (NIMs) are highly desired, particularly for the realization of ultra-high resolution lenses. However, existing isotropic NIMs function only two-dimensionally and cannot be miniaturized beyond microwaves. Direct laser writing processes can be a paradigm shift toward the fabrication of three-dimensionally (3D) isotropic bulk optical metamaterials, but only at the expense of an additional design constraint, namely connectivity. Here, we demonstrate with a proof-of-principle design that the requirement connectivity does not preclude fully isotropic left-handed behavior. This is an important step towards the realization of bulk 3D isotropic NIMs at optical wavelengths.

  18. V prostranstve mezhdu soboi i personazhem / Stella Saltõkova

    Index Scriptorium Estoniae

    Saltõkova, Stella

    2006-01-01

    16. juunil. andis Tallinnas Vene Kultuurikeskuses külalisetendusi Georgi Tovstonogovi nim. Suur Draamateater. Mängiti Ronald Harwoodi "Kvartetti", osalesid vene näitlejad Alissa Freindlihh, Kirill Lavrov, Oleg Basilashvili ja Zinaida Sharko

  19. Mathematical games, abstract games

    CERN Document Server

    Neto, Joao Pedro

    2013-01-01

    User-friendly, visually appealing collection offers both new and classic strategic board games. Includes abstract games for two and three players and mathematical games such as Nim and games on graphs.

  20. Muusikamaailm : Hooaja algus "La Scalas". Verdi mälestusaastast mujalgi. Uusooper Ateenasse olümpia-aastaks. Soome ooperi "hullu aasta" lõpp / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Milano La Scala hooaja avaetendustest. G. Verdi ooperite lavastustest New Yorgi, Barcelona, Viini ja Helsingi ooperiteatrites. D. Mitropoulose nim. rahvusvahelisest heliloojate konkursist. K. Tikka uusooperi "Luther" maailmaesiettekandest 12. dets. Helsingi Koopakirikus

  1. Mozhet kontshitsja, no ne "Vishnjovõi sad" / Jelena Skulskaja

    Index Scriptorium Estoniae

    Skulskaja, Jelena, 1950-

    2008-01-01

    Vene teatrifestivali "Kuldne mask Eestis" viimasest etendusest, Anton Tshehhovi "Kirsiaiast" Eimuntas Nekroshiuse lavastuses. Lavastus sündis K. Stanislavski nim. Rahvusvahelise Fondi ja teatri Meno Fortas ühisprojektina

  2. Kiviõlis kõlavad "West Side Story" laulud / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2004-01-01

    Tallinna Georg Otsa nim. Muusikakooli viiepäevasest treeninglaagrist Kiviõli Keemiatööstuse hoones ja kontserdist muusikali "West Side Story" lauludega 27. aug. (ettevalmistus 4. sept. Tallinnas esietenduvale muusikalile, projektijuht Eerika Kurm)

  3. Command and Control for Homeland Security

    National Research Council Canada - National Science Library

    Greene, Marjorie

    2007-01-01

    ... Security June 2006, NIMS Revision Version 2 March 2007, NWDC Domestic Disaster Relief Operations Planning, 15 May 2006, AFRL-Supported Studies on Large- Scale Coordination, A Sociotechnical Systems...

  4. Zdorovje - eto zhizn võssokogo katshestva / Jekaterina Sokolovskaja

    Index Scriptorium Estoniae

    Sokolovskaja, Jekaterina

    2004-01-01

    Venemaa meditsiiniteaduste akadeemia inimeseökoloogia ja keskkonnahügieeni A. N. Sõssina nim. teadusliku uurimise instituudi andmetel on viimase kümne aasta jooksul keskkonna seisund Venemaal paranenud

  5. Nuclear Magnetic Resonance Study of Nanoscale Ionic Materials

    KAUST Repository

    Oommen, Joanna Mary; Hussain, Muhammad Mustafa; Emwas, Abdul-Hamid M.; Agarwal, Praveen; Archer, Lynden A.

    2010-01-01

    using nuclear magnetic resonance (NMR) spectroscopy. NIMs are relatively stable over a temperature range from 300 to 383 K, rendering them usable in high temperature applications. We confirmed the presence of covalent bonds between the SiO2 core

  6. Tallinn ja Peterburi : kultuurikontaktid / Ester Shank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2007-01-01

    Tallinna volikogu esinduse kohtumisest Peterburi kolleegidega, ka kontserdist Georg Otsa mälestuseks 8. nov. Peterburi endise Väikese Ooperi- ja Balletiteatri, nüüd Mihhailovski-nim. teatri saalis (õhtujuhiks Arne Mikk)

  7. Картошку на премию покупать не собираюсь / Андрус Кивиряхк ; интервьюировал Ивар Сильд

    Index Scriptorium Estoniae

    Кивиряхк, Андрус, 1970-

    2003-01-01

    A. Kivirähk pälvis A. H. Tammsaare nim. romaaniauhinna "Rehepapi" eest. Intervjuu on ilmunud SL Õhtulehes pealk. "Sherlock Holmes tegi ka vahepeal keemiakatseid". Tõlkija on intervjuud lühendanud

  8. Plasmon-Enhanced Photonic Crystal Negative Index Materials for Superlensing Applications, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Negative index materials (NIMs) offer tremendous potential for the formation of highly compact as well as large-area deployable thin-film optical components. Omega...

  9. National Infrastructure Maintenance Strategy and its implementation

    CSIR Research Space (South Africa)

    Wall, K

    2008-10-01

    Full Text Available The National Infrastructure Maintenance Strategy (NIMS) was approved by Cabinet in 2006. This Strategy sets overarching policy for sector-based initiatives and describes the framework for a coordinated programme of actions. It is an essential part...

  10. Parts lubas uut muusikakooli

    Index Scriptorium Estoniae

    2005-01-01

    Peaminister Juhan Parts vastas Tallinna Muusikakeskkooli õpilase Judith Partsi kirjale Tallinna Muusikakeskkooli olukorrast lubadusega hoida silma peal Tallinna Muusikakeskkoolile, Tallinna Balletikoolile ja Georg Otsa nim. Muusikakoolile ühise hoone võimaldamisest kokkuehituseks Eesti Muusikaakadeemiaga

  11. Lastekirjanduse uurimisest laias maailmas / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    1995-01-01

    Organisatsiooni International Research Society for Children's Literature (IRSCL, asutatud 1969. a.) tegevusest ja muljeid 1993. a. kongressist Austraalias. Sisaldab ka IRSCL-i väljaannete loetelu (8 nim.)

  12. Muusikamaailm : Wien Modern 2000. Muusikateater Huddersfieldis. Sibeliuse konkurss Helsingis. Penderecki uus teos Tokyos / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Nüüdismuusikafestivalist "Wien Modern" 28. okt.-26. nov. Muusikalavastustest Huddersfieldi kaasaegse muusika festivalil. VIII Sibeliuse nim. rahvusvahelisest viiuldajate konkursist. 30. nov. toimus Tokyos K. Penderecki teose "Concerto grosso per tre violoncelli ed orchestra"

  13. Театральная радуга в городе белых ночей / Борис Тух

    Index Scriptorium Estoniae

    Тух, Борис, 1946-

    2015-01-01

    16. teatrifestival Vikerkaar toimus Peterburis mais-juunis 2015, korraldas Aleksandr Brjantsevi nimeline Noorsooteater. Pikemalt Brjantsevi nim. Noorsooteatri lavastusest Ray Bradbury romaani "Võilillevein" ainetel (lavastaja Adolf Šapiro)

  14. Ruzhjo dolzhno võstrelit / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2005-01-01

    Mängufilm "Libahundi needus" : stsenaristid Margus Kasterpalu, Ilmar Raag ja Rainer Sarnet : režissöör Rainer Sarnet : Shop of Dreams - Eesti Televisioon 2005. Ka "teatrineedusest" Moskva Pushkini nim. teatri näitel

  15. "Thais" muusika on fenomenaalne / Veronika Džiojeva ; intervjueerinud Silja Joon

    Index Scriptorium Estoniae

    Džiojeva, Veronika

    2009-01-01

    Küsimustele vastab 22. mail Pärnu Endla teatris esietenduva Jules Massenet' ooperi "Thais" nimiosatäitja, 2007. aastal toimunud Klaudia Taevi nim. rahvusvahelise ooperilauljate konkursi laureaat Veronika Džiojeva

  16. Baletnaja poezija erotiki / Boris Eifman ; interv. Aljona Strizhenova

    Index Scriptorium Estoniae

    Eifman, Boris, 1946-

    2007-01-01

    Lev Tolstoi romaani "Anna Karenina" järgi Boris Eifmani loodud koreograafiaga balletilavastus Pjotr Tšaikovski muusikale. B. Eifmani nim. St-Peterburgi Riikliku Akadeemilise Balletiteatri külalisetendused Tallinnas, 16. juunil

  17. German, Pikovaja dama i jejo alter ego / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2007-01-01

    Moskva Vahtangovi nim. Teatri näitlejad Ludmilla Maksakova, Jevgeni Knjazev ja Julia Rutberg räägivad Pjotr Fomenko "Padaemanda" lavastusest, mis etendub Tallinnas festivali "Kuldne mask Eestis" raames

  18. "Hair" - laul ja tants, mitte kultusmuusikal / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2006-01-01

    Kultusmuusikal "Hair" Rock Cafés Georg Otsa nim. Tallinna Muusikakooli õpilaste esituses, lavastaja Ivo Eensalu, muusikajuhid Mare Väljataga, Meelis Punder, tantsujuht Ulrike Ustav, kunstnikud Kristel Viks, Liisi Suuroja

  19. Nuclear Magnetic Resonance Study of Nanoscale Ionic Materials

    KAUST Repository

    Oommen, Joanna Mary

    2010-08-13

    Nanoscale ionic materials (NIMs) are a new class of nanomaterials that exhibit interesting properties including negligible vapor pressures and tunable physical states, among others. In this study, we analyzed the temperature-wise performance of NIMs using nuclear magnetic resonance (NMR) spectroscopy. NIMs are relatively stable over a temperature range from 300 to 383 K, rendering them usable in high temperature applications. We confirmed the presence of covalent bonds between the SiO2 core and the sulfonate group and determined relative concentrations of aromatic and aliphatic hydrocarbons. These findings serve as first hand proof-of-concept for the usefulness of NMR analyses in further studies on the diffusive properties of NIMs. © 2010 The Electrochemical Society.

  20. Gate-keeper module for TANSY-KM5

    International Nuclear Information System (INIS)

    Rydz, R.; Norberg, L.; Urholm, L.; Grosshoeg, G.

    1991-01-01

    The purpose of the Gate-keeper is the control of the RDCs, the ADCs, and the constant fraction discriminator. The Gate-keeper synchronizes the units and ensures that the data taking is clean and not intermixed with other events. There are six Gate-Keepers in the system, one for each proton detector. All input circuits are designed to accept TTL as well as negative NIM signals. The output is 50 ohm TTL or negative NIM as defined by internal jumpers

  1. Autonomy in euthyroid goitre: Precursor of non-immunogenic hyperthyroidism in an area of iodine deficiency

    International Nuclear Information System (INIS)

    Emrich, D.; Schicha, H.

    1984-01-01

    There is evidence that in an area of iodine deficiency NIM-HY exists to a considerable percentage, probably originating from euthyroid goitre with autonomy, especially if iodine intake is suddenly increased. Separation of IM-HY and NIM-HY is possible with a probability of 90% by clinical criteria and available laboratory investigations. This might be important not only from a pathophysiological point of view but also for diagnosis and selection of the kind of therapy. (orig.)

  2. Retorika, javno razpravljanje in spor o racionalnosti

    OpenAIRE

    Škerlep, Andrej

    2015-01-01

    V članku obravnavamo razmerje med retoriko in javnim razpravljanjem prek prikaza Habermasove nesposobnosti, da bi integriral retoriko v svojo teorijo racionalne argumentacije. V sporu med filozofijo in retoriko najprej izpostavljamo polemiko med modernisitčnim racionalizmom in postmodernističnim antiracionalizmom, nato pa v drugem delu članka ta spor obravnavamo še v okviru Platonovega in Aristotelovega pojmovanja retorike. Zastopamo tezo, da je Habermasova nesposobnost integracije retorike š...

  3. Canopy Dynamics in Nanoscale Ionic Materials

    KAUST Repository

    Jespersen, Michael L.

    2010-07-27

    Nanoscale ionic materials (NIMS) are organic - inorganic hybrids in which a core nanostructure is functionalized with a covalently attached corona and an ionically tethered organic canopy. NIMS are engineered to be liquids under ambient conditions in the absence of solvent and are of interest for a variety of applications. We have used nuclear magnetic resonance (NMR) relaxation and pulse-field gradient (PFG) diffusion experiments to measure the canopy dynamics of NIMS prepared from 18-nm silica cores modified by an alkylsilane monolayer possessing terminal sulfonic acid functionality, paired with an amine-terminated ethylene oxide/propylene oxide block copolymer canopy. Carbon NMR studies show that the block copolymer canopy is mobile both in the bulk and in the NIMS and that the fast (ns) dynamics are insensitive to the presence of the silica nanoparticles. Canopy diffusion in the NIMS is slowed relative to the neat canopy, but not to the degree predicted from the diffusion of hard-sphere particles. Canopy diffusion is not restricted to the surface of the nanoparticles and shows unexpected behavior upon addition of excess canopy. Taken together, these data indicate that the liquid-like behavior in NIMS is due to rapid exchange of the block copolymer canopy between the ionically modified nanoparticles. © 2010 American Chemical Society.

  4. Canopy Dynamics in Nanoscale Ionic Materials

    KAUST Repository

    Jespersen, Michael L.; Mirau, Peter A.; Meerwall, Ernst von; Vaia, Richard A.; Rodriguez, Robert; Giannelis, Emmanuel P.

    2010-01-01

    Nanoscale ionic materials (NIMS) are organic - inorganic hybrids in which a core nanostructure is functionalized with a covalently attached corona and an ionically tethered organic canopy. NIMS are engineered to be liquids under ambient conditions in the absence of solvent and are of interest for a variety of applications. We have used nuclear magnetic resonance (NMR) relaxation and pulse-field gradient (PFG) diffusion experiments to measure the canopy dynamics of NIMS prepared from 18-nm silica cores modified by an alkylsilane monolayer possessing terminal sulfonic acid functionality, paired with an amine-terminated ethylene oxide/propylene oxide block copolymer canopy. Carbon NMR studies show that the block copolymer canopy is mobile both in the bulk and in the NIMS and that the fast (ns) dynamics are insensitive to the presence of the silica nanoparticles. Canopy diffusion in the NIMS is slowed relative to the neat canopy, but not to the degree predicted from the diffusion of hard-sphere particles. Canopy diffusion is not restricted to the surface of the nanoparticles and shows unexpected behavior upon addition of excess canopy. Taken together, these data indicate that the liquid-like behavior in NIMS is due to rapid exchange of the block copolymer canopy between the ionically modified nanoparticles. © 2010 American Chemical Society.

  5. Anisotropic breakdown of Fermi liquid quasiparticle excitations in overdoped La₂-xSrxCuO₄.

    Science.gov (United States)

    Chang, J; Månsson, M; Pailhès, S; Claesson, T; Lipscombe, O J; Hayden, S M; Patthey, L; Tjernberg, O; Mesot, J

    2013-01-01

    High-temperature superconductivity emerges from an un-conventional metallic state. This has stimulated strong efforts to understand exactly how Fermi liquids breakdown and evolve into an un-conventional metal. A fundamental question is how Fermi liquid quasiparticle excitations break down in momentum space. Here we show, using angle-resolved photoemission spectroscopy, that the Fermi liquid quasiparticle excitations of the overdoped superconducting cuprate La1.77Sr0.23CuO4 is highly anisotropic in momentum space. The quasiparticle scattering and residue behave differently along the Fermi surface and hence the Kadowaki-Wood's relation is not obeyed. This kind of Fermi liquid breakdown may apply to a wide range of strongly correlated metal systems where spin fluctuations are present.

  6. Environmental radiation in Higashi-Hiroshima Campus, Hiroshima University

    International Nuclear Information System (INIS)

    Inada, K.; Matsuhima, A.; Nakashima, S.; Takahashi, Y.; Shizuma, K.; Saito, T.; Iwatani, K.

    2006-01-01

    Environmental radiation of the water sample from the junction point to public sewerage system and from Kadowaki Chosetsu Pond in Higashi-Hiroshima Campus, Hiroshima University was measured. Time dependence of the total radiation from β-emitter in 40 K equivalent was checked from 1995 to 2005. Seasonal dependence of the environmental radiation for the junction point to public sewerage system was observed. There was no relation between this seasonal dependence and the data of discharge of the effluent from Radioisotope Center, suggesting that there was no radiation originated from the RI facilities. The seasonal dependence was closely related to the weight of residue of the water sample. The present results show an interesting seasonal dependence of the weight of residue of the water sample from the junction point to public sewerage system. (author)

  7. Social Media for Enhancing Civil Society and Disaster Relief: Usage by Local Municipalities in Japan

    Directory of Open Access Journals (Sweden)

    Muneo Kaigo

    2015-10-01

    Full Text Available This main focus of this article is a case study that analyzes social media usage by a local municipality in Japan, and on the possibilities and problems of complementary communication channels such as social networking services for promoting civil society activities and linking civil society organizations. We examine how in the past, Japanese municipalities have been using social media and social networking services for enhancing civil society and how social networking services are a potential tool that can provide vital information and connect citizens, municipal governments and civil society. This article focuses on the first phase of the Tsukuba Civic Activities Cyber-Square [Tsukuba Shimin Katsudō no Hiroba] on Facebook Experiment in 2012 and how it functioned during and after the May 6, 2012 Tsukuba city tornado disaster for the subsequent relief and support activities during May 2012.

  8. Exercise habituation is effective for improvement of periodontal disease status: a prospective intervention study

    Directory of Open Access Journals (Sweden)

    Omori S

    2018-03-01

    Full Text Available Shoei Omori,1,2 Fumihiko Uchida,3 Sechang Oh,4,5 Rina So,6 Takehiko Tsujimoto,7 Toru Yanagawa,8 Satoshi Sakai,4 Junichi Shoda,4,5 Kiyoji Tanaka,9 Hiroki Bukawa8 1Oral and Maxillofacial Surgery, Clinical Sciences, Graduate School of Comprehensive Human Sciences, University of Tsukuba, Tsukuba, Ibaraki, Japan; 2Department of Dental Oral Surgery, Kitaibaraki City Hospital, Kitaibaraki, Ibaraki, Japan; 3Department of Oral and Maxillofacial Surgery, University of Tsukuba Hospital, Tsukuba, Ibaraki, Japan; 4Department of Medical Sciences, Faculty of Medicine, University of Tsukuba, Tsukuba, Ibaraki, Japan; 5The Center of Sports Medicine and Health Sciences, Tsukuba University Hospital, Tsukuba, Ibaraki, Japan; 6Research Center for Overwork-Related Disorders, National Institute of Occupational Safety and Health, Kawasaki, Kanagawa, Japan; 7Department of Sports Medicine, Faculty of Human Sciences, Shimane University, Matsue, Shimane, Japan; 8Department of Oral and Maxillofacial Surgery, Faculty of Medicine, University of Tsukuba, Tsukuba, Ibaraki, Japan; 9Department of Sports Medicine, Faculty of Health and Sport Sciences, University of Tsukuba, Tsukuba, Ibaraki, Japan Background and purpose: Periodontal disease is closely related to lifestyle-related diseases and obesity. It is widely known that moderate exercise habits lead to improvement in lifestyle-related diseases and obesity. However, little research has been undertaken into how exercise habits affect periodontal disease. The purpose of this study was to examine the effect of exercise habits on periodontal diseases and metabolic pathology. Methods: We conducted a prospective intervention research for 12 weeks. The subjects were 71 obese men who participated in an exercise and/or dietary intervention program. Fifty subjects were assigned to exercise interventions (exercise intervention group and 21 subjects were assigned to dietary interventions (dietary intervention group. This research was

  9. The distribution of blood eosinophil levels in a Japanese COPD clinical trial database and in the rest of the world

    OpenAIRE

    Barnes, Neil; Ishii, Takeo; Hizawa, Nobuyuki; Midwinter, Dawn; James, Mark; Hilton, Emma; Jones, Paul W

    2018-01-01

    Neil Barnes,1,2 Takeo Ishii,3,4 Nobuyuki Hizawa,5 Dawn Midwinter,6 Mark James,3 Emma Hilton,1 Paul Jones1,71Respiratory Medicine Franchise, GlaxoSmithKline, Brentford, UK; 2William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, London, UK; 3Medical Affairs, GlaxoSmithKline K.K., Tokyo, Japan; 4Graduate School of Medicine, Nippon Medical School, Tokyo, Japan; 5Department of Pulmonary Medicine, Faculty of Medicine, University of Tsukuba, Tsukuba, Japan; 6Globa...

  10. A model for translating ethnography and theory into culturally constructed clinical practices.

    Science.gov (United States)

    Nastasi, Bonnie Kaul; Schensul, Jean J; Schensul, Stephen L; Mekki-Berrada, Abelwahed; Pelto, Pertti J; Maitra, Shubhada; Verma, Ravi; Saggurti, Niranjan

    2015-03-01

    This article describes the development of a dynamic culturally constructed clinical practice model for HIV/STI prevention, the Narrative Intervention Model (NIM), and illustrates its application in practice, within the context of a 6-year transdisciplinary research program in Mumbai, India. Theory and research from anthropology, psychology, and public health, and mixed-method ethnographic research with practitioners, patients, and community members, contributed to the articulation of the NIM for HIV/STI risk reduction and prevention among married men living in low-income communities. The NIM involves a process of negotiation of patient narratives regarding their sexual health problems and related risk factors to facilitate risk reduction. The goal of the NIM is to facilitate cognitive-behavioral change through a three-stage process of co-construction (eliciting patient narrative), deconstruction (articulating discrepancies between current and desired narrative), and reconstruction (proposing alternative narratives that facilitate risk reduction). The NIM process extends the traditional clinical approach through the integration of biological, psychological, interpersonal, and cultural factors as depicted in the patient narrative. Our work demonstrates the use of a recursive integration of research and practice to address limitations of current evidence-based intervention approaches that fail to address the diversity of cultural constructions across populations and contexts.

  11. A Model for Translating Ethnography and Theory into Culturally Constructed Clinical Practices

    Science.gov (United States)

    Schensul, Jean J.; Schensul, Stephen L.; Mekki-Berrada, Abelwahed; Pelto, Pertti J.; Maitra, Shubhada; Verma, Ravi; Saggurti, Niranjan

    2015-01-01

    This article describes the development of a dynamic culturally constructed clinical practice model for HIV/STI prevention, the Narrative Intervention Model (NIM), and illustrates its application in practice, within the context of a 6-year transdisciplinary research program in Mumbai, India. Theory and research from anthropology, psychology, and public health, and mixed-method ethnographic research with practitioners, patients, and community members, contributed to the articulation of the NIM for HIV/STI risk reduction and prevention among married men living in low-income communities. The NIM involves a process of negotiation of patient narratives regarding their sexual health problems and related risk factors to facilitate risk reduction. The goal of the NIM is to facilitate cognitive-behavioral change through a three-stage process of co-construction (eliciting patient narrative), deconstruction (articulating discrepancies between current and desired narrative), and reconstruction (proposing alternative narratives that facilitate risk reduction). The NIM process extends the traditional clinical approach through the integration of biological, psychological, interpersonal, and cultural factors as depicted in the patient narrative. Our work demonstrates the use of a recursive integration of research and practice to address limitations of current evidence-based intervention approaches that fail to address the diversity of cultural constructions across populations and contexts. PMID:25292448

  12. A single-layer wide-angle negative-index metamaterial at visible frequencies.

    Science.gov (United States)

    Burgos, Stanley P; de Waele, Rene; Polman, Albert; Atwater, Harry A

    2010-05-01

    Metamaterials are materials with artificial electromagnetic properties defined by their sub-wavelength structure rather than their chemical composition. Negative-index materials (NIMs) are a special class of metamaterials characterized by an effective negative index that gives rise to such unusual wave behaviour as backwards phase propagation and negative refraction. These extraordinary properties lead to many interesting functions such as sub-diffraction imaging and invisibility cloaking. So far, NIMs have been realized through layering of resonant structures, such as split-ring resonators, and have been demonstrated at microwave to infrared frequencies over a narrow range of angles-of-incidence and polarization. However, resonant-element NIM designs suffer from the limitations of not being scalable to operate at visible frequencies because of intrinsic fabrication limitations, require multiple functional layers to achieve strong scattering and have refractive indices that are highly dependent on angle of incidence and polarization. Here we report a metamaterial composed of a single layer of coupled plasmonic coaxial waveguides that exhibits an effective refractive index of -2 in the blue spectral region with a figure-of-merit larger than 8. The resulting NIM refractive index is insensitive to both polarization and angle-of-incidence over a +/-50 degree angular range, yielding a wide-angle NIM at visible frequencies.

  13. Hydrogen embrittlement property of a 1700-MPa-class ultrahigh-strength tempered martensitic steel

    Energy Technology Data Exchange (ETDEWEB)

    Li Songjie; Zhang Boping [School of Materials Science and Engineering, University of Science and Technology Beijing, No. 30 Xueyuan Road, Hidian Zone, Beijing 100083 (China); Akiyama, Eiji; Yuuji, Kimura; Tsuzaki, Kaneaki [Structural Metals Center, National Institute for Materials Science, 1-2-1 Sengen, Tsukuba, Ibaraki 305-0047 (Japan); Uno, Nobuyoshi, E-mail: AKIYAMA.Eiji@nims.go.j [Nippon Steel and Sumikin Metal Products Co, Ltd, SA Bldg., 17-12 Kiba 2-chome, Koto-ku, Tokyo (Japan)

    2010-04-15

    The hydrogen embrittlement property of a prototype 1700-MPa-class ultrahigh-strength steel (NIMS17) containing hydrogen traps was evaluated using a slow strain rate test (SSRT) after cathodic hydrogen precharging, cyclic corrosion test (CCT) and atmospheric exposure. The hydrogen content in a fractured specimen was measured after SSRT by thermal desorption spectroscopy (TDS). The relationship between fracture stress and hydrogen content for the hydrogen-precharged specimens showed that the fracture stress of NIMS17 steel was higher, at a given hydrogen content, than that of conventional AISI 4135 steels with tensile strengths of 1300 and 1500 MPa. This suggests better resistance of NIMS17 steel to hydrogen embrittlement. However, hydrogen uptake to NIMS17 steel under CCT and atmospheric exposure decreased the fracture stress. This is because of the stronger hydrogen uptake to the steel containing hydrogen traps than to the AISI 4135 steels. Although NIMS17 steel has a higher strength level than AISI 4135 steel with a tensile strength of 1500 MPa, the decrease in fracture stress is similar between these steels.

  14. Hydrogen embrittlement property of a 1700-MPa-class ultrahigh-strength tempered martensitic steel

    Directory of Open Access Journals (Sweden)

    Songjie Li, Eiji Akiyama, Kimura Yuuji, Kaneaki Tsuzaki, Nobuyoshi Uno and Boping Zhang

    2010-01-01

    Full Text Available The hydrogen embrittlement property of a prototype 1700-MPa-class ultrahigh-strength steel (NIMS17 containing hydrogen traps was evaluated using a slow strain rate test (SSRT after cathodic hydrogen precharging, cyclic corrosion test (CCT and atmospheric exposure. The hydrogen content in a fractured specimen was measured after SSRT by thermal desorption spectroscopy (TDS. The relationship between fracture stress and hydrogen content for the hydrogen-precharged specimens showed that the fracture stress of NIMS17 steel was higher, at a given hydrogen content, than that of conventional AISI 4135 steels with tensile strengths of 1300 and 1500 MPa. This suggests better resistance of NIMS17 steel to hydrogen embrittlement. However, hydrogen uptake to NIMS17 steel under CCT and atmospheric exposure decreased the fracture stress. This is because of the stronger hydrogen uptake to the steel containing hydrogen traps than to the AISI 4135 steels. Although NIMS17 steel has a higher strength level than AISI 4135 steel with a tensile strength of 1500 MPa, the decrease in fracture stress is similar between these steels.

  15. Hydrogen embrittlement property of a 1700-MPa-class ultrahigh-strength tempered martensitic steel

    International Nuclear Information System (INIS)

    Li Songjie; Zhang Boping; Akiyama, Eiji; Yuuji, Kimura; Tsuzaki, Kaneaki; Uno, Nobuyoshi

    2010-01-01

    The hydrogen embrittlement property of a prototype 1700-MPa-class ultrahigh-strength steel (NIMS17) containing hydrogen traps was evaluated using a slow strain rate test (SSRT) after cathodic hydrogen precharging, cyclic corrosion test (CCT) and atmospheric exposure. The hydrogen content in a fractured specimen was measured after SSRT by thermal desorption spectroscopy (TDS). The relationship between fracture stress and hydrogen content for the hydrogen-precharged specimens showed that the fracture stress of NIMS17 steel was higher, at a given hydrogen content, than that of conventional AISI 4135 steels with tensile strengths of 1300 and 1500 MPa. This suggests better resistance of NIMS17 steel to hydrogen embrittlement. However, hydrogen uptake to NIMS17 steel under CCT and atmospheric exposure decreased the fracture stress. This is because of the stronger hydrogen uptake to the steel containing hydrogen traps than to the AISI 4135 steels. Although NIMS17 steel has a higher strength level than AISI 4135 steel with a tensile strength of 1500 MPa, the decrease in fracture stress is similar between these steels.

  16. PREFACE: Buried Interface Sciences with X-rays and Neutrons 2010

    Science.gov (United States)

    Sakurai, Kenji

    2011-09-01

    The 2010 summer workshop on buried interface science with x-rays and neutrons was held at Nagoya University, Japan, on 25-27 July 2010. The workshop was organized by the Japan Applied Physics Society, which established a group to develop the research field of studying buried function interfaces with x-rays and neutrons. The workshop was the latest in a series held since 2001; Tsukuba (December 2001), Niigata (September 2002), Nagoya (July 2003), Tsukuba (July 2004), Saitama (March 2005), Yokohama (July 2006), Kusatsu (August 2006), Tokyo (December 2006), Sendai (July 2007), Sapporo (September 2007), Tokyo (December 2007), Tokyo-Akihabara (July 2009) and Hiratsuka (March 2010). The 2010 summer workshop had 64 participants and 34 presentations. Interfaces mark the boundaries of different material systems at which many interesting phenomena take place, thus making it extremely important to design, fabricate and analyse the structures of interfaces at both the atomic and macroscopic scale. For many applications, devices are prepared in the form of multi-layered thin films, with the result that interfaces are not exposed but buried under multiple layers. Because of such buried conditions, it is generally not easy to analyse such interfaces. In certain cases, for example, when the thin surface layer is not a solid but a liquid such as water, scientists can observe the atomic arrangement of the liquid-solid interface directly by using a scanning probe microscope, of which the tip is soaked in water. However, it has become clear that the use of a stylus tip positioned extremely close to the interface might change the structure of the water molecules. Therefore it is absolutely crucial to develop non-contact, non-destructive probes for buried interfaces. It is known that analysis using x-rays and neutrons is one of the most powerful tools for exploring near-surface structures including interfaces buried under several layers. In particular, x-ray analysis using 3rd

  17. Intermediate phases in the hydrogen disproportionated state of NdFeB-type powders

    International Nuclear Information System (INIS)

    Yi, G.; Chapman, J. N.; Brown, D. N.; Harris, I. R.

    2001-01-01

    Transmission electron microscopy studies have been carried out on partially disproportionated NdFeB-type alloys. A new intermediate magnetic (NIM) phase has been identified. Moreover, the lamella structure which subsequently develops from the tetragonal NIM phase comprises a tetragonal NdFe-containing (IL) phase and α-Fe. The experimental data show strong evidence of a well-defined crystallographic relation between both the NIM and lamella phases and between the IL phase and α-Fe. These observations give insight into how crystallographic texture, and hence anisotropy, can be developed in NdFeB-type powders processed by the hydrogenation, disproportionation, desorption, and recombination route. copyright 2001 American Institute of Physics

  18. Analisis Faktor-Faktor Yang Mempengaruhi Profitabilitas Perbankan

    Directory of Open Access Journals (Sweden)

    Wawan Prasetyo

    2015-03-01

    Full Text Available This research result shows that ratio of NPL, BOPO, and NIM influenced the profitability partially. But simultaneously, ratio of CAR, NPL, BOPO, LDR, and NIM influenced to the profitability. Based the research result, it is obtained the conclusion that if NIM in interest income over productive asset has an improvement, then BOPO in the operational cost that spent by related bank will be more efficient. And if LDR in serving and distributing the fund for people can be fulfilled, then NPL in repreship can be controlled and will improve capital adequacy to the CAR, thus it can improve bank profitability. Based on this research, it can be suggested to Bank BUMN Persero that it expected to be able to keep bank stability in order to make bank intermediate function can be running well, thus profitability as orientation of bank established can be fulfilled as expected target.

  19. Working group report: Collider Physics

    Indian Academy of Sciences (India)

    11KEK, Tsukuba, Japan. 12Cornell University ... This is summary of the activities of the working group on collider physics in the IXth ... In view of the requirements of the hour and the available skills and interests, it was decided to .... The actual computation, which is long and somewhat tedious, is currently under way and is ...

  20. Flux pinning and superconducting properties of ZnO added (Nd, Eu, Gd)Ba.sub.2./sub. Cu.sub.3./sub. O.sub.y./sub..

    Czech Academy of Sciences Publication Activity Database

    Muralidhar, M.; Sakai, N.; Jirsa, Miloš; Kono, T.; Murakami, M.; Hirabayashi, I.

    445-448, - (2006), s. 403-407 ISSN 0921-4534. [International Symposium on Superconductivity /18./. Tsukuba, 24.10.2005-26.10.2005] Institutional research plan: CEZ:AV0Z10100520 Keywords : microstructure * MgO seeds * critical current density * flux pinning * LRE-123 melt textured compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.792, year: 2006

  1. Shoot Blight and Leaf Spot of Blueberry Anthracnose Caused by Colletotrichum acutatum

    OpenAIRE

    Shigenobu, YOSHIDA; Takao, TSUKIBOSHI; National Institute for Agro-Environmental Sciences; National Institute for Agro-Environmental Sciences

    2002-01-01

    Shoot blight and leaf spots were found on highbush blueberry trees in Tsukuba, Ibaraki, in 1999. The causal fungus was identified morphologically as Colletotrichum acutatum Simmonds ex Simmonds. This is the first report of blueberry anthracnose caused by C. acutatum in Japan.

  2. Ruby lidar observations and trajectory analysis of stratospheric aerosols injected by the volcanic eruptions of El Chichon

    Science.gov (United States)

    Uchino, O.; Tabata, T.; Akita, I.; Okada, Y.; Naito, K.

    1985-01-01

    Large amounts of aerosol particles and gases were injected into the lower stratosphere by the violet volcanic eruptions of El Chichon on March 28, and April 3 and 4, 1982. Observational results obtained by a ruby lidar at Tsukuba (36.1 deg N, 140.1 deg E) are shown, and some points of latitude dispersion processes of aerosols are discussed.

  3. The Education of a Librarian and Educator: Professor Satoru Takeuchi of Japan

    Science.gov (United States)

    Williams, Robert V.

    2015-01-01

    The early life and professional career of Dr. Satoru Takeuchi, a noted Japanese librarian, educator, and author, are explored here within the context of Japanese library education since World War II. Professor Takeuchi, now retired from the University of Library and Information Science (ULIS) in Tsukuba, Japan, has been an influential educator,…

  4. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 125; Issue 1. Simulation of CO2 concentrations at Tsukuba tall tower using WRF-CO2 tracer transport model. Srabanti Ballav Prabir K Patra Yousuke Sawa Hidekazu Matsueda Ahoro Adachi Shigeru Onogi Masayuki Takigawa Utpal K De. Volume 125 Issue 1 ...

  5. A beam test of prototype time projection chamber using micro ...

    Indian Academy of Sciences (India)

    High Energy Accelerator Organization (KEK), Tsukuba 305-0801, Japan. E-mail: makoto.kobayashi.exp@kek.jp. Abstract. We conducted a series of beam tests of prototype TPCs for the international linear collider (ILC) experiment, equipped with an MWPC, a MicroMEGAS, or GEMs as a readout device. The prototype ...

  6. Effect of gas recirculation intensity and various temperatures on ...

    African Journals Online (AJOL)

    user

    1UFR des Sciences et Gestion de l'Environment, University of Nangui Abrogoua, Abidjan, Côte d'Ivoire. 2Graduate School of Life and Environmental Sciences, University of Tsukuba, .... related the change of the microbial population dynamics from an anaerobic co- digestion of municipal solid waste to the change of mixing.

  7. Factors Impacting Bank Net Interest Margin and the Role of Monetary Policy: Evidence from Turkey

    Directory of Open Access Journals (Sweden)

    Muhammed Hasan Yılmaz

    2017-10-01

    Full Text Available In this study, we investigate factors affecting net interest margin (NIM of commercial banks in Turkey. Especially, our results highlight the relation between unconventional monetary policy shocks and bank margins. To this end, first, we conduct an identification analysis about which parameters of asymmetric interest corridor framework are important in explaining variations in NIM. Using industry-level data, we show that there exists a pass through from BIST interbank overnight repo/reverse repo market rate and weighted average cost of funding (WACF to bank loan and deposit rates. As a result of reduced-form Vector Autoregression (VAR analysis we find the existence of a transmission mechanism from BIST rate and WACF to commercial loan rate, consumer loan rate and deposit rate. Same pass through to loan and deposit rates is also shown in individual bank level with the Panel Vector Autoregression (Panel VAR analysis in the case of 16 commercial banks in Turkey during the period 2011Q1-2016Q1. After the identification analysis, we examine the relationship between NIM and policy rates through System Generalized Method of Moments (GMM techniques by controlling bank specific, industry related and macroeconomic factors. We find that a change in the monetary policy rate has significant and positive impact on NIM. Among bank-specific factors, equity ratio and operating expenses are found to be significantly affecting NIM during the sample period. Our empirical findings also stress the significance of lag values of NIM. Estimations conducted with standardized variables indicate that economic significance of lag values and bank specific variables are larger than that of policy.

  8. Intermittent Intraoperative Neural Monitoring Technology in Minimally Invasive Video-Assisted Thyroidectomy: A Preliminary Study.

    Science.gov (United States)

    Hei, Hu; Zhai, Yifei; Qin, Jianwu; Song, Yongping

    2016-01-01

    Intraoperative neural monitoring (IONM) technology was applied in minimally invasive video-assisted thyroidectomy (MIVAT) to explore its safety and effectiveness. Data were collected retrospectively from October 2009 to August 2011. Inclusion criteria included the following: (1) benign thyroid nodule with maximum diameter less than 4.0 cm by preoperative ultrasound evaluation; (2) no previous thyroid surgeries; (3) no cervical radiation history; (4) normal function of recurrent laryngeal nerve (RLN) examined by preoperative laryngoscopy; (5) patients who did not accept to take a "wait and see" follow-up strategy. Enrolled patients were randomly allocated into NIM group and control group. 46 patients were enrolled in NIM group, and 51 patients were enrolled in control group. All surgeries in NIM group were performed successfully, and majority of tracheal intubations were placed with one attempt. 47 RLNs in NIM group and 60 RLNs in control group were exposed. The time of RLN locating was 6.06 ± 1.48 min in NIM group and 6.92 ± 1.34 min in control group (p = .02). The time of RLN tracing and exposing was 28.96 ± 4.75 min in NIM group and 32.17 ± 5.56 min in control group (p = .02). 1 case of temporary RLN paralysis was observed in both groups, and no permanent RLN paralysis was reported. The application of intermittent IONM in MIVAT is feasible. Intermittent IONM can help reduce the time of RLN locating and the time of RLN tracing and exposing.

  9. Impartial Triangular Chocolate Bar Games

    OpenAIRE

    Miyadera, Ryohei; Nakamura, Shunsuke; Fukui, Masanori

    2017-01-01

    Chocolate bar games are variants of the game of Nim in which the goal is to leave your opponent with the single bitter part of the chocolate bar. The rectangular chocolate bar game is a thinly disguised form of classical multi-heap Nim. In this work, we investigate the mathematical structure of triangular chocolate bar games in which the triangular chocolate bar can be cut in three directions. In the triangular chocolate bar game, a position is a $\\mathcal{P}$-position if and only if $x \\oplu...

  10. 24-channel dual microcontroller-based voltage controller for ion optics remote control

    Science.gov (United States)

    Bengtsson, L.

    2018-05-01

    The design of a 24-channel voltage control instrument for Wenzel Elektronik N1130 NIM modules is described. This instrument is remote controlled from a LabVIEW GUI on a host Windows computer and is intended for ion optics control in electron affinity measurements on negative ions at the CERN-ISOLDE facility. Each channel has a resolution of 12 bits and has a normally distributed noise with a standard deviation of <1 mV. The instrument is designed as a standard 2-unit NIM module where the electronic hardware consists of a printed circuit board with two asynchronously operating microcontrollers.

  11. LH2 three-phase pump control circuit description

    International Nuclear Information System (INIS)

    Pierce, W.

    1977-05-01

    A brief description and circuit drawings are given for a pump control system. The pump is used to circulate liquid hydrogen through the cell and heat exchanger of an LH 2 target. The pump is powered by three-phase 60 cycle power, and the control unit is powered from a positive and negative 24 V dc supply available in the NIM Bin. The control unit is packaged in a double-width NIM module. Drawings are given for the pump speed indicator, function generator, and power supply

  12. Material d'estudi de psicofarmacologia

    OpenAIRE

    Moya Albiol, Luis

    2012-01-01

    Material d'estudi de psicofarmacologia: Delimitació conceptual i desenvolupament històric de la psicofarmacologia. Neurobiologia dels trastorns mentals. Conceptes bàsics en psicofarmacologia. Metodologia i tècniques d’investigació en psicofarmacologia. Bases biològiques dels trastorns de l’estat d’ànim. Antidepressius i estabilitzadors de l’estat d’ànim. Bases biològiques de l’ansietat. Ansiolítics i hipnòtics. Tractaments farmacològics per el trastorn obsessivo-compu...

  13. "Русские!" Русские?.. И Казимир Малевич / Этэри Кекелидзе

    Index Scriptorium Estoniae

    Кекелидзе, Этэри, 1944-

    2014-01-01

    Ülevaade XXIII Peterburi teatrifestivalist "Balti kodu" 2013. a. Pikemalt Ivo van Hove lavastusest Tšehhovi näidendite järgi "De Russen!" (Toneelgroep Amsterdam (Holland)), Alvis Hermanise lavastusest "Oblomov" (Riia Uus Teater), Luk Percevali lavastusest "Vennad Karamazovid" (Theater Thalia (Saksamaa)), Bram Janseni lavastusest Strindbergi "Preili Julie" järgi "Kijken naar Julie" (Bram Jansen Company (Holland)), Juri Butussovi lavastusest "Macbeth-Kino" (Peterburi Lensoveti-nim. Teater), Grigori Kozlovi lavastusest "Vaikne Don" (Мастерская (Peterburi)) ning Rimas Tuminase lavastusest "Jevgeni Onegin" (Vahtangovi-nim. Teater (Moskva))

  14. Improved covariance matrix estimation in spectrally inhomogeneous sea clutter with application to adaptive small boat detection.

    CSIR Research Space (South Africa)

    Herselman, PL

    2008-09-01

    Full Text Available and that is necessary to set the threshold χt as a function of the steering vector Doppler fd. Improvements to the estimation technique are suggested and evaluated where a more localised M is estimated using either frequency agility or the immediate time history... of frequency, calculated as NIM2(fd) = E{z(fd)2}/E2{z(fd)} , (3) where z(fd) is the power spectral density at fd. This is often used to quantify the Rayleigh-likeness of the envelope 0 5 10 15 −500 −250 0 250 500 Doppler frequency [Hz ] NIM2Time [s...

  15. Computational methods and modeling. 3. Adaptive Mesh Refinement for the Nodal Integral Method and Application to the Convection-Diffusion Equation

    International Nuclear Information System (INIS)

    Torej, Allen J.; Rizwan-Uddin

    2001-01-01

    The nodal integral method (NIM) has been developed for several problems, including the Navier-Stokes equations, the convection-diffusion equation, and the multigroup neutron diffusion equations. The coarse-mesh efficiency of the NIM is not fully realized in problems characterized by a wide range of spatial scales. However, the combination of adaptive mesh refinement (AMR) capability with the NIM can recover the coarse mesh efficiency by allowing high degrees of resolution in specific localized areas where it is needed and by using a lower resolution everywhere else. Furthermore, certain features of the NIM can be fruitfully exploited in the application of the AMR process. In this paper, we outline a general approach to couple nodal schemes with AMR and then apply it to the convection-diffusion (energy) equation. The development of the NIM with AMR capability (NIMAMR) is based on the well-known Berger-Oliger method for structured AMR. In general, the main components of all AMR schemes are 1. the solver; 2. the level-grid hierarchy; 3. the selection algorithm; 4. the communication procedures; 5. the governing algorithm. The first component, the solver, consists of the numerical scheme for the governing partial differential equations and the algorithm used to solve the resulting system of discrete algebraic equations. In the case of the NIM-AMR, the solver is the iterative approach to the solution of the set of discrete equations obtained by applying the NIM. Furthermore, in the NIM-AMR, the level-grid hierarchy (the second component) is based on the Hierarchical Adaptive Mesh Refinement (HAMR) system,6 and hence, the details of the hierarchy are omitted here. In the selection algorithm, regions of the domain that require mesh refinement are identified. The criterion to select regions for mesh refinement can be based on the magnitude of the gradient or on the Richardson truncation error estimate. Although an excellent choice for the selection criterion, the Richardson

  16. Activity of neem tree (Azadirachta indica) leaves aqueous extract on Spodoptera frugiperda

    OpenAIRE

    Prates, Hélio Teixeira; Viana, Paulo Afonso; Waquil, José Magid

    2003-01-01

    A lagarta-do-cartucho do milho (Spodoptera frugiperda (J. E. Smith)) tem sido controlada com inseticidas sintéticos. Uma das caracteristicas do nim (Azadirachta indica A. Juss) é sua atividade inseticida contra pragas, como sucedâneo aos sintéticos. O objetivo deste trabalho foi avaliar a atividade inseticida do extrato aquoso das folhas do nim sobre a lagarta-do-cartucho do milho, em laboratório. Bioensaios com diferentes concentrações de extrato em dieta artificial, tendo o inseticida chlor...

  17. Eight-Channel Digital Signal Processor and Universal Trigger Module

    Science.gov (United States)

    Skulski, Wojtek; Wolfs, Frank

    2003-04-01

    A 10-bit, 8-channel, 40 megasamples per second digital signal processor and waveform digitizer DDC-8 (nicknamed Universal Trigger Module) is presented. The digitizer features 8 analog inputs, 1 analog output for a reconstructed analog waveform, 16 NIM logic inputs, 8 NIM logic outputs, and a pool of 16 TTL logic lines which can be individually configured as either inputs or outputs. The first application of this device is to enhance the present trigger electronics for PHOBOS at RHIC. The status of the development and the first results are presented. Possible applications of the new device are discussed. Supported by the NSF grant PHY-0072204.

  18. Unrestricted Mintek publications 1966 to 1984

    International Nuclear Information System (INIS)

    Glen, H.W.

    1984-01-01

    This publication lists the 895 unrestricted reports, 508 papers, 45 patents, 5 special publications, and 2 technical bulletins that were issued as publications of the National Institute for Metallurgy (NIM) and the Council for Mineral Technology (Mintek) from 1966 (the year of NIM's inception) to 31st March 1984. For ease of reference, these publications are also classified under research topics. Also included are details of the periodicals issued by Mintek and a list of its current miscellaneous publications, which include brochures and leaflets of various kinds

  19. A compact four channel scaler with display

    International Nuclear Information System (INIS)

    Ingelman, S.; Wannberg, G.

    1977-03-01

    This note describes the construction of a simple-to-make and inexpensive four channel, four decade scaler with display. The unit is intended for use with standard NIM modules in nuclear counting experiments where counting rates are fairly moderate. (Auth.)

  20. [Lutsuvad kivid : helisalvestis : kirjanikud muusikas / koostanud Aapo Ilves] / Veiko märka

    Index Scriptorium Estoniae

    Märka, Veiko, 1964-

    2013-01-01

    CD “Lutsuvad kivid. Kirjanikud muusikas” on valminud Tartu Oskar Lutsu nim. Linnaraamatukogu ja Tartu kirjandusfestivali Prima Vista ühisel ettevõtmisel, et tähistada kaht sünnipäeva – Lutsu raamatukogu 100 ja Prima Vista 10

  1. Intraoperative monitoring of marginal mandibular nerve during neck dissection.

    Science.gov (United States)

    Tirelli, Giancarlo; Bergamini, Pier Riccardo; Scardoni, Alessandro; Gatto, Annalisa; Boscolo Nata, Francesca; Marcuzzo, Alberto Vito

    2018-05-01

    The purpose of this study was to assess the efficacy of intraoperative nerve integrity monitoring (NIM) to prevent marginal mandibular nerve injuries during neck dissection. This prospective study compared 36 patients undergoing NIM-assisted neck dissection from July 2014 to March 2015 to a cohort of 35 patients subjected to neck dissection over an identical period of time before the technique was introduced. We also assessed possible correlations between marginal mandibular nerve injuries and other factors, such as anthropometric measurements, presence of clinical neck metastases, type of neck dissection, and site of primary tumor. The incidence of marginal mandibular nerve paralyses was significantly lower among the group of patients undergoing NIM-assisted neck dissection (P = .021). There was no significant difference in the duration of the procedure, and the technique resulted in a limited increase of cost. No other factor seemed to influence the onset of marginal mandibular nerve palsy. In our opinion, NIM is a valuable aid for preventing marginal mandibular nerve injuries during neck dissection. © 2018 Wiley Periodicals, Inc.

  2. Eesti graafika rahvusvahelisel areenil / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    26. VIII-28. XI Fredrikstadis Hebleri-nim. rahvusvahelises graafikakeskuses avatud XII Norra rahvusvahelisel graafikatriennaalil esindavad Eestit Anu Kalm, Avo Keerend, Vive Tolli, Benjamin Vasserman, Mare Vint. Peapreemia ئ Anthony Hill. Triennaali president - Herman Hebler (s. 1911). 24. VI-15. IX Poolas toimunud X Lodzi rahvusvahelisel väikegraafika triennaalil osalesid Eestist Virge Jõekalda, Benjamin Vasserman.

  3. 26th National Neurotrauma Symposium

    Science.gov (United States)

    2008-12-31

    Sanchez Alvaro I., Puyana Juan C., Fabio Anthony, Adelson P. David 81 COMPARATIVE NEUROPROTECTIVE EFFECTS OF CYCLOSPORIN A AND NIM811, A NON...Xiangbai, Fabio Anthony, Yuan Zhifang, Niyonkuru Christian, Wagner Amy 99 ACTIVATION OF MITOCHONDRIAL UNCOUPLING PROTEINS BY POLYUNSATURATED FATTY...Metabolism/Physiological Assessments TBI Mitchell Cohen University of California, San Francisco Ferguson Adam, Cohen Mitchell, Morabito Diane

  4. Sotsiaalne kapital, poliitiliste institutsioonide mõjutamisvõimaluste tunnetamine ja usaldus võimuinstitutsioonide vastu / Tõnis Saarts

    Index Scriptorium Estoniae

    Saarts, Tõnis

    2002-01-01

    Autor vaatleb kuivõrd mõjutab sotsiaalne kapital ja poliitiliste institutsioonide töö mõjutamise võimaluse tunnetamine mitte-eestlaste ja eestlaste usaldust nende poliitiliste institutsioonide vastu nii kohalikul kui ka keskvõimu tasandil. Tabelid. Bibliogr. 8 nim. Kokkuvõte ingl. k.

  5. Data acquisition systems for high energy physics experiments

    International Nuclear Information System (INIS)

    Duran, I.; Olmos, P.

    1986-01-01

    The Data Acquisition Systems most frequently used in High Energy Physics experiments is described. This report begins with a brief description of the main elements of a typical signal processing chain, following with a detailed exposition of the four most popular instrumentation standards used in this kind of experiments: NIM, CAMAC, and VMI. (author). 20 figs., 9 ref

  6. Algorithmic decision rules for estimating growth, removals, and mortality within a national-scale forest inventory (USA)

    Science.gov (United States)

    William H. McWilliams; Carol L. Alerich; William A. Bechtold; Mark Hansen; Christopher M. Oswalt; Mike Thompson; Jeff Turner

    2012-01-01

    The U.S. Department of Agriculture, Forest Service, Forest Inventory and Analysis (FIA) program maintains the National Information Management System (NIMS) that provides the computational framework for the annual forest inventory of the United States. Questions regarding the impact of key elements of programming logic, processing criteria, and estimation procedures...

  7. Симонов: играть надо всегда радостно / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2011-01-01

    Festivali Kuldne mask Eestis raames etendub Gerard Sibleyrasi absurdikomöödia "Ветер шумит в тополях" (Moskva Jevgeni Vahtangovi nim. Teater), lavastaja Rimas Tuminas. Lavastuses teeb kaasa Venemaa näitleja Vladimir Simonov

  8. Актер Суханов создает аритмию дел / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2011-01-01

    Festivali Kuldne mask Eestis raames etendub Gerard Sibleyrasi absurdikomöödia "Ветер шумит в тополях" (Moskva Jevgeni Vahtangovi nim. Teater), lavastaja Rimas Tuminas. Lavastuses teeb kaasa Venemaa tuntud teatri- ja filminäitleja Maksim Suhhanov

  9. Множественные "я" Максима Суханова / Максим Суханов ; интервьюировал Николай Караев

    Index Scriptorium Estoniae

    Суханов, Максим, 1963-

    2011-01-01

    Festivali Kuldne mask Eestis raames etendub Gerard Sibleyrasi absurdikomöödia "Ветер шумит в тополях" (Moskva Jevgeni Vahtangovi nim. Teater), lavastaja Rimas Tuminas. Lavastuses teeb kaasa Venemaa tuntud teatri- ja filminäitleja Maksim Suhhanov

  10. A remote control system for the LELA experiment

    International Nuclear Information System (INIS)

    Castellano, M.; Cavallo, N.; Cevenini, F.; Patteri, P.

    1983-01-01

    A modular system for closed loop computer control of stepping motors has been realized and used for optical component movement of LELA experiment in radiation risk area. A CAMAC module, controlling up to 15 stepping motors, a NIM dual motor driver and a special purpose circuit for computer interfacing are described

  11. Muusikamaailm : New Yorki tuleb Maazel. Kiri ei lahku veel lavalt. Kennedy Centeri autasud. Opera Internationali ankeet / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    L.Maazel valiti NY Filharmoonikute uueks peadirigendiks alates 2002.a., dirigendi praegustest tegemistest. K.Te Kanawa jätkab lauljategevust. Washingtoni Kennedy nim. kunstikeskuse aasta autasudest. Muusikaajakiri Opera Internationali lugejad valisid 20. saj. suurimad ooperilauljad, dirigendid ja lavastajad

  12. Muusikamaailm : Klaverifestival Luzernis. Rahvusvahelistel konkurssidel. Ooperiharuldus Huddersfieldi festivalil. Strausside kontsert ka Helsingisse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Klaverifestivalist Luzernis. Weimaris toimunud Liszti nim. pianistide konkursi võitjatest, Hannoveris toimunud Joseph Joachimi viiuldajate konkursi võitjatest. Huddersfieldi festivalil etendus C. Vivier' ooper "Kopernikus". Helsingi Messikeskuse Amfisaalis hakatakse korraldama pidulikke uusaastakontserte sarnaselt Viinile, kontserdist 1. jaan. 2001//Labeque, Katia ja Marielle - kanada klaveriduo//Jacques Loussier trio - dzhässtrio//Sibeliuse Akadeemia Sümfooniaorkester

  13. Kas õpilaste stress on viimase kümmekonna aastaga suurenenud? / Marit Tarkin, Enda Trubok, Kersti Rohtmets, Leena Arras, Kaie Lõhmus

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad Kuressaare gümnaasiumi õpetaja Marit Tarkin, Albu põhikooli õpetaja Enda Trubok, Audru keskkooli direktor Kersti Rohtmets, Tallinna Pääsküla gümnaasiumi direktor Leena Arras, C. R. Jakobsoni nim gümnaasiumi õppealajuhataja Kaie Lõhmus

  14. Distributed intelligence in CAMAC

    International Nuclear Information System (INIS)

    Kunz, P.F.

    1977-01-01

    A simple extension of the CAMAC standard is described which allows distributed intelligence at the crate level. By distributed intelligence is meant that there is more than one source of control in a system. This standard is just now emerging from the NIM Dataway Working Group and its European counterpart. 1 figure

  15. Adsorptive stripping voltammetric determination of nitroimidazole derivative on multiwalled carbon nanotube modified electrodes: influence of size and functionalization of nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Jara-Ulloa, Paola; Canete-Rosales, Paulina; Nunez-Vergara, Luis J; Squella, Juan A., E-mail: asquella@ciq.uchile.c [University of Chile, Santiago (Chile). Chemical and Pharmaceutical Sciences Faculty. Bioelectrochemistry Lab.

    2011-07-01

    1-Methyl-4-nitro-2-bromine methylimidazole (4-NimMeBr), was electrochemically reduced on mercury, glassy carbon and multiwalled carbon nanotubes (MWCNT) modified electrodes. 4-NimMeBr was adsorbed on the MWCNT modified electrode thus permitting the implementation of an adsorptive stripping voltammetric (ASV) method. We have used 4-NimMeBr as a prototype electroactive nitro compound to study the effect of both the size of the nanotubes and its functionalization by oxidation. The oxidized MWCNT forms better dispersions than the non-oxidized, producing electrode surface with higher density of MWCNT as was determined by electrochemical mapping using scanning electrochemical microscopy (SECM). Under the optimized conditions, the peak current was proportional to the concentration of 4-NimMeBr in the range of 10{sup -6} mol L{sup -1} to 10{sup -4} mol L{sup -1} with detection and quantification limits of 4.41 x 10{sup -6} mol L{sup -1} and 6.21 x 10{sup -6} mol L{sup -1}, respectively. The sensibility of bare electrode was 0.01 {mu}A per mmol L{sup -1}, which was lower than the value of 5.34 and 6.97 mA per mmol L{sup -1} obtained using short and large oxidized MWCNT, respectively. (author)

  16. Encapsulated Curcumin for Transdermal Administration

    African Journals Online (AJOL)

    Erah

    Faculty of Pharmacy, University of Benin, ... Institute of Pharmacy, NIMS University, Jaipur, 303121, Rajasthan, Global Institute of .... securely attached on one side. ..... Clinic.Biochem. 2002: 17(12): 33-43. 13. Garg SK. Effect of Curcuma longa ...

  17. Non-indigenous macroinvertebrate species in Lithuanian fresh waters, Part 2: Macroinvertebrate assemblage deviation from naturalness in lotic systems and the consequent potential impacts on ecological quality assessment

    Directory of Open Access Journals (Sweden)

    Arbačiauskas K.

    2011-12-01

    Full Text Available The biological pressure represented by non-indigenous macroinvertebrate species (NIMS should be addressed in the implementation of EU Water Framework Directive as this can have a direct impact on the ’naturalness’ of the invaded macroinvertebrate assemblage. The biocontamination concept allows assessment of this deviation from naturalness, by evaluation of abundance and disparity contamination of an assemblage. This study aimed to assess the biocontamination of macroinvertebrate assemblages in Lithuanian rivers, thereby revealing the most high-impact non-indigenous species, and to explore the relationship between biocontamination and conventional metrics of ecological quality. Most of the studied rivers appeared to be impacted by NIMS. The amphipods Pontogammarus robustoides, Chelicorophium curvispinum and snail Litoglyphus naticoides were revealed as high-impact NIMS for Lithuanian lotic systems. Metrics of ecological quality which largely depend upon the richness of indicator taxa, such as the biological monitoring working party (BMWP score and Ephemeroptera/Plecoptera/Trichoptera (EPT taxa number, were negatively correlated with biocontamination, implying they could provide unreliable ecological quality estimates when NIMS are present. Routine macroinvertebrate water quality monitoring data are sufficient for generation of the biocontamination assessment and thus can provide supplementary information, with minimal extra expense or effort. We therefore recommend that biocontamination assessment is included alongside established methods for gauging biological and chemical water quality.

  18. Ionic-Liquid-Tethered Nanoparticles: Hybrid Electrolytes

    KAUST Repository

    Moganty, Surya S.

    2010-10-22

    A new class of solventless electrolytes was created by tethering ionic liquids to hard inorganic ZrO2 nanostructures (see picture; NIM=nanoscale ionic material). These hybrid fluids exhibit exceptional redox stability windows, excellent thermal stability, good lithium transference numbers, long-term interfacial stability in the presence of a lithium anode and, when doped with lithium salt, reasonable ionic conductivities.

  19. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  20. Nuclear incident monitor criticality alarm instrument for the Savannah River Site: Technical manual

    International Nuclear Information System (INIS)

    Jenkins, J.B.

    1996-01-01

    The Savannah River Site is a Department of Energy facility. The facility stores, processes, and works with fissionable material at a number of locations. Technical standards and US Department of Energy orders, require these locations to be monitored by criticality alarm systems under certain circumstances. The Savannah River Site calls such instruments Nuclear Incident Monitors or NIMs. The Sole purpose of the Nuclear Incident Monitor is to provide an immediate evacuation signal in the case of an accidental criticality in order to minimize personnel exposure to radiation. The new unit is the third generation Nuclear Incident Monitor at the Savannah River Site. The second generation unit was developed in 1979. It was designed to eliminate vacuum-tube circuits, and was the first solid state NIM at SRS. The major design objectives of the second generation NIM were to improve reliability and reduce maintenance costs. Ten prototype units have been built and tested. This report describes the design of the new NIM and the testing that took place to verify its acceptability

  1. Linnapea autasustas tublisid arvutajaid / Liisi Seil

    Index Scriptorium Estoniae

    Seil, Liisi, 1971-

    2009-01-01

    Viljandi linnapea Kalle Jents võttis vastu August Maramaa nimelise matemaatikaülesannete lahendamise võistluse võitjad, nende õpetajad ja võistluse korraldajad. Eriauhinna pälvis Carl Robert Jakobsoni nim. Gümnaasiumi õpilane Siim-Ilmar Nopri

  2. Hierarchical Canopy Dynamics of Electrolyte-Doped Nanoscale Ionic Materials

    KAUST Repository

    Jespersen, Michael L.

    2013-12-23

    Nanoscale ionic materials (NIMs) are organic-inorganic hybrids prepared from ionically functionalized nanoparticles (NP) neutralized by oligomeric polymer counterions. NIMs are designed to behave as liquids under ambient conditions in the absence of solvent and have no volatile organic content, making them useful for a number of applications. We have used nuclear magnetic resonance relaxation and pulsed-field gradient NMR to probe local and collective canopy dynamics in NIMs based on 18-nm silica NPs with a covalently bound anionic corona, neutralized by amine-terminated ethylene oxide/propylene oxide block copolymers. The NMR relaxation studies show that the nanosecond-scale canopy dynamics depend on the degree of neutralization, the canopy radius of gyration, and crowding at the ionically modified NP surface. Two canopy populations are observed in the diffusion experiments, demonstrating that one fraction of the canopy is bound to the NP surface on the time scale (milliseconds) of the diffusion experiment and is surrounded by a more mobile layer of canopy that is unable to access the surface due to molecular crowding. The introduction of electrolyte ions (Na+ or Mg2+) screens the canopy-corona electrostatic interactions, resulting in a reduced bulk viscosity and faster canopy exchange. The magnitude of the screening effect depends upon ion concentration and valence, providing a simple route for tuning the macroscopic properties of NIMs. © 2013 American Chemical Society.

  3. Electrical Transport Properties of Polycrystalline Monolayer Molybdenum Disulfide

    Science.gov (United States)

    2014-07-14

    Lou, Sina Najmaei, Matin Amani, Matthew L. Chin, Zheng Se. TASK NUMBER Liu Sf. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAMES AND ADDRESSES 8...Transport Properties of Polycrystalline Monolayer Molybdenum Disulfide Sina Najmaei,t.§ Matin Ama ni,M Matthew L. Chin,* Zhe ng liu/ ·"·v: A. Gle n

  4. Rubriik "Linnulennul olnust"

    Index Scriptorium Estoniae

    2004-01-01

    Bachi "Jõuluoratooriumist", Jõulumuusika festivalist, kontserdist "Jõulupolüfoonia" Tallinnas ja Haapsalus", "Te Deumist" Tartus, Pärnu neiud tõid Tšehhimaalt grand prix, H. Elleri nim. muusikakooli korraldatud romantismi pidunädalast, 9. märtsil Ülikooli aulas sai kuulda Mendelssohni kantaate, teistest Tartus toimuvatest muusikasündmustest

  5. Muusikamaailm : Ateena konkurss tuleb esinduslik. Kaks raamatut juubilar-lauljatest. David Robertson lahkub Pariisist. Jean-Pierre Rampal surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Septembris Ateenas toimuvast D. Mitropoulose nim. rahvusvahelisest noorte dirigentide konkursist. Saksamaal ilmus kaks raamatut nimekatelt lauljatelt ئ D. Fischer-Dieskau "Zeit eines Lebens. Auf Fährtensuche" ja J. King'i "Nun sollt Ihr mich befragen". D. Robertson lahkub Ensemble InterContemporaini kunstilise juhi kohalt, dirigendi edasisest tegevuskavast. J.-P. Rampal'i muusikuteest

  6. Uudised : Ernesaksa auhind ning stipendiumid. Arvo Pärdi uus teos Roomas. Paavo Järvi Euroopas / Ilmar Moss

    Index Scriptorium Estoniae

    Moss, Ilmar

    2000-01-01

    4. dets. toimus Kuusalus G.Ernesaksa mälestuskontsert, kus anti üle stipendiumid ja Ernesaksa nim. auhind. 19. nov. toimus Roomas A.Pärdi teose "Cecilia, vergine romana" esiettekanne. P.Järvi kontsertidest detsembris Euroopas

  7. Solution of Fractional Partial Differential Equations in Fluid Mechanics by Extension of Some Iterative Method

    Directory of Open Access Journals (Sweden)

    A. A. Hemeda

    2013-01-01

    Full Text Available An extension of the so-called new iterative method (NIM has been used to handle linear and nonlinear fractional partial differential equations. The main property of the method lies in its flexibility and ability to solve nonlinear equations accurately and conveniently. Therefore, a general framework of the NIM is presented for analytical treatment of fractional partial differential equations in fluid mechanics. The fractional derivatives are described in the Caputo sense. Numerical illustrations that include the fractional wave equation, fractional Burgers equation, fractional KdV equation, fractional Klein-Gordon equation, and fractional Boussinesq-like equation are investigated to show the pertinent features of the technique. Comparison of the results obtained by the NIM with those obtained by both Adomian decomposition method (ADM and the variational iteration method (VIM reveals that the NIM is very effective and convenient. The basic idea described in this paper is expected to be further employed to solve other similar linear and nonlinear problems in fractional calculus.

  8. Operation Brain Trauma Therapy Extended Studies

    Science.gov (United States)

    2015-05-01

    precluded our ability to move forward. Others agents with favorable voting at our prior drug selection meetings include edaravone and etanercept...Minocycline, P7C3-A20, NACA, NIM-811, Edaravone , and Etanercept, among many others by Dr. Kochanek, with updating of the manual through the most

  9. Teatr im. Mossoveta - vernõi drug Tallintsev / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Mängitakse Juri Jerjomini lavastusi "Mees, naine ja armuke" (F. Dostojevski ja I. Turgenevi teoste põhjal) ja Tennessee Williamsi "Tramm nimega Iha". Tutvustavalt teatrist ja teatri varasematest külalisetendustest Tallinnas 1996, 1998 ja 2004

  10. Vsemirnaja teatralnaja Olimpiada : Rossiiski razmahh / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2001-01-01

    21. apr. kuni 29. juunini toimub Moskvas Ülemaailmne Teatriolümpiaad ja A. Tšehhovi nim. IV rahvusvaheline teatrifestival, millest võtab osa 150 teatritruppi 50 maalt. Festivalil esines ka Priit Pedajas lavastusega "Lõikuskuu tantsud" Pjotr Fomenko teatris

  11. Uudised : Hortus Musicus Moskvas. TPÜ naiskoor koorikonkursil. RAM samal laval Mark Knopfleriga. "Tuuleveskid. Kerkokell" / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2000-01-01

    Hortus Musicus esines 23. ja 24. nov. Moskvas. TPÜnaiskoor võitis II preemia XVII rahvusvahelisel F.Schuberti nim. koorikonkursil Austrias. RAM esineb 8. dets. Helsingis Hartwall Areenas heategevuskontserdil. RAM esineb 6. dets. Estonia kontserdisaalis kavaga "Tuuleveskid. Kerkokell"

  12. Assessing the port to port risk of vessel movements vectoring non-indigenous marine species within and across domestic Australian borders.

    Science.gov (United States)

    Campbell, Marnie L; Hewitt, Chad L

    2011-07-01

    Biofouling of vessels is implicated as a high risk transfer mechanism of non-indigenous marine species (NIMS). Biofouling on international vessels is managed through stringent border control policies, however, domestic biofouling transfers are managed under different policies and legislative arrangements as they cross internal borders. As comprehensive guidelines are developed and increased compliance of international vessels with 'clean hull' expectations increase, vessel movements from port to port will become the focus of biosecurity management. A semi-quantitative port to port biofouling risk assessment is presented that evaluates the presence of known NIMS in the source port and determines the likelihood of transfer based on the NIMS association with biofouling and environmental match between source and receiving ports. This risk assessment method was used to assess the risk profile of a single dredge vessel during three anticipated voyages within Australia, resulting in negligible to low risk outcomes. This finding is contrasted with expectations in the literature, specifically those that suggest slow moving vessels pose a high to extreme risk of transferring NIMS species.

  13. IAEA-HypoX. A randomized multicenter study of the hypoxic radiosensitizer nimorazole concomitant with accelerated radiotherapy in head and neck squamous cell carcinoma

    DEFF Research Database (Denmark)

    Metwally, Mohamed Ahmed Hassan; Ali, Rubina; Kuddu, Maire

    2015-01-01

    PURPOSE: To test the hypothesis that radiotherapy (RT) of head and neck squamous cell carcinoma (HNSCC) can be improved by hypoxic modification using nimorazole (NIM) in association with accelerated fractionation. MATERIALS AND METHODS: The protocol was activated in March 2012 as an international...

  14. Hierarchical Canopy Dynamics of Electrolyte-Doped Nanoscale Ionic Materials

    KAUST Repository

    Jespersen, Michael L.; Mirau, Peter A.; von Meerwall, Ernst D.; Koerner, Hilmar; Vaia, Richard A.; Fernandes, Nikhil J.; Giannelis, Emmanuel P.

    2013-01-01

    Nanoscale ionic materials (NIMs) are organic-inorganic hybrids prepared from ionically functionalized nanoparticles (NP) neutralized by oligomeric polymer counterions. NIMs are designed to behave as liquids under ambient conditions in the absence of solvent and have no volatile organic content, making them useful for a number of applications. We have used nuclear magnetic resonance relaxation and pulsed-field gradient NMR to probe local and collective canopy dynamics in NIMs based on 18-nm silica NPs with a covalently bound anionic corona, neutralized by amine-terminated ethylene oxide/propylene oxide block copolymers. The NMR relaxation studies show that the nanosecond-scale canopy dynamics depend on the degree of neutralization, the canopy radius of gyration, and crowding at the ionically modified NP surface. Two canopy populations are observed in the diffusion experiments, demonstrating that one fraction of the canopy is bound to the NP surface on the time scale (milliseconds) of the diffusion experiment and is surrounded by a more mobile layer of canopy that is unable to access the surface due to molecular crowding. The introduction of electrolyte ions (Na+ or Mg2+) screens the canopy-corona electrostatic interactions, resulting in a reduced bulk viscosity and faster canopy exchange. The magnitude of the screening effect depends upon ion concentration and valence, providing a simple route for tuning the macroscopic properties of NIMs. © 2013 American Chemical Society.

  15. Nanostructure-initiator mass spectrometry biometrics

    Science.gov (United States)

    Leclerc, Marion; Bowen, Benjamin; Northen, Trent

    2015-09-08

    Several embodiments described herein are drawn to methods of identifying an analyte on a subject's skin, methods of generating a fingerprint, methods of determining a physiological change in a subject, methods of diagnosing health status of a subject, and assay systems for detecting an analyte and generating a fingerprint, by nanostructure-initiator mass spectrometry (NIMS).

  16. Nastojashtshije spektakli dlja nastojashtshego zritelja / Ella Agranovskaja

    Index Scriptorium Estoniae

    Agranovskaja, Ella, 1950-

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Juri Jerjomini lavastus "Mees, naine ja armuke" F. Dostojevski ja I. Turgenevi teoste põhjal, peaosas Valentin Gaft ning lavastus Tennessee Williamsi järgi "Tramm nimega Iha"

  17. The Role of Schools and their Capabilities to Ensure Safe Sheltering During a Storm

    Science.gov (United States)

    2017-03-01

    Education HIEMA Hawaii Emergency Management Agency HMGP Hazard Mitigation Grant Program HTA Hawaii Tourism Authority IBC international building...Ministry of Education, Culture, Sports , Science and Technology MOU memoranda of understanding NIMS National Incident Management NIPP National...gathering-place/. 51 Department of Business, Economic Development and Tourism , Population and Economic Projections for the State of Hawaii to 2040

  18. 76 FR 72431 - Criteria for Preparation and Evaluation of Radiological Emergency Response Plans and Preparedness...

    Science.gov (United States)

    2011-11-23

    ... national preparedness terms and concepts found in the National Incident Management System (NIMS)/ Incident... many of the REP Program's operative guidance and policy documents into one location, and [[Page 72432... for alert and notification systems. In addition, Supplement 4 revises and adds evaluation criteria and...

  19. Data acquisition systems for high energy Physics experiments

    International Nuclear Information System (INIS)

    Duran, I.; Olmos, P.

    1986-01-01

    We describe here the Data Acquisition Systems most frequently used in High Energy Physics experiments. This report begins with a brief description of the main elements of a typical signal processing chain, following with a detailed exposition of the four most popular instrumentation standards used in this kind of experimental: NIM, CAMAC, FASTBUS and VME. (Author) 9 refs

  20. Õpetajad olid enam-vähem ühed-samad, kuigi koolis käinud olen kolmel ajal / Moja Konno ; üles kirjutanud Ülo Alo Võsar

    Index Scriptorium Estoniae

    Konno, Moja

    2008-01-01

    Ülo Alo Võsari poolt üles kirjutatud lugu Moja Konno õpingutest alguses Viljandi Eesti Haridusseltsi Tütarlastegümnaasiumis, mis riigikorra muutudes pärast 1940. aastat oli sunnitud vahetama nime Carl Robert Jakobsoni nim. Viljandi 1. Keskkooliks

  1. Amplification and discrimination of signals from proportional multiwire chambers

    International Nuclear Information System (INIS)

    Papadopoulos, L.; Bosio, C.; Cordelli, M.

    1976-03-01

    A circuit is described which detects signals from proportional multiwire chambers. The threshold is about 3μ A and the time jitter of the pulse obtained is better than 2.5 ns. The circuit has one negative input and two complementary outputs. The realized module includes 8 channels with common trigger level control and was built as NIM standard unit

  2. Modeling recognition memory using the similarity structure of natural input

    NARCIS (Netherlands)

    Lacroix, J.P.W.; Murre, J.M.J.; Postma, E.O.; van den Herik, H.J.

    2006-01-01

    The natural input memory (NIM) model is a new model for recognition memory that operates on natural visual input. A biologically informed perceptual preprocessing method takes local samples (eye fixations) from a natural image and translates these into a feature-vector representation. During

  3. "J. Chr. Brotze. Estonica" esitlused Poolas

    Index Scriptorium Estoniae

    2007-01-01

    TLÜ emeriitprofessori Raimo Pullati juhtimisel ja TLÜ teadlaste ühistööna valminud entsüklopeedilise suurteose "J. Chr. Brotze. Estonica" esitlused Johannes Paulus II nim. Lublini Katoliiklikus Ülikoolis seminaril "Eesti kultuur ja kunst" ning Poola Rahvusraamatukogus, kus toimub ka Brotze kollektsiooni näituse avamine

  4. Otvedaite "Ljubovnõi napitok"

    Index Scriptorium Estoniae

    1999-01-01

    Majakovski nim. Akadeemilise Teatri külalisetendused Tallinnas 16. ja 17. mail Vene Draamateatris.Etendatakase Tatjana Ahramkova lavastuses "Armujooki" Peter Shafferi näidendi "Lettice and Lovage" järgi. Peaosas näitleja Natalja Gundareva

  5. Eesti-saksa kultuurivahetus

    Index Scriptorium Estoniae

    1999-01-01

    Frankfurdi Goethe-nim. Ülikooli ja Eesti Kunstiakadeemia vahetusnäitusena avati 26. X eesti kunstnike Margot Kase, Kiwa, Marko Laimre, Piia Ruberi, Kadi Soosalu, Mirja-Mari Smidti, Killu Sukmiti, Taave Tuutma näitus 'Lääne-Ida diivan' Frankfurdis. Koostajad Dorothee Bauerle-Willert, Mari Laanemets

  6. Трое неизвестных / Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    Tallinnas jagati Juri Dolgorukovi nim. kirjandusauhindu. I preemia võitis Maks Frai ulmeromaaniga "Большая телега", Eestist pärit Aleksandr Degterenko sai diplomi jutustusega "Al Sacrum". Preemia on määratud vene kirjanikele Lätis, Leedus ja Eestis

  7. Eesti retrospektiivse rahvusbibliograafia kolm köidet ilmunud / Anne Ainz

    Index Scriptorium Estoniae

    Ainz, Anne

    1995-01-01

    Bibl. 3 nim. Kokkuv. inglise k. lk. 151. Rets. rmt.: Eestikeelne raamat 1901-1917. A-P, II R-Y / Toim. Endel Annus. - Tln.: Eesti TA; Eestis ilmunud saksa-, vene- ja muukeelne perioodika 1675-1940 / Toim. E. Annus. Tln. : Eesti TA, 1993

  8. A pulse amplifier for nuclear instrumentation

    International Nuclear Information System (INIS)

    Martin, D.; Cliff, P.

    1987-01-01

    A Class-A 1 Watt amplifier has been designed and optimized for nanosecond pulses. Spanning .01MHz to 1300Mhz, signal gain is 26dB with gain flatness of 1dB. The amplifier drive +- 10 volts across 500 with 350ps risetime. Each amplifier is housed in a 2-wide NIM

  9. Скандинавская проза и восточноевропейская поэзия / Борис Тух

    Index Scriptorium Estoniae

    Тух, Борис, 1946-

    2005-01-01

    27.-31. dets. Tallinnas toimunud III rahvusvahelisest teatrifestivalist "Talveöö unenägu 2004". Arvustatakse lavastusi : I. B. Singeri "Ori" Gesher-teatri esituses, R. Lundani "Tarbetud inimesed" KOM-teatri esituses, A. Tshehhovi "Kirsiaed" P. Adamtshikovi lavastuses Valgevene Janka Kupala nim. Draamateatri esituses ning Tallinna Linnateatri lavastusi "Isad ja pojad" A. Shapiro lavastuses ja "Vincent" A. Prosa lavastuses

  10. Math Around the World: Grades 5-8. Teachers' Guide. Great Explorations in Math and Science (GEMS).

    Science.gov (United States)

    Braxton, Beverly; And Others

    This document is a collection of eight games from four continents. Students use mathematics that is directly relevant to them as they take part in the games. The first five games (NIM, Kalah, Tower of Hanoi, Shongo Networks, and Magic Squares) feature presentation instructions that describe multiple-session classroom activities for grades 5-8.…

  11. 5 kandidaati nüüdisaegse arhitektuuri auhinnale / Maris Meiesaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2009-01-01

    Euroopa Liidu Mies van der Rohe nim. preemia finalistid: Atelier Marc Barani (Nice'i trammivõrk ja jalakäijate ala), Massimiliano ja Doriana Fuksas (Zenith Music Hall Strasbourgis), Grafton Architects (Luigi Bocconi ülikool Milanos), Snohetta (Norra ooperi- ja balletiteater Oslos), RCR Aranda Pigem Vilalta Arquitectes (Barcelona Sant Antoni linnaosa raamatukogu, vanurite keskus, linnaruum). Loetletud seitse kandidaati Eestist

  12. Incident Management: Process into Practice

    Science.gov (United States)

    Isaac, Gayle; Moore, Brian

    2011-01-01

    Tornados, shootings, fires--these are emergencies that require fast action by school district personnel, but they are not the only incidents that require risk management. The authors have introduced the National Incident Management System (NIMS) and the Incident Command System (ICS) and assured that these systems can help educators plan for and…

  13. High-voltage power supply - 2.500 V - 4mA

    International Nuclear Information System (INIS)

    Souza, H.H. de.

    1977-01-01

    A high-voltage power supply, in a NIM two-width module, was developed to be used in nuclear measurements systems. The design utilizes the principle of DC-DC conversion. A general description of the instrument and of its circuity is presented, as well as a report of the results obtained from the tests performed to establish its characteristics [pt

  14. Juri Jerjomin : teatr dolzhen bõt derzkim / Juri Jerjomin ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Jerjomin, Juri

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Mängitakse Juri Jerjomini lavastusi "Mees, naine ja armuke" (F. Dostojevski ja I. Turgenevi teoste põhjal) ja Tennessee Williamsi "Tramm nimega Iha". Vestluses lavastajaga ka vene teatrist, arengust, näitekirjanikest, lavastustest

  15. Teatr imeni Mossoveta prijehhal v ljubimõi gorod / Margarita Kornõsheva

    Index Scriptorium Estoniae

    Kornõsheva, Margarita, 1957-

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Juri Jerjomini lavastus "Mees, naine ja armuke" F. Dostojevski ja I. Turgenevi teoste põhjal, peaosas Valentin Gaft ning lavastus Tennessee Williamsi järgi "Tramm nimega Iha". Näitlejad Valentin Gaft ja Olga Ostroumova pressikonverentsist

  16. Odnoi krovi s Dostojevskim / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Mängitakse Juri Jerjomini lavastusi "Mees, naine ja armuke" (F. Dostojevski ja I. Turgenevi teoste põhjal) ja Tennessee Williamsi "Tramm nimega iha"

  17. "Ja rabotaju na zhenshtshin", govorit znamenitõi rezhissjor Juri Jerjomin / Polina Nilina

    Index Scriptorium Estoniae

    Nilina, Polina

    2006-01-01

    5.-7. juulini toimuvad Estonia teatris Moskva Mossoveti-nim. Teatri külalisetendused. Juri Jerjomini lavastus "Mees, naine ja armuke" F. Dostojevski ja I. Turgenevi teoste põhjal, peaosas Valentin Gaft ning lavastus Tennessee Williamsi järgi "Tramm nimega Iha". Teatrist, näitlejatest, lavastustest

  18. Uudised : Marko Martini konkursiedu Kanadas. "Con brio" lõppkontserdile 6 esinejat. Tublid noored trompetistid / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2000-01-01

    M. Martin pälvis II koha III Esther Honensi nim. pianistide konkursil Kanadas. Konkursi "Con brio" lõppvooru pääsejatest. N. ja J.Ots olid edukad I rahvusvahelisel noorte trompetistide konkursil Jekabpilsis Lätis

  19. Muusikamaailm : Rostropovitshi suurprojekt. Festival "Arsenal Baroque" Metzis. "UltraSchall" Berliinis. Vermeuleni preemia 2000. Thielemann jääb Berliini. Henri Tomasi ئ 100 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    M. Rostropovitsh tõi publiku ette Shostakovitshi ooperi "Mtsenski maakonna leedi Macbeth". Festivalist Arsenal Baroque" Metzis. Rahvusvahelisest festivalist "UltraSchall" Berliinis. Matthijs Vermeuleni nim. preemia sai tänavu R. Rijnvos. C. Thielemann jääb Deutsche Operi muusikadirektoriks veel aastani 2007. Lühidalt H. Tomasist

  20. На крыльце сидели царь, царевич... / Елена Скульская

    Index Scriptorium Estoniae

    Скульская, Елена, 1950-

    2010-01-01

    Võrdluses on kolm tsaar Ivan Julmast (Ivan IV, 1530-1584) jutustavat teost: Mossoveti nim. Teatri ajalooline näidend "Isa ja poja kuningriik" (tegelasteks Ivan Julm ja tsareevitš Fjodor), lavastaja Juri Jerjomin. Andrei Ešpai lavastatud 16-osaline teleseriaal "Ivan Groznõi" (Venemaa 2009) ja Pavel Lungini ajalooline mängufilm "Tsaar" (Venemaa 2009)

  1. Tšehhov - ilma ainsagi sõnata / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2004-01-01

    Festivali külalisest Valgevene Janka Kupala nim. Valgevene Akad. Rahvusteatrist ja P. Adamtshikovi fantaasiast "S.V." A. Tšehhovi "Kirsiaia" ainetel. Lisatud E. Kekelidze mulje etendusest, mida ta nägi ülevenemaalisel festivalil Peterburis

  2. Recent financial crisis and business perspective of Greek bank subsidiaries in Serbia

    Directory of Open Access Journals (Sweden)

    Ljumović Isidora

    2016-01-01

    Full Text Available Greece was one of the Eurozone countries that was hit the hardest by the crisis and there is a real threat that the risk overflow from the Greece home markets could have negative consequences on the activities of their subsidiaries in Serbia since they account for 14% of total assets of the banking sector in Serbia. The initial reasons for entering the Serbian market were versatile, the most important ones being the high interest margins, untapped debt potential of the corporate and retail sectors and a search for new clients. The data about the performance of Greek bank subsidiaries are mixed. The ROAA and ROAE data show that they are below average, but had a positive trend before the crisis. On the other hand, the data on the net interest margin (NIM show that before crisis the Greek subsidiaries had NIM above the industry average. After the crisis, the NIM decreased, but most of the banks are still above the average. Negative profitability figures mean that a bank is unable to generate income (net interest income or other operating income to the level necessary to cover the expenses, even though the NIM of Greek bank subsidiaries is above the banking sector average.

  3. Марина Голуб: У меня расчетверение творческой личности! / интервьюировал Николай Хрусталев

    Index Scriptorium Estoniae

    Голуб, Марина, 1957-

    2011-01-01

    Vene näitlejanna Marina Golub räägib endast, oma tööst ja rollidest. Näitleja viibis Tallinnas seoses Moskva Tšehhovi nim. Kunstiteatri külalisetendusega "Vassa Zeleznova", milles ta mängib peaosa

  4. Sequence Classification: 227637 [

    Lifescience Database Archive (English)

    Full Text Available biotics resistance protein, NimA-family || http://www.ncbi.nlm.nih.gov/protein/15895740 ... ...Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|15895740|ref|NP_349089.1| Possible 5-Nitroimidazole anti

  5. Data acquisition systems for high energy Physics experiments; Sistemas de adquisicion de datos en experimentos de Fisica de Particulas

    Energy Technology Data Exchange (ETDEWEB)

    Duran, I; Olmos, P

    1986-07-01

    We describe here the Data Acquisition Systems most frequently used in High Energy Physics experiments. This report begins with a brief description of the main elements of a typical signal processing chain, following with a detailed exposition of the four most popular instrumentation standards used in this kind of experimental: NIM, CAMAC, FASTBUS and VME. (Author) 9 refs.

  6. Contact Allergy to Neem Oil.

    NARCIS (Netherlands)

    de Groot, Anton; Jagtman, Berend A; Woutersen, Marjolijn

    2018-01-01

    A case of allergic contact dermatitis from neem oil is presented. Neem oil (synonyms: Melia azadirachta seed oil [INCI name], nim oil, margosa oil) is a vegetable (fixed) oil obtained from the seed of the neem tree Azadirachta indica by cold pressing. Contact allergy to neem oil has been described

  7. Structural basis for the Nanos-mediated recruitment of the CCR4–NOT complex and translational repression

    Science.gov (United States)

    Bhandari, Dipankar; Raisch, Tobias; Weichenrieder, Oliver; Jonas, Stefanie; Izaurralde, Elisa

    2014-01-01

    The RNA-binding proteins of the Nanos family play an essential role in germ cell development and survival in a wide range of metazoan species. They function by suppressing the expression of target mRNAs through the recruitment of effector complexes, which include the CCR4–NOT deadenylase complex. Here, we show that the three human Nanos paralogs (Nanos1–3) interact with the CNOT1 C-terminal domain and determine the structural basis for the specific molecular recognition. Nanos1–3 bind CNOT1 through a short CNOT1-interacting motif (NIM) that is conserved in all vertebrates and some invertebrate species. The crystal structure of the human Nanos1 NIM peptide bound to CNOT1 reveals that the peptide opens a conserved hydrophobic pocket on the CNOT1 surface by inserting conserved aromatic residues. The substitutions of these aromatic residues in the Nanos1–3 NIMs abolish binding to CNOT1 and abrogate the ability of the proteins to repress translation. Our findings provide the structural basis for the recruitment of the CCR4–NOT complex by vertebrate Nanos, indicate that the NIMs are the major determinants of the translational repression mediated by Nanos, and identify the CCR4–NOT complex as the main effector complex for Nanos function. PMID:24736845

  8. Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.

    Science.gov (United States)

    Bhandari, Dipankar; Raisch, Tobias; Weichenrieder, Oliver; Jonas, Stefanie; Izaurralde, Elisa

    2014-04-15

    The RNA-binding proteins of the Nanos family play an essential role in germ cell development and survival in a wide range of metazoan species. They function by suppressing the expression of target mRNAs through the recruitment of effector complexes, which include the CCR4-NOT deadenylase complex. Here, we show that the three human Nanos paralogs (Nanos1-3) interact with the CNOT1 C-terminal domain and determine the structural basis for the specific molecular recognition. Nanos1-3 bind CNOT1 through a short CNOT1-interacting motif (NIM) that is conserved in all vertebrates and some invertebrate species. The crystal structure of the human Nanos1 NIM peptide bound to CNOT1 reveals that the peptide opens a conserved hydrophobic pocket on the CNOT1 surface by inserting conserved aromatic residues. The substitutions of these aromatic residues in the Nanos1-3 NIMs abolish binding to CNOT1 and abrogate the ability of the proteins to repress translation. Our findings provide the structural basis for the recruitment of the CCR4-NOT complex by vertebrate Nanos, indicate that the NIMs are the major determinants of the translational repression mediated by Nanos, and identify the CCR4-NOT complex as the main effector complex for Nanos function.

  9. Kunst rahvani ehk Kwangju biennaal / Siram

    Index Scriptorium Estoniae

    Siram, pseud., 1968-

    2004-01-01

    Biennaal "Tolmutera, veetilk" Lõuna-Koreas, avatud kuni 13. XI 2004. Kuraatorid Yongwoo Lee (New York, Soul), Kerry Brougher (Washington-distrikt), Suk-won Chang (Kwangju). City Light Award - Watercio Caldas (Brasiilia), Korea fondi preemia - Jennifer Allora ja Guillermo Calzadilla (Kuuba) jt. Johann Köleri nim. Positivistlik Kunsttööstuskool osales biennaali performance'iprogrammis

  10. The Effectiveness of Neurological Impress Method on Reading Fluency of Students with Learning Disabilities in Amman, Jordan

    Science.gov (United States)

    Ziadat, Ayed H.; AL-Awan, Mohammad Soud A.

    2018-01-01

    The aim of this study was to evaluate the effectiveness of Neurological Impress Method (NIM) on reading fluency of students with learning disabilities in Amman, Jordan. A sample of forty students (boys and girls) between the ages 10-12 years old with learning disabilities were selected from the Fourth Amman Educational Directorate in the Hashemite…

  11. "Sinjaja ptitsa" - shedevr stoletnei võderzhki / Anatoli Korolev

    Index Scriptorium Estoniae

    Korolev, Anatoli

    2008-01-01

    Moskva Kunstiteater tähistab Maurice Maeterlincki näidendi "Sinilind" lavastuse 100. juubelit. Esmalavastus Moskva Kunstiteatris 1908, lavastaja Konstantin Stanislavski. "Sinilind" on vene reformaatori ainus lavastus, mis on säilinud meie päevini. Praegu mängitakse seda Gorki-nim. Kunstiteatris Tatjana Doronina lavastuses

  12. Kas Euroopa saab Euroopaks? / Timothy Garton Ash ; tõlk. Aet Varik

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2002-01-01

    3. aprillil 1996 peetud Sanford S. Elbergi nim. loeng California Ülikooli (Berkeley) Rahvusvaheliste Uuringute Instituudis. Euroopa määratlus enne 1945. aastat, 1945-1989, külma sõja järgsel perioodil ja tänapäeval

  13. On recent (2008–2012 stratospheric aerosols observed by lidar over Japan

    Directory of Open Access Journals (Sweden)

    O. Uchino

    2012-12-01

    Full Text Available An increase in stratospheric aerosols caused by the volcanic eruption of Mt. Nabro (13.37° N, 41.70° E on 12 June 2011 was detected by lidar at Tsukuba (36.05° N, 140.13° E and Saga (33.24° N, 130.29° E in Japan. The maximum backscattering ratios at a wavelength of 532 nm were 2.0 at 17.0 km on 10 July 2011 at Tsukuba and 3.6 at 18.2 km on 23 June 2011 at Saga. The maximum integrated backscattering coefficients (IBCs at 532 nm above the first tropopause height were 4.18×10−4 sr−1 on 11 February 2012 at Tsukuba and 4.19×10−4 sr−1 on 23 June 2011 at Saga, respectively.

    A time series of lidar observational results at Tsukuba have also been reported from January 2008 through May 2012. Increases in stratospheric aerosols were observed after the volcanic eruptions of Mt. Kasatochi (52.18° N, 175.51° E in August 2008 and Mt. Sarychev Peak (48.09° N, 153.20° E in June 2009. The yearly averaged IBCs at Tsukuba were 2.54×10−4 sr−1, 2.48×10−4 sr−1, 2.45×10−4 sr−1, and 2.20×10−4 sr−1 for 2008, 2009, 2010, and 2011, respectively. These values were about twice the IBC background level (1.21×10−4 sr−1 from 1997 to 2001 at Tsukuba. We briefly discuss the influence of the increased aerosols on climate and the implications for analysis of satellite data.

  14. The G2/M DNA damage checkpoint inhibits mitosis through Tyr15 phosphorylation of p34cdc2 in Aspergillus nidulans.

    Science.gov (United States)

    Ye, X S; Fincher, R R; Tang, A; Osmani, S A

    1997-01-02

    It is possible to cause G2 arrest in Aspergillus nidulans by inactivating either p34cdc2 or NIMA. We therefore investigated the negative control of these two mitosis-promoting kinases after DNA damage. DNA damage caused rapid Tyr15 phosphorylation of p34cdc2 and transient cell cycle arrest but had little effect on the activity of NIMA. Dividing cells deficient in Tyr15 phosphorylation of p34cdc2 were sensitive to both MMS and UV irradiation and entered lethal premature mitosis with damaged DNA. However, non-dividing quiescent conidiospores of the Tyr15 mutant strain were not sensitive to DNA damage. The UV and MMS sensitivity of cells unable to tyrosine phosphorylate p34cdc2 is therefore caused by defects in DNA damage checkpoint regulation over mitosis. Both the nimA5 and nimT23 temperature-sensitive mutations cause an arrest in G2 at 42 degrees C. Addition of MMS to nimT23 G2-arrested cells caused a marked delay in their entry into mitosis upon downshift to 32 degrees C and this delay was correlated with a long delay in the dephosphorylation and activation of p34cdc2. Addition of MMS to nimA5 G2-arrested cells caused inactivation of the H1 kinase activity of p34cdc2 due to an increase in its Tyr15 phosphorylation level and delayed entry into mitosis upon return to 32 degrees C. However, if Tyr15 phosphorylation of p34cdc2 was prevented then its H1 kinase activity was not inactivated upon MMS addition to nimA5 G2-arrested cells and they rapidly progressed into a lethal mitosis upon release to 32 degrees C. Thus, Tyr15 phosphorylation of p34cdc2 in G2 arrests initiation of mitosis after DNA damage in A. nidulans.

  15. Personality assessment inventory profile and predictors of elevations among dissociative disorder patients.

    Science.gov (United States)

    Stadnik, Ryan D; Brand, Bethany; Savoca, Angela

    2013-01-01

    Assessing patients with dissociative disorders (DD) using personality tests is difficult. On the Minnesota Multiphasic Personality Inventory-2 ( J. N. Butcher, W. G. Dahlstrom, J. R. Graham, A. Tellegen, & B. Kaemmer, 1989 ), DD patients often obtain elevations on multiple clinical scales as well as on validity scales that were thought to indicate exaggeration yet have been shown to be elevated among traumatized individuals, including those with DD. No research has been conducted to determine how DD patients score on the Personality Assessment Inventory (PAI; L. C. Morey, 1991 ), which includes the symptom exaggeration scale Negative Impression (NIM) and the malingering scales Malingering Index (MAL) and Rogers Discriminant Function (RDF). The goals of this study were to document the PAI profile of dissociative identity disorder (DID) and dissociative disorder not otherwise specified (DDNOS) patients and to determine how the validity and Schizophrenia scales are related to other PAI scales as well as dissociation. A total of 42 inpatients with DID or DDNOS were assessed on the PAI as well as the Dissociative Experiences Scale-II. The DID/DDNOS patients were elevated on many PAI scales, including NIM and, to a lesser extent, MAL, but not RDF. Dissociation scores significantly and uniquely predicted NIM scores above and beyond Depression and Borderline Features. In addition, after we controlled for MAL and RDF, dissociation was positively associated with NIM. In contrast, after we controlled for the other 2 scales, dissociation was not related to MAL and was negatively related to RDF, indicating that RDF and, to a lesser extent, MAL are better correlates of feigning in DD patients than NIM.

  16. Inhalation carcinogenicity study with nickel metal powder in Wistar rats

    International Nuclear Information System (INIS)

    Oller, Adriana R.; Kirkpatrick, Daniel T.; Radovsky, Ann; Bates, Hudson K.

    2008-01-01

    Epidemiological studies of nickel refinery workers have demonstrated an association between increased respiratory cancer risk and exposure to certain nickel compounds (later confirmed in animal studies). However, the lack of an association found in epidemiological analyses for nickel metal remained unconfirmed for lack of robust animal inhalation studies. In the present study, Wistar rats were exposed by whole-body inhalation to 0, 0.1, 0.4, and 1.0 mg Ni/m 3 nickel metal powder (MMAD = 1.8 μm, GSD = 2.4 μm) for 6 h/day, 5 days/week for up to 24 months. A subsequent six-month period without exposures preceded the final euthanasia. High mortality among rats exposed to 1.0 mg Ni/m 3 nickel metal resulted in the earlier termination of exposures in this group. The exposure level of 0.4 mg Ni/m 3 was established as the MTD for the study. Lung alterations associated with nickel metal exposure included alveolar proteinosis, alveolar histiocytosis, chronic inflammation, and bronchiolar-alveolar hyperplasia. No increased incidence of neoplasm of the respiratory tract was observed. Adrenal gland pheochromocytomas (benign and malignant) in males and combined cortical adenomas/carcinomas in females were induced in a dose-dependent manner by the nickel metal exposure. The incidence of pheochromocytomas was statistically increased in the 0.4 mg Ni/m 3 male group. Pheochromocytomas appear to be secondary to the lung toxicity associated with the exposure rather than being related to a direct nickel effect on the adrenal glands. The incidence of cortical tumors among 0.4 mg Ni/m 3 females, although statistically higher compared to the concurrent controls, falls within the historical control range; therefore, in the present study, this tumor is of uncertain relationship to nickel metal exposure. The lack of respiratory tumors in the present animal study is consistent with the findings of the epidemiological studies

  17. Hotspots on Io During the Ganymede 2 Encounter

    Science.gov (United States)

    1996-01-01

    The Near Infrared Mapping Spectrometer (NIMS) on the Galileo spacecraft imaged Io at high spectral resolution at a range of 439,000 km (275,000 miles) during the G2 encounter on 6 September 1996. This image shows, on the right, Io as seen by NIMS, centered on 150 W longitude. The image on the left shows the same view point from Voyager data (from the encounters in 1979 and 1980). The NIMS image can be compared to the NIMS hotspot image from the G1 orbit (June 1996) to monitor changes on Io. The most dramatic feature of the G2 image is the hotspot at Malik Patera. Preliminary analysis of the data yields a temperature of at least 1000 K (727 C) for this hotspot, an increase of more than 300 K from the G1 encounter. In the overlap area of the G1 and G2 images all the hotspots seen during the G1 encounter are also seen in the G2 image. Other hotspots were seen, including one at the Pele plume origin site. This image is at the 4 micron band to best view the Malik hotspot. Most of the other hotspots are best seen at longer wavelengths. NIMS is continuing to observe Io to monitor volcanic activity throughout the Galileo mission.The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov.

  18. Enhanced nonlinearity interval mapping scheme for high-performance simulation-optimization of watershed-scale BMP placement

    Science.gov (United States)

    Zou, Rui; Riverson, John; Liu, Yong; Murphy, Ryan; Sim, Youn

    2015-03-01

    Integrated continuous simulation-optimization models can be effective predictors of a process-based responses for cost-benefit optimization of best management practices (BMPs) selection and placement. However, practical application of simulation-optimization model is computationally prohibitive for large-scale systems. This study proposes an enhanced Nonlinearity Interval Mapping Scheme (NIMS) to solve large-scale watershed simulation-optimization problems several orders of magnitude faster than other commonly used algorithms. An efficient interval response coefficient (IRC) derivation method was incorporated into the NIMS framework to overcome a computational bottleneck. The proposed algorithm was evaluated using a case study watershed in the Los Angeles County Flood Control District. Using a continuous simulation watershed/stream-transport model, Loading Simulation Program in C++ (LSPC), three nested in-stream compliance points (CP)—each with multiple Total Maximum Daily Loads (TMDL) targets—were selected to derive optimal treatment levels for each of the 28 subwatersheds, so that the TMDL targets at all the CP were met with the lowest possible BMP implementation cost. Genetic Algorithm (GA) and NIMS were both applied and compared. The results showed that the NIMS took 11 iterations (about 11 min) to complete with the resulting optimal solution having a total cost of 67.2 million, while each of the multiple GA executions took 21-38 days to reach near optimal solutions. The best solution obtained among all the GA executions compared had a minimized cost of 67.7 million—marginally higher, but approximately equal to that of the NIMS solution. The results highlight the utility for decision making in large-scale watershed simulation-optimization formulations.

  19. Variation of atmospheric 210Pb concentration in the inland area of Chinese continent

    International Nuclear Information System (INIS)

    Doi, Taeko; Sato, Jun.

    1995-01-01

    Atmospheric concentrations of 210 Pb and their variations over Urumqi, Lanzhou and Baotou, cities located in inland area of Chinese continent, were observed for a period of 1 year in 1992. The monthly average concentrations ranged from 0.27 to 4.57 mBq/m 3 . The concentrations over these cities in winter were several times higher than that observed at Tsukuba Science City, Japan, and the range of variation was also larger. The variations in concentration over the 3 localities were similar to each other, showing the same seasonal variation pattern: low concentration appeared in summer and high in winter. This variation pattern was different from that observed at Tsukuba Science City. The variations in concentration over Chinese continent, where precipitation is much lower than that in Japan, correlated quite well with the variation in precipitation. (author)

  20. Superconductivity and normal state properties of non-centrosymmetric CePt3Si: a status report

    International Nuclear Information System (INIS)

    Bauer, E.; Bonalde, I.; Sigrist, M.

    2005-01-01

    Ternary CePt 3 Si crystallizes in the tetragonal P4mm structure which lacks a center of inversion. Antiferromagnetic order sets in at T N approx 22 K followed by superconductivity (SC) below Tc approx 0.75 K. Large values of H' c2 approx -8.5 T/K and H c2 (0) approx 5T were derived, referring to Cooper pairs formed out of heavy quasiparticles. The mass enhancement originates from Kondo interactions with a characteristic temperature T K approx 8 K. CePt 3 Si follows the general features of correlated electron systems and can be arranged within the Kadowaki-Woods plot next to the unconventional SC UPt 3 . NMR and mSR results show that both magnetic order and SC coexist on a microscopic scale without having spatial segregation of both phenomena. The absence of an inversion symmetry gives rise to a lifting of the degeneracy of electronic bands by spin-orbit coupling. As a consequence, the SC order parameter may have uncommon features as indicated from a very unique NMR relaxation rate 1/T 1 and a linear temperature dependence of the penetration depth λ

  1. Thermal and electron transport studies on the valence fluctuating compound YbNiAl4

    Science.gov (United States)

    Falkowski, M.; Kowalczyk, A.

    2018-05-01

    We report the thermoelectric power S and thermal conductivity κ measurements on the valence fluctuating compound YbNiAl4, furthermore taking into account the impact of the applied magnetic field. We discuss our new results with revisiting the magnetic [χ(T)], transport [ρ(T)], and thermodynamic [Cp(T)] properties in order to better understand the phenomenon of thermal and electron transport in this compound. The field dependence of the magnetoresistivity data is also given. The temperature dependence of thermoelectric power S(T) was found to exhibit a similar behaviour as expected for Yb-based compounds with divalent or nearly divalent Yb ions. In addition, the values of total thermal conductivity as a function of temperature κ(T) of YbNiAl4 are fairly low compared to those of pure metals which may be linked to the fact that the conduction band is perturbed by strong hybridization. A deeper analysis of the specific heat revealed the low-T anomaly of the ratio Cp(T)/T3, most likely associated with the localized low-frequency oscillators in this alloy. In addition, the Kadowaki-Woods ratio and the Wilson ratio are discussed with respect to the electronic correlations in YbNiAl4.

  2. Polaronic Nonmetal-Correlated Metal Crossover System β'-CuxV2O5 with Anharmonic Copper Oscillation and Thermoelectric Conversion Performance

    Science.gov (United States)

    Onoda, Masashige; Sato, Takuma

    2017-12-01

    The crystal structures and electronic properties of β'CuxV2O5 are explored through measurements of X-ray four-circle diffraction, electrical resistivity, thermoelectric power, thermal conductivity, magnetization, and electron paramagnetic resonance. For various compositions with 0.243 ≤ x ≤ 0.587, the crystal structures are redetermined through the anharmonic approach of the copper displacement factors, where the anharmonicity is reduced with increasing Cu concentration. The electron transport for x ≤ 0.45 is nonmetallic due to polaron hopping and the random potential of Cu ions, while for x = 0.60, a correlated Fermi-liquid state appears with a Wilson ratio of 1.3 and a Kadowaki-Woods ratio close to the universal value for heavy-fermion systems. At around x = 0.50, the polaronic bandwidth may broaden so that the Hubbard subbands caused by the electron correlation will overlap. The nonmetallic composition in the proximity of the nonmetal-metal crossover shows a dimensionless thermoelectric power factor of 10-2 at 300 K, partly due to the anharmonic copper oscillation.

  3. Japan Accelerator Conference

    International Nuclear Information System (INIS)

    Anon.

    1989-01-01

    At the international level, the high energy accelerator scene evolves rapidly and the International Conference on High Energy Accelerators is where its strong pulse can best be felt. This year, the Conference was held for the first time in Japan, with the 14th meeting in the series having been hosted in August by the Japanese KEK National Laboratory for High Energy Physics, Tsukuba. The venue was a recognition of the premier accelerator physics and technology status achieved by this diligent nation

  4. Student teaching and research laboratory focusing on brain-computer interface paradigms--A creative environment for computer science students.

    Science.gov (United States)

    Rutkowski, Tomasz M

    2015-08-01

    This paper presents an applied concept of a brain-computer interface (BCI) student research laboratory (BCI-LAB) at the Life Science Center of TARA, University of Tsukuba, Japan. Several successful case studies of the student projects are reviewed together with the BCI Research Award 2014 winner case. The BCI-LAB design and project-based teaching philosophy is also explained. Future teaching and research directions summarize the review.

  5. Benchmark test of CP-PACS for lattice QCD

    International Nuclear Information System (INIS)

    Yoshie, Tomoteru

    1996-01-01

    The CP-PACS is a massively parallel computer dedicated for calculations in computational physics and will be in operation in the spring of 1996 at Center for Computational Physics, University of Tsukuba. In this paper, we describe the architecture of the CP-PACS and report the results of the estimate of the performance of the CP-PACS for typical lattice QCD calculations. (author)

  6. Dicty_cDB: SFH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

  7. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC148 (Link to dictyBase) - G00403 DDB0215559 Contig-U08747-1...rary) Clone ID VFC148 (Link to dictyBase) Atlas ID - NBRP ID G00403 dictyBase ID DDB0215559 Link to Contig C...ontig-U08747-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC1-B...STEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICTIKTPLLVGSIPNGVTDLFL HDGFSEPISQDIIPPSVQNLYLCDIKLPFK...it--- ---LMKSXFIIHSKSINXAKKPKRVQFGDKVFTYYNKDENNGIISTEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICT

  9. Dicty_cDB: SLB394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB394 (Link to dictyBase) - G24120 DDB0184167BP Contig-U13982... (Link to library) Clone ID SLB394 (Link to dictyBase) Atlas ID - NBRP ID G24120 dictyBase ID DDB0184167BP L...ink to Contig Contig-U13982-1 Original site URL http://dictycdb.biol.tsukuba.ac.j...2 Translated Amino Acid sequence TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT...e B: TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT

  10. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  11. Dicty_cDB: VHJ417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

  12. Dicty_cDB: CHA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

  13. Europe Report, Science and Technology

    Science.gov (United States)

    1986-12-08

    Fair in Tsukuba several thousand Japanese schoolchildren were conducted a la Disneyland through enormous representations of "space colonies.’ And in...of Elf shares, were to finally grant Renault the additional appro- priation referred to in last April’s special national budget. Renault could then...Fr 2.5 billion in government aid is granted to small and medium-sized companies in the data processing sector. 36 3. Funds are not being funneled

  14. Summary and outlook for KEKTC5

    International Nuclear Information System (INIS)

    Quinn, Helen

    2002-01-01

    This is the summary talk of a meeting held at the KEK, Tsukuba, Japan, November 20-22, 2001. I give a brief summary of the talks we heard, and a few comments of my own on various points that have been made. Other talks given at this meeting are referred to by the speakers last name; these talks will appear in the same proceedings. See these talks for the detailed references for each subject

  15. Autonomy-How much is too much

    Science.gov (United States)

    2007-06-22

    Autonomous Robots Automatically Operated Car (1977) The first demonstration of a driverless car occurred in 1977 in Tsukuba, Japan[19][20] The car ...is autonomy? Brief history of autonomous robots Current field use of robots Current state-of-the-art for autonomous robots Barriers to the use of... autonomous robots Considering the human factor Outlook for the future 19 June 2007 Systems & Software Technology

  16. License - RPD | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available lows: Rice Proteome Database © Setsuko Komatsu (National Institute of Crop Science, National Agriculture and Food Research Organizati...1-18 Kannondai Tsukuba, Ibaraki 305-8634, Japan National Institute of Crop Science, National Agriculture and Food Research Organizati...on) licensed under CC Attribution-Share Alike 4.0 Intern...on Setsuko Komatsu E-mail: About Providing Links to This Database You can freely pr

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB533 (Link to dictyBase) - G02515 DDB0218082 Contig-U10369-1...brary) Clone ID VFB533 (Link to dictyBase) Atlas ID - NBRP ID G02515 dictyBase ID DDB0218082 Link to Contig ...Contig-U10369-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-... %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> predict

  18. Robotic and Virtual Reality BCIs Using Spatial Tactile and Auditory Oddball Paradigms

    OpenAIRE

    Rutkowski, Tomasz M.

    2016-01-01

    The paper reviews nine robotic and virtual reality (VR) brain–computer interface (BCI) projects developed by the author, in collaboration with his graduate students, within the BCI–lab research group during its association with University of Tsukuba, Japan. The nine novel approaches are discussed in applications to direct brain-robot and brain-virtual-reality-agent control interfaces using tactile and auditory BCI technologies. The BCI user intentions are decoded from the brainwaves in realti...

  19. Mutation breeding newsletter. No. 38

    International Nuclear Information System (INIS)

    1991-12-01

    This issue contains a number of contributions from readers describing experiments in plant breeding (the individual items are indexed separately) and a report on the 30th Gamma-Field Symposium held in Tsukuba, Japan in July 1991. Also included is a list of officially released mutant varieties of seed-propagated crops taken from the FAO/IAEA database of mutant varieties. It is planned to organize a database on available crop plant mutant variety germplasm collections. Refs, figs and tabs

  20. The second workshop on phase separation with ordering

    International Nuclear Information System (INIS)

    Osamura, K.; Furusaka, M.

    1993-04-01

    The second workshop on phase separation with ordering was held at the seminar room of Booster, National Laboratory for High Energy Physics, KEK, Tsukuba, in March 16-17, 1992. 31 participants attended this meeting. The structure and its dynamical change were discussed mainly in the experimental viewpoint, and the theories have been developed and the results of simulation were reported. (J.P.N.) 115 refs

  1. 関東地域の現地水田転換畑ほ場におけるダイズへの地下水位制御システム(FOEAS)と不耕起狭畦栽培の導入効果

    OpenAIRE

    島田, 信二; 前川, 富也; 濱口, 秀生; 若杉, 晃介; 藤森, 新作

    2017-01-01

    We attempted to clarify the effects of water table control by farm-oriented enhancement for aquatic system (FOEAS) and non-tillage cultivation on seedingefficiency, growth, yield, and seed component of soybean (Glycine max (L.) Merrill) grown on farmer’s fields in Tsukuba, Ibaraki.The experiment was performed for five years (2007- 2011) by using three cultivation methods: control field using conventional rotary seeding (CC), FOEAS field with conventional rotary seeding (FC), and FOEAS field w...

  2. Japan Accelerator Conference

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1989-11-15

    At the international level, the high energy accelerator scene evolves rapidly and the International Conference on High Energy Accelerators is where its strong pulse can best be felt. This year, the Conference was held for the first time in Japan, with the 14th meeting in the series having been hosted in August by the Japanese KEK National Laboratory for High Energy Physics, Tsukuba. The venue was a recognition of the premier accelerator physics and technology status achieved by this diligent nation.

  3. Database Description - PLACE | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available abase Description General information of database Database name PLACE Alternative name A Database...Kannondai, Tsukuba, Ibaraki 305-8602, Japan National Institute of Agrobiological Sciences E-mail : Databas...e classification Plant databases Organism Taxonomy Name: Tracheophyta Taxonomy ID: 58023 Database...99, Vol.27, No.1 :297-300 External Links: Original website information Database maintenance site National In...- Need for user registration Not available About This Database Database Descripti

  4. Dicty_cDB: SHE695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT

  5. Wilson and Domainwall Kernels on Oakforest-PACS

    Science.gov (United States)

    Kanamori, Issaku; Matsufuru, Hideo

    2018-03-01

    We report the performance of Wilson and Domainwall Kernels on a new Intel Xeon Phi Knights Landing based machine named Oakforest-PACS, which is co-hosted by University of Tokyo and Tsukuba University and is currently fastest in Japan. This machine uses Intel Omni-Path for the internode network. We compare performance with several types of implementation including that makes use of the Grid library. The code is incorporated with the code set Bridge++.

  6. Mobile Networked Sensors for Environmental Observatories

    Science.gov (United States)

    Kaiser, W. J.

    2005-12-01

    The development of the first embedded networked sensing (ENS) systems has been rapidly followed by their successful deployment for investigations in environments ranging from forest ecosystems, to rivers and lakes, and to subsurface soil observations. As ENS systems have been deployed, many technology challenges have been successfully addressed. For example, the requirements for local and remote data access and long operating life have been encountered and solved with a novel hierarchical network architecture and unique, low power platforms. This presentation will describe this progress and also the development and applications of a new ENS system addressing the most current challenges: A robotic ENS platform providing precise, reliable, and sustained observation capability with diverse sensing capabilities that may adapt to environmental dynamics. In the development of methods for autonomous observation by networked sensors, many applications have emerged requiring spatially and temporally intensive data sampling. Examples include the mapping of forest understory solar radiation, autonomous acquisition of imaging for plant phenology, and mapping of contaminant concentration in aquatic systems. Common to these applications is the need to actively and continuously configure the location and orientation of sensors for high fidelity mapping of the spatial distribution of phenomena. To address this primary environmental observation need, a new sensing platform, Networked Infomechanical Systems (NIMS) has been developed. NIMS relies on deployed aerial infrastructure (for example, cable suspension systems) in the natural environment to permit robotic devices to precisely and reliably move or remain stationary as required at elevations that may lie directly in or above the forest canopy or within a river or stream. NIMS systems are suspended to allow devices to translate a sensor node horizontally, and also to raise and lower devices. Examples of sensors that are now

  7. Accelerator mass spectrometry (AMS) dating from the modern age to the past million age

    International Nuclear Information System (INIS)

    Sasa, K.; Nagashima, Y.; Seki, R.; Takahashi, T.; Tosaki, Y.; Sueki, K.; Bessyo, K.; Matsumura, H.; Miura, T.

    2006-01-01

    A multi-nuclide Accelerator Mass Spectrometry system at the University of Tsukuba (Tsukuba AMS system) is able to measure the long-lived radioisotopes of 14 C, 26 Al, 36 Cl and 129 I. The Tsukuba AMS system is able to perform AMS measurements with the terminal voltage of more than 10 MV. It is difficult to estimate the modern age dating (timescale of the past ten years) by the AMS dating method because the low attenuation of long-lived radioisotopes. The atomic bomb-produced radioisotopes are proposed as the environmental traces for the modern age dating. There is the advantage that the long half life of radioisotopes makes the attenuation negligilbe compared with the short half life of radioisotopes. We applied the 36 Cl bomb pulse as a dating tool for modern groundwater (∼50 years) instead of the 3 H bomb pulse. In addition, we have developed 32 Si-AMS system. The half life of 32 Si is about 140 years, therefore 32 Si-AMS is a useful tool for the modern age dating. On the other hand, we have started a new project to measure the cosmogenic nuclide of 36 Cl in an ice core retrieved from Dome Fuji station at Antarctic in order to investigate the past solar activity and the past earth environment as the timescale of the past million age. (author)

  8. PREFACE: 11th IAEA Technical Meeting on H-mode Physics and Transport Barriers

    Science.gov (United States)

    Takizuka, Tomonori

    2008-07-01

    This volume of Journal of Physics: Conference Series contains papers based on invited talks and contributed posters presented at the 11th IAEA Technical Meeting on H-mode Physics and Transport Barriers. This meeting was held at the Tsukuba International Congress Center in Tsukuba, Japan, on 26-28 September 2007, and was organized jointly by the Japan Atomic Energy Agency and the University of Tsukuba. The previous ten meetings in this series were held in San Diego (USA) 1987, Gut Ising (Germany) 1989, Abingdon (UK) 1991, Naka (Japan) 1993, Princeton (USA) 1995, Kloster Seeon (Germany) 1997, Oxford (UK) 1999, Toki (Japan) 2001, San Diego (USA) 2003, and St Petersburg (Russia) 2005. The purpose of the eleventh meeting was to present and discuss new results on H-mode (edge transport barrier, ETB) and internal transport barrier, ITB, experiments, theory and modeling in magnetic fusion research. It was expected that contributions give new and improved insights into the physics mechanisms behind high confinement modes of H-mode and ITBs. Ultimately, this research should lead to improved projections for ITER. As has been the tradition at the recent meetings of this series, the program was subdivided into six topics. The topics selected for the eleventh meeting were: H-mode transition and the pedestal-width Dynamics in ETB: ELM threshold, non-linear evolution and suppression, etc Transport relations of various quantities including turbulence in plasmas with ITB: rotation physics is especially highlighted Transport barriers in non-axisymmetric magnetic fields Theory and simulation on transport barriers Projections of transport barrier physics to ITER For each topic there was an invited talk presenting an overview of the topic, based on contributions to the meeting and on recently published external results. The six invited talks were: A Leonard (GA, USA): Progress in characterization of the H-mode pedestal and L-H transition N Oyama (JAEA, Japan): Progress and issues in

  9. A 75 ps rms time resolution BiCMOS time to digital converter optimized for high rate imaging detectors

    CERN Document Server

    Hervé, C

    2002-01-01

    This paper presents an integrated time to digital converter (TDC) with a bin size adjustable in the range of 125 to 175 ps and a differential nonlinearity of +-0.3%. The TDC has four channels. Its architecture has been optimized for the readout of imaging detectors in use at Synchrotron Radiation facilities. In particular, a built-in logic flags piled-up events. Multi-hit patterns are also supported for other applications. Time measurements are extracted off chip at the maximum throughput of 40 MHz. The dynamic range is 14 bits. It has been fabricated in 0.8 mu m BiCMOS technology. Time critical inputs are PECL compatible whereas other signals are CMOS compatible. A second application specific integrated circuit (ASIC) has been developed which translates NIM electrical levels to PECL ones. Both circuits are used to assemble board level TDCs complying with industry standards like VME, NIM and PCI.

  10. Quench tests of Nb3Al small racetrack magnets

    International Nuclear Information System (INIS)

    Yamada, R.; Kikuchi, A.; Tartaglia, Michael Albert; Ambrosio, G.; Andreev, N.; Barzi, E.; Carcagno, R.; Feher, S.; Kashikhin, V.V.; Kotelnikov, S.; Lamm, Michael J.; Fermilab; NIMC, Tsukuba; KEK, Tsukuba

    2007-01-01

    Two Cu stabilized Nb3Al strands, F1 (Nb matrixed) and F3 (Ta matrixed), have been made at NIMS and their Rutherford cables were made at Fermilab in collaboration with NIMS. A Small Race-track magnet using F1 Rutherford cable, the first Nb3Al dipole magnet in the world, was constructed and tested to full current at Fermilab. This magnet was tested extensively to full short sample data and its quench characteristics were studied and reported. The 3-D magnetic field calculation was done with ANSYS to find the peak field. The quench characteristics of the magnet are explained with the characteristics of the Nb3Al strand and Rutherford cable. The other Small Race-track magnet using Ta matrixed F3 strand was constructed and will be tested in the near future. The advantages and disadvantages of these Nb3Al cables are discussed

  11. Quench tests of Nb3Al small racetrack magnets

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, R.; Kikuchi, A.; Tartaglia, Michael Albert; Ambrosio, G.; Andreev, N.; Barzi, E.; Carcagno, R.; Feher, S.; Kashikhin, V.V.; Kotelnikov, S.; Lamm, Michael J.; /Fermilab /NIMC, Tsukuba /KEK, Tsukuba

    2007-08-01

    Two Cu stabilized Nb3Al strands, F1 (Nb matrixed) and F3 (Ta matrixed), have been made at NIMS and their Rutherford cables were made at Fermilab in collaboration with NIMS. A Small Race-track magnet using F1 Rutherford cable, the first Nb3Al dipole magnet in the world, was constructed and tested to full current at Fermilab. This magnet was tested extensively to full short sample data and its quench characteristics were studied and reported. The 3-D magnetic field calculation was done with ANSYS to find the peak field. The quench characteristics of the magnet are explained with the characteristics of the Nb3Al strand and Rutherford cable. The other Small Race-track magnet using Ta matrixed F3 strand was constructed and will be tested in the near future. The advantages and disadvantages of these Nb3Al cables are discussed.

  12. Annual changes in abundance of non-indigenous marine benthos on a very large spatial scale

    DEFF Research Database (Denmark)

    Thomsen, Mads S.; Wernberg, Thomas; Stæhr, Peter Anton

    2008-01-01

    to quantify annual nation-wide changes in abundance of non-indigenous soft-bottom invertebrates (from grab samples) and hard-bottom macroalgae (from diver based percent cover values) in Denmark. Based on criteria of being either abundant (constituting >1% of the entire Danish assemblages) or increasing...... in abundance, NIMS of particular interest were found to be Mya arenaria and Bonemaissonia hamifera (abundant), Crepidula fornicata, Ensis americanus, Neanthes succinea (a cryptogenic species), Marenzelleria spp. (increasing), and Sargassum muticum (abundant and increasing). In addition, new and/or warm......-water eurohaline NIMS such as Gracilaria vermiculophylla and Crassostrea gigas, should be given attention as these species are expected to increase in the future. Finally, species not included in existing monitoring programs (hard-bottom estuarine invertebrates, fish, parasites, highly mobile species) should also...

  13. Present and future status of distributed database for nuclear materials (Data-Free-Way)

    International Nuclear Information System (INIS)

    Fujita, Mitsutane; Xu, Yibin; Kaji, Yoshiyuki; Tsukada, Takashi

    2004-01-01

    Data-Free-Way (DFW) is a distributed database for nuclear materials. DFW has been developed by three organizations such as National Institute for Materials Science (NIMS), Japan Atomic Energy Research Institute (JAERI) and Japan Nuclear Cycle Development Institute (JNC) since 1990. Each organization constructs each materials database in the strongest field and the member of three organizations can use these databases by internet. Construction of DFW, stored data, outline of knowledge data system, data manufacturing of knowledge note, activities of three organizations are described. On NIMS, nuclear reaction database for materials are explained. On JAERI, data analysis using IASCC data in JMPD is contained. Main database of JNC is experimental database of coexistence of engineering ceramics in liquid sodium at high temperature' and 'Tensile test database of irradiated 304 stainless steel' and 'Technical information database'. (S.Y.)

  14. Instrumentation for Nuclear Applications

    International Nuclear Information System (INIS)

    1998-01-01

    The objective of this project was to develop and coordinate nuclear instrumentation standards with resulting economies for the nuclear and radiation fields. There was particular emphasis on coordination and management of the Nuclear Instrument Module (NIM) System, U.S. activity involving the CAMAC international standard dataway system, the FASTBUS modular high-speed data acquisition and control system and processing and management of national nuclear instrumentation and detector standards, as well as a modest amount of assistance and consultation services to the Pollutant Characterization and Safety Research Division of the Office of Health and Environmental Research. The principal accomplishments were the development and maintenance of the NIM instrumentation system that is the predominant instrumentation system in the nuclear and radiation fields worldwide, the CAMAC digital interface system in coordination with the ESONE Committee of European Laboratories, the FASTBUS high-speed system and numerous national and international nuclear instrumentation standards

  15. Nanoscale Ionic Materials

    KAUST Repository

    Rodriguez, Robert; Herrera, Rafael; Archer, Lynden A.; Giannelis, Emmanuel P.

    2008-01-01

    Polymer nanocomposites (nanoparticles dispersed in a polymer matrix) have been the subject of intense research for almost two decades in both academic and industrial settings. This interest has been fueled by the ability of nanocomposites to not only improve the performance of polymers, but also by their ability to introduce new properties. Yet, there are still challenges that polymer nanocomposites must overcome to reach their full potential. In this Research News article we discuss a new class of hybrids termed nanoparticle ionic materials (NIMS). NIMS are organic-inorganic hybrid materials comprising a nanoparticle core functionalized with a covalently tethered ionic corona. They are facilely engineered to display flow properties that span the range from glassy solids to free flowing liquids. These new systems have unique properties that can overcome some of the challenges facing nanocomosite materials. © 2008 WILEY-VCH Verlag GmbH & Co. KGaA.

  16. PENGARUH MANAJEMEN ASET, MANAJEMEN LIABILITI, MANAJEMEN ASET LIABILITI TERHADAP ECONOMIC VALUE ADDED (EVA PADA PERBANKAN KONVENSIONAL YANG TERDAFTAR DI BURSA EFEK INDONESIA

    Directory of Open Access Journals (Sweden)

    H Hamidah

    2013-08-01

    Full Text Available Generally, company wants to optimize its profit. Properly manage the asset management, liability management and asset liability management can provide value added profits for the company. A sample of research consists of 18 banking companies listed at Indonesia Stock Exchange (IDX during the 2005-2009. This research investigate the relationship net loans/total earning assets (NLA, non performing loan (NPL, liabilities/total assets (LA, equity/total assets (EA, net interest margin (NIM, loan to deposite ratio (LDR on economic value added (EVA. The research use regression of panel data. The result show that net loans/total earning assets (NLA, liabilities/total assets (LA, equity/total assets (EA, net interest margin (NIM, loan to deposite ratio (LDR are have significant effect on economic value added (EVA but non performing loan (NPL.

  17. A histogram memory plug-in board for IBM-PC based nuclear pulse height analysis applications

    International Nuclear Information System (INIS)

    Behere, Anita; Ghodgaonkar, M.D.

    1989-01-01

    The histogram memory PC plug-in board has 8K x 24 dual ported memory with access from PC as well as from on board data acquisition logic. The arbitration control logic monitors the memory access requests from both the sources and honours them on first come first served basis. The data acquisition logic takes only 840 ns. to perform Read-Modify-Write memory operation. The data acquisition logic incorporates ADC interface logic for connecting to a NIM ADC which is normally housed in a NIM system along with other required front-end processing modules. Two interval timers are provided on the board. One of them provides Live Time/Clock Time counting and the other generates a 200 ms interrupt which is used for live spectrum display. The board is fully supported with system and data processing software developed in Turbo Pascal. (author)

  18. A high resolution portable spectroscopy system

    International Nuclear Information System (INIS)

    Kulkarni, C.P.; Vaidya, P.P.; Paulson, M.; Bhatnagar, P.V.; Pande, S.S.; Padmini, S.

    2003-01-01

    Full text: This paper describes the system details of a High Resolution Portable Spectroscopy System (HRPSS) developed at Electronics Division, BARC. The system can be used for laboratory class, high-resolution nuclear spectroscopy applications. The HRPSS consists of a specially designed compact NIM bin, with built-in power supplies, accommodating a low power, high resolution MCA, and on-board embedded computer for spectrum building and communication. A NIM based spectroscopy amplifier and a HV module for detector bias are integrated (plug-in) in the bin. The system communicates with a host PC via a serial link. Along-with a laptop PC, and a portable HP-Ge detector, the HRPSS offers a laboratory class performance for portable applications

  19. Nuclear timer/counter

    International Nuclear Information System (INIS)

    Wuthayavanich, S.

    1978-01-01

    This thesis represents the development of a Timer/COUNTER compatible to the standard Nuclear Instrument Module Specifications. The unit exhibits high accuracy, light weight and ease of maintenance. The unit also has a built-in precision discriminator to discriminate unwanted signals that may cause interference in counting. With line frequency time base the timer can be preset in steps from 0.1 sec. to 9 x 10 5 min. The counter with six digits miniature display and an overflow output has a maximum counting rate of 10 MHz. The accumulated counting data can be transferred to a teletype or printer for hard copy printout with the aid of ORTEC 777 Line Printer or 432 A Print-out Control or any print out interface with input compatible to the print output of the Timer/Counter. Owing to its NIM compatibility the unit is directly powered by the NIM power supply

  20. PENGARUH KARAKTERISTIK DEWAN DIREKSI TERHADAP PENGUKURAN KINERJA BANK DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Susy Muchtar

    2009-09-01

    Full Text Available The purpose of this research is to analyse the effect of Characteristics of The Board of towar Directors s Bank Performance. This research was used are 19 banking firm which listed in Indonesian Stock Exchange during 2005-2008. Independent variables from this research are board size and Outside Director. Dependent variables are bank performance which include Net Interest Margin (NIM, Return On Asset (ROA, Return On Equity(ROE and Efficiency Ratio. Control Variables are Size, Risk and Capital Ratio. The analysis method was used are multiple regression analysis. The result from this research shows that Board Size did not has related to bank performance. Outsiders has related to bank performance. Keywords: Board Size, Outside Director, Net Interest Margin (NIM, Return On Asset (ROA, Return On Equity(ROE and Efficiency Ratio

  1. High rate read-out of LaBr(Ce) scintillator with a fast digitizer

    International Nuclear Information System (INIS)

    Stevanato, L.; Cester, D.; Nebbia, G.; Viesti, G.; Neri, F.; Petrucci, S.; Selmi, S.; Tintori, C

    2012-01-01

    The energy resolution of a LaBr(Ce) detector has been studied as a function of the count rate up to 340 kHz by using a 12 bit 250 MS/s V1720 digitizer. The time resolution achieved by processing off line the digitized signals has been also determined. It appears that the energy resolution obtained with the digitizer is better than that achievable using standard NIM electronics. The time resolution yielded by the digitizer with a software CFTD is about δt=0.8 ns (FWHM), slightly worse with respect to δt=0.65 ns (FWHM) obtained from standard NIM. However, this time resolution lies well within the requirements for applications in Non-Destructive Analysis of large objects with tagged neutron beams.

  2. Digital instrumentation and management of dead time: first results on a NaI well-type detector setup.

    Science.gov (United States)

    Censier, B; Bobin, C; Bouchard, J; Aubineau-Lanièce, I

    2010-01-01

    The LNE-LNHB is engaged in a development program on digital instrumentation, the first step being the instrumentation of a NaI well-type detector set-up. The prototype acquisition card and its technical specifications are presented together with the first comparison with the classical NIM-based acquisition chain, for counting rates up to 100 kcps. The digital instrumentation is shown to be counting-loss free in this range. This validates the main option adopted in this project, namely the implementation of an extending dead time with live-time measurement already successfully used in the MTR2 NIM module developed at LNE-LNHB. Copyright 2010. Published by Elsevier Ltd.

  3. PDAC-100 operations manual

    International Nuclear Information System (INIS)

    Slice, R.

    1985-05-01

    The Programmable Data Acquisition and Control (PDAC-100) system was designed to provide data acquisition and control functions for dedicated in-plant nuclear safeguards systems. The PDAC-100, along with a detector, peripherals, and input/output devices, functions as a programmable multichannel analyzer, controls devices, acquires data, analyzes the results, and displays computed values. The PDAC-100 is packaged as a six-wide nuclear instrumentation module (NIM). The NIM standard allows the flexibility to use the optimum signal conditioning, analog-to-digital conversion, and stabilization electronics required for the specific application. The PDAC-100 uses a Motorola MC6802 microprocessor that executes a program stored in read-only memory. The program can be written in Motorola 6800 assembly, FORTRAN IV, or BASIC language. As an analyzer, the PDAC-100 uses an external analog-to-digital converter and an XYZ oscilloscope to acquire and display spectra of 1024 channels

  4. Experience of monitoring the recurrent laryngeal nerve in thyroid surgery with endotracheal intubation

    Directory of Open Access Journals (Sweden)

    Liang Feng

    2017-01-01

    Full Text Available Purpose:To analysis clinical experience of applying recurrent laryngeal monitoring endotracheal tube (NIM EMG Endotracheal Tube in the surgery of thyroid. Method: A retrospective analysis of 84 patients who underwent endotracheal intubation laryngeal nerve monitoring by thyroid surgery in the Chinese-Japanese Friendship Hospital of Jilin University from March to December in 2015. To summarize the experience of intubation with NIM EMG Endotracheal Tube. Result 77 (91.7%had initial intubation achievement in the 84 patients.FROM the 77 cases we had gotten s atisfactory nerve monitoring signal.Whereas there are 7 cases (8.3% appear abnormal EMG or signal missing, in the 7 cases there is one which being intubated too deep, 3 cases which being intubated too shallow and 3 cases with malrotation intubation.Conclusion: We got the satisfactory signals after adjust1ing the tube by using the visual laryngoscope.

  5. Nanoscale Ionic Materials

    KAUST Repository

    Rodriguez, Robert

    2008-11-18

    Polymer nanocomposites (nanoparticles dispersed in a polymer matrix) have been the subject of intense research for almost two decades in both academic and industrial settings. This interest has been fueled by the ability of nanocomposites to not only improve the performance of polymers, but also by their ability to introduce new properties. Yet, there are still challenges that polymer nanocomposites must overcome to reach their full potential. In this Research News article we discuss a new class of hybrids termed nanoparticle ionic materials (NIMS). NIMS are organic-inorganic hybrid materials comprising a nanoparticle core functionalized with a covalently tethered ionic corona. They are facilely engineered to display flow properties that span the range from glassy solids to free flowing liquids. These new systems have unique properties that can overcome some of the challenges facing nanocomosite materials. © 2008 WILEY-VCH Verlag GmbH & Co. KGaA.

  6. Creating double negative index materials using the Babinet principle with one metasurface

    Science.gov (United States)

    Zhang, Lei; Koschny, Thomas; Soukoulis, C. M.

    2013-01-01

    Metamaterials are patterned metallic structures which permit access to a novel electromagnetic response, negative index of refraction, impossible to achieve with naturally occurring materials. Using the Babinet principle, the complementary split ring resonator (SRR) is etched in a metallic plate to provide negative ɛ, with perpendicular direction. Here we propose a new design, etched in a metallic plate to provide negative magnetic permeability μ, with perpendicular direction. The combined electromagnetic response of this planar metamaterial, where the negative μ comes from the aperture and the negative ɛ from the remainder of the continuous metallic plate, allows achievement of a double negative index metamaterial (NIM) with only one metasurface and strong transmission. These designs can be used to fabricate NIMs at microwave and optical wavelengths and three-dimensional metamaterials.

  7. 34. MPA seminar 2008. Proceedings; 34. MPA Seminar 2008. Vortraege

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-12-17

    The proceedings include two introductory lectures: The renaissance of nuclear power - causes and challenges; on the way to the coal fired power plant with 50% efficiency. The other contributions concern the following topics: MPA-IfW-NIMS-Workshop: microstructural evolution (7 contributions), advanced materials (6 contributions), material and damage behaviour (6 contributions), integrity of nuclear plants and components (13 contributions), monitoring and inspection (6 contributions), creep and lifetime analysis (4 contributions), applications to HT components (4 contributions), fracture mechanics (7 components).

  8. Representasi Persahabatan dalam Film 5 Cm

    OpenAIRE

    Handayani, Intan Murni; Lukmantoro, Triyono; Naryoso, Agus

    2013-01-01

    Representasi Persahabatan dalam Film 5 cmSkripsiDisusun untuk memenuhi persyaratan menyelesaikanPendidikan Strata-1Jurusan IlmumKomunikasi Fakultas Ilmu Sosial dan Ilmu PolitikUniversitas DiponegoroPenyusunNama: Intan Murni HandayaniNIM: D2C 009 034JURUSAN ILMU KOMUNIKASIFAKULTAS ILMU SOSIAL DAN ILMU POLITIKUNIVERSITAS DIPONEGOROSEMARANG2013ABSTRAKSIFilm merupakan salah satu media massa yang menjadi wadah bagi parapembuat film untuk menyampaikan pesan serta nilai-nilai yang dimiliki olehpara ...

  9. Pengaruh Terpaan Komunikasi Pemasaran Menu Breakfast Mcdonald"s Keputusan Pembelian

    OpenAIRE

    Tasuki, Martia Mutiara; Pradekso, Tandiyo; Ulfa, Nurist Surayya

    2013-01-01

    PENGARUH TERPAAN KOMUNIKASI PEMASARAN MENU BREAKFAST MCDONALD'S DAN CITRA PRODUK TERHADAP KEPUTUSAN PEMBELIANSkripsiDisusun untuk memenuhi persyaratan menyelesaikanPendidikan Strata IJurusan Ilmu Komunikasi Fakultas Ilmu Sosial dan Ilmu PolitikUniversitas DiponegoroPenyusunNama : Martia Mutiara TasukiNIM : D2C 005 183JURUSAN ILMU KOMUNIKASIFAKULTAS ILMU SOSIAL DAN ILMU POLITIKUNIVERSITAS DIPONEGOROSEMARANG2013PENGARUH TERPAAN KOMUNIKASI PEMASARAN MENU BREAKFAST MCDONALD'S DAN CITRA PRODUK TER...

  10. CAMAC - A modular instrumentation system for data handling. Revised description and specification

    International Nuclear Information System (INIS)

    1977-03-01

    CAMAC is a modern data handling system in widespread use with on-line digital computers. It is based on a digital highway for data and control. The CAMAC specifications ensures compatibility between equipment from different sources. The revised specification introduces several new features, but is consistent with the previous version (EUR 4100e, 1969). The CAMAC system was specified by European laboratories, through the Esone Committee, and has been endorsed by the USAEC NIM Committee, who have an identical specification (TID-25875)

  11. Upping The Emergency Management Ante: The Role Of Private Sector Collaboration In Emergency Management And Whether State Procurement And Emergency Management Laws Are Built To Collaborate

    Science.gov (United States)

    2016-03-01

    would be better served by a managerial structure overseen by a private entity.46 Busch and Givens also point out the potential legal concerns that...NIMS espouses a “continuous cycle of planning, organizing, training, equipping, exercising, evaluating, and taking corrective action” and stresses ...context, though. His analysis was conducted in connection with the post-Katrina out-of- control spending by multinational corporations that did not have

  12. Klaasikunstisügis Baltikumis / Eve Koha

    Index Scriptorium Estoniae

    Koha, Eve

    2002-01-01

    11. X-15. XI Kaunase raekojas M. K. Ciurlionise nim. rahvusliku kunsti muuseumi keraamika muuseumis rahvusvahelisel klaasikunsti biennaalil "Vitrum Balticum II" osalevad Eestist Eve Koha, Ivo Lill, Mare Saare. Albinas Elskusest, Mark Eckstrandist. 20. X-20. XI Riia vanalinna klaasigaleriis Laipu t. 6 eesti ja läti klaasikunstnike ühisnäitusel, kus tutvustatakse vanu klaasitehnikaid ja vanade klaasiahjude ehitust, osalevad Eestist Kati Kerstna, Merle Hiis

  13. In vivo click reaction between Tc-99m-labeled azadibenzocyclooctyne-MAMA and 2-nitroimidazole-azide for tumor hypoxia targeting.

    Science.gov (United States)

    Sun, Wenjing; Chu, Taiwei

    2015-10-15

    The bioactivity of nitroimidazole in Tc-99m-labeled 2-nitroimidazole, a traditional solid tumor hypoxia-imaging agent for single photon emission computed tomography (SPECT), is reduced by the presence of large ligand and metallic radionuclide, exhibiting lower tumor-to-nontumor ratios. In an effort to solve this general problem, a pretargeting strategy based on click chemistry (strain-promoted cyclooctyne-azide cycloaddition) was applied. The functional click synthons were synthesized as pretargeting components: an azide group linked to 2-nitroimidazole (2NIM-Az) serves for tumor hypoxia-targeting and azadibenzocyclooctyne conjugated with monoamine monoamide dithiol ligand (AM) functions as radiolabeling and binding group to azides in vivo. 2NIM-triazole-MAMA was obtained from in vitro click reaction with a reaction rate constant of 0.98M(-1)s(-1). AM and 2NIM-triazole-MAMA were radiolabeled with Tc-99m. The hypoxia-pretargeting biodistribution was studied in Kunming mice bearing S180 tumor; (99m)Tc-AM and (99m)Tc-triazole-2NIM were used as blank control and conventional control. Compared to the control groups, the pretargeting experiment exhibits the best radio-uptake and retention in tumor, with higher tumor-to-muscle and tumor-to-blood ratios (up to 8.55 and 1.44 at 8h post-(99m)Tc-complex-injection, respectively). To some extent, the pretargeting strategy protects the bioactivity of nitroimidazole and therefore provides an innovative approach for the development of tumor hypoxia-SPECT imaging agents. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Reflections of a TMS International Scholar: Sharing Research across Cultures and Continents

    Energy Technology Data Exchange (ETDEWEB)

    Unocic, Kinga A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-19

    Here, I was honored to be selected as the 2017 Japan Institute of Metals (JIM)/TMS Young Leaders International Scholar, an opportunity made possible by the TMS Foundation. One of the benefits of receiving this award for me was traveling to Japan to visit the National Institute for Materials Science (NIMS), and attending the 2017 JIM Annual Spring Meeting, held at the Tokyo Metropolitan University.

  15. Characterisation of a multidrug-resistant Bacteroides fragilis isolate recovered from blood of a patient in Denmark using whole-genome sequencing

    DEFF Research Database (Denmark)

    Ank, Nina; Sydenham, Thomas V; Iversen, Lene H

    2015-01-01

    Here we describe a patient undergoing extensive abdominal surgery and hyperthermic intraperitoneal chemotherapy due to primary adenocarcinoma in the sigmoid colon with peritoneal carcinomatosis. During hospitalisation the patient suffered from bacteraemia with a multidrug-resistant Bacteroides fr...... fragilis isolate. Whole-genome sequencing of the isolate resulted in identification of nimE, cfiA and ermF genes corresponding to metronidazole, carbapenem and clindamycin resistance....

  16. Making sense in the edge of chaos : a framework for effective initial response efforts to large-scale incidents

    OpenAIRE

    Renaud, Cynthia E.

    2010-01-01

    CHDS State/Local Approved for public release; distribution is unlimited A review of response efforts to 9/11 revealed considerable challenges to resolving an event of this magnitude. To cope with these challenges, the federal government created the National Incident Management System (NIMS), an organizational structure intended to manage resources and channel communication between disparate agencies working together to solve a catastrophic crisis. Yet, first responders who have bee...

  17. System programming languages

    OpenAIRE

    Šmit, Matej

    2016-01-01

    Most operating systems are written in the C programming language. Similar is with system software, for example, device drivers, compilers, debuggers, disk checkers, etc. Recently some new programming languages emerged, which are supposed to be suitable for system programming. In this thesis we present programming languages D, Go, Nim and Rust. We defined the criteria which are important for deciding whether programming language is suitable for system programming. We examine programming langua...

  18. Application of NMR circuit for superconducting magnet using signal averaging

    International Nuclear Information System (INIS)

    Yamada, R.; Ishimoto, H.; Shea, M.F.; Schmidt, E.E.; Borer, K.

    1977-01-01

    An NMR circuit was used to measure the absolute field values of Fermilab Energy Doubler magnets up to 44 kG. A signal averaging method to improve the S/N ratio was implemented by means of a Tektronix Digital Processing Oscilloscope, followed by the development of an inexpensive microprocessor based system contained in a NIM module. Some of the data obtained from measuring two superconducting dipole magnets are presented

  19. Improving the Current DHS Capabilities Framework

    Science.gov (United States)

    2008-09-01

    Laboratories ( PNL ) to establish the standards for the NIMS initiative. This entire situation creates another set of inconsistencies in criteria for...www.hsaj.org/?fullarticle=1.2.2, (accessed June 12, 2007), 8. 24 setting agencies: NFPA, PNL , American National Standards Institute (ANSI), and...with Pacific Northwest Laboratory ( PNL ) to develop the NIC standards. The Incident Management Standards Working Group (IMSWG) was established

  20. In der Suche nach eigenem Sprachstandards

    Directory of Open Access Journals (Sweden)

    Lada Badurina

    1992-01-01

    Full Text Available Im Artikl wird dreifache Lösungsmöglichkeit des burgenländrich-kroatischen Sprachkomplexes vor-gesehen: Stützung auf den deutschen schriftsprachlichen Ausdruck, Übernahme des südlichen kroatischen Standards oder Aufbau eigener Sprachnorm. Neulich veröffentlichtes Werk Gradis6anskohrvatski-hrvatsko-nim§ki rjeönik zeugt über die Anbahnung der schwierigten aber zugleich annehmbarsten Lösung: Standardisierung der eigenen Sprache.

  1. Study of prevalence of bacterial vaginosis in preterm and term labour

    OpenAIRE

    Deepa Masand; Deepshikha Melkani

    2016-01-01

    Background: The objective of the study was to study the prevalence of bacterial vaginosis in women with preterm and term labour and to analyze the causal relationship of bacterial vaginosis with preterm labour. Methods: An observational study conducted on 100 patients reporting at labour room in Obstetrics and Gynaecology department of NIMS Medical College and hospital, between November 2013 to June 2014 involving 50 patients with preterm and 50 with term labour. Results: Pat...

  2. "Неужто этот ловелас так сильно действует на вас..." / Марианна Тарасенко

    Index Scriptorium Estoniae

    Тарасенко, Марианна

    2008-01-01

    Linnamäe Vene Lütseumis Tallinnas toimus konverents teemal "Tsarskoje Selo lütseum ja tänapäevased õpetamis- ja kasvatusmeetodid", millest võtsid osa Ülevenemaalise A. Puškini nim. Muuseumi töötajad Peterburist. Nad tõid kaasa näituse "A. S. Puškini elu ja looming 20. saj. kunstnike loomingus"

  3. Fast ADC interface with data reduction facilities for multi-parameter experiments in nuclear physics

    Energy Technology Data Exchange (ETDEWEB)

    Liebl, W; Franz, N; Ziegler, G [Technische Univ. Muenchen, Garching (Germany, F.R.). Fakultaet Physik; Hegewisch, S; Kunz, D; Maier, D; Lutter, R; Schoeffel, K; Stanzel, B [Muenchen Univ. (Germany, F.R.). Sektion Physik; Drescher, B [Hahn-Meitner-Institut fuer Kernforschung Berlin G.m.b.H. (Germany, F.R.)

    1982-03-01

    A modular ADC interface system for multi-parameter experiments with single NIM ADCs is described. 16 fast ADCs are handled by CAMAC modules and data buses in order to build up a sophisticated hardware system which is able to take coincidence data and singles spectra in parallel. The coincidence logic is handled by one of the interface modules; the interface allows online data reduction. The further expansion of the system will be discussed.

  4. Seven channel gated charge to time converter

    Energy Technology Data Exchange (ETDEWEB)

    Stubbs, R J; Waddoup, W D [Durham Univ. (UK)

    1977-11-01

    By using a hybrid integrated circuit seven independent gated charge to time converters have been constructed in a single width NIM module. Gate widths from < approximately 10 ns to approximately 300 ns are possible with a resolution of 0.25 pC, linearity is better than +-1 pC over 2.5 decades of input signal height. Together with a multichannel scaling system described in the following paper one has a very powerful multichannel gated ADC system.

  5. Som Energia: sostenibilitat energètica i cooperativisme

    OpenAIRE

    Duran i Grant, Alexandre; Huijink, Gijsbert; Roselló, Marc

    2013-01-01

    La cooperativa Som Energia és una organització innovadora en el sector energètic a casa nostra. Proposa una forma de fer diferent de la de les empreses tradicionals del sector: ven energia renovable certificada, no té ànim de lucre i busca el bé comú. La proposta treballa per la sostenibilitat energètica.

  6. Uudised : RAMi lauljad Iisraelis. Lauluvõistlus Pärnus. Wagner, ka Eestis. Juuniküüditamise mälestuskontsert / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2001-01-01

    Osa RAMi lauljaist osaleb Tel Avivis Iisraeli Uue Ooperi etendustel, B.Britteni ooperi "Billy Budd" lavastuses. Pärnus 2.-6. mail toimunud II Klaudia Taevi nim. noorte lauljate konkursi tulemustest. 17. mail EMAs toimuvast teaduskonverentsist "Richard Wagner, ka Eestis", 18. mail toimuvast galakontserdist ja näituse "Wagner Eesti laval" avamisest Estonia kontserdisaalis. 15. mail Narvas ja 16. mail Rakveres toimuvast Mozarti "Reekviemi" ettekandest juuniküüditamise mälestuseks

  7. Optimizacija procesnih parametrov za stabilizacijo in izboljšanje sposobnosti struženja

    OpenAIRE

    Mlinar, Andrej

    2017-01-01

    Magistrska naloga obravnava proizvodni proces izdelka z ozkim tolerančnim območjem. V procesu izdelave se je pojavil problem nestabilnosti obdelovalnega procesa. Pred analizo obdelovalnega procesa smo najprej z metodo analize merilnega sistema preverili merilni proces. Po preverjanju ustreznosti merilnega procesa smo v nadaljevanju preverili obstoječi obdelovalni proces. Iz analize statistične kontrole procesa obstoječega stanja smo ugotovili, da je proces potrebno stabilizirati. Za stabiliza...

  8. Aktiivse tööturupoliitika meetmed / Reelika Leetmaa

    Index Scriptorium Estoniae

    Leetmaa, Reelika, 1975-

    2002-01-01

    Aktiivse tööturupoliitika (ATP) programm, selle rakendamine ja mõju erinevates riikides, s.h. Eestis. Tööotsingualane abi, tööturukoolitus, stardiabi ettevõtjaile, subsiidiumid erasektori tööandjatele ja teised ETP meetmed. Diagramm ja tabel: kulutused ATP-le ja ATP meetmetele OECD riikides ja Eestis. Lisa: ETP teoreetiline mõju ja olulised küsimused. Bibliogr. 12 nim. Kokkuvõte ingl.k.

  9. Treff piilus tudengite tööde kaudu tulevikku / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2009-01-01

    Nukuteatrifestivalist Tallinn Treff, kus näitasid oma töid Turu Kunstiakadeemia nukuteatri osakonna teise kursuse tudengid - Rene Bakeri lavastatud eepostel "Kalevala" ja "Kalevipoeg põhinev "Mieliteko" ning Federico Fellini filmist "Tee" inspireeritud "Tsirkus Gelsomina"- ja Ernst Buschi nim. Berliini Lavakunstikooli nukuteatritudengid - "Inspektor tuleb" J. B. Priestley draama järgi. Auhinna saajaks oli Von Krahli egiidi all valminud lavakunstikooli diplomilavastus "Kummitus masinas", lavastaja Mart Koldits

  10. A cyclic production problem: an application of max-algebra

    NARCIS (Netherlands)

    Nawijn, W.M.

    1998-01-01

    Given are m identical machines, each of which performs the same N operations Oi, 1 ≤ i ≤ N, cyclically and indefinitely, i.e. a production run on a machine looksO1, O2,…,ON, O1, O2,…,ON, O1…. There are nim to to perform operation Oi. The tools are transported between the machines by means of an

  11. Pengaruh Intensitas Mengakses Twitter Duta Im3 terhadap Kepuasan Pengalaman Adopsi dan Kepuasan Pengalaman Adopsi terhadap Keputusan Penggunaan Program Im3

    OpenAIRE

    Ayu Kinasih, Diyan Hafdinovianti; Pradekso, Tandiyo; Setiabudi, Djoko

    2014-01-01

    Nama : Diyan H Ayu KinasihNIM : D2C009029Judul : Pengaruh Intensitas Mengakses Twitter Duta IM3 terhadapKepuasan Pengalaman Adopsi dan Kepuasan PengalamanAdopsi terhadap Keputusan Penggunaan Program IM3ABSTRAKTwitter sebagai salah satu promotion tools yang digunakan oleh PTIndosat Tbk, diharapkan dapat memperkenalkan program-program serta eventyang dilakukan oleh Indosat. Melalui duta IM3 sebagai brand ambassador, Indosatmencoba meraih pasar anak muda dengan melakukan kegiatan promosi.Tipe pe...

  12. Improving the Effectiveness of Penicillin Allergy De-labeling.

    Science.gov (United States)

    Bourke, Jack; Pavlos, Rebecca; James, Ian; Phillips, Elizabeth

    2015-01-01

    Approximately 10-20% of hospitalized patients are labeled as penicillin allergic, and this is associated with significant health and economic costs. We looked at the effectiveness of penicillin allergy de-labeling in clinical practice with the aim of deriving risk stratification models to guide testing strategies. Consecutive patients aged 15 years or more, referred to a Western Australian public hospital drug allergy service between 2008 and 2013 for beta-lactam allergy, were included. Follow-up surveys were conducted. Results of skin prick testing and intradermal testing (SPT/IDT) and oral challenge (OC), and follow-up of post testing antibiotic usage were the main outcomes. SPT/IDT was performed in 401 consecutive patients with immediate (IMM) (≤ 1 hour) (n = 151) and nonimmediate (NIM) (>1 hour) (n = 250) reactions. Of 341 patients, 42 (12.3%) were SPT/IDT+ to ≥ 1 penicillin reagents, including 35/114 (30.4%) in the IMM group and 7/227 (3.1%) in the NIM group (P penicillin VK (SPT/IDT negative predictive value [NPV] 99.2%). Selective or unrestricted beta-lactam was recommended in almost 90% overall, including 238/250 (95.2%) in the NIM group and 126/151 (83.4%) in the IMM group (P = .0001). Of 182 patients, 137 (75.3%) were following the allergy label modifications (ALM) at the time of follow-up. Penicillin SPT/IDT/OC safely de-labels penicillin-allergic patients and identifies selective beta-lactam allergies; however, incomplete adherence to ALM recommendations impairs effectiveness. Infrequent SPT/IDT+ and absent OC reactions in patients with NIM reactions suggest OC alone to be a safe and cost-effective de-labeling strategy that could improve the coverage of penicillin allergy de-labeling in lower risk populations. Copyright © 2015 American Academy of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

  13. Experimental verification of the inverse Doppler effect in negative-index material

    Science.gov (United States)

    Feng, Lie; Chen, Jiabi; Wang, Yan; Geng, Tao; Zhuang, Songlin

    2010-10-01

    μResearch of negative-index material (NIM) is a very hot developing research field in recent years. NIM is also called left-handed material (LHM), in which the electric field [see manuscript], the magnetic field [see manuscript] and the wave vector [see manuscript] are not composed of a set of right-handed coordinates but a set of left-handed coordinates. Thus the action of electromagnetic waves in both left-handed material and right-handed material is just the opposite, for instance, the negative refraction phenomenon, the inverse Doppler effect and so on. Here we report the explicit result of the inverse Doppler effect through a photonic crystal (PC) prism at 10.6m wavelength for the first time, and the result we get from the experiment is much similar to the theoretical analysis we have deduced before. During the experiment, the CO2 laser is used as a light source, and the PC prism is used as a sample, which can move a tiny distance (1mm) uniformly with a translating stage. Based on the method of optical heterodyne, we let the emergent light from the output surface of PC prism and the reference light from light source interfere at the surface of the detector. When the translating stage moves towards the detector, the optical paths in the PC prism will be changed, and then the Doppler frequency shift will be generated. Though several different samples have been tested repeatedly, the results we get are extraordinarily similar. So we can be sure that the inverse Doppler effect really exists in the NIM at optical frequencies. To our best knowledge, this is the only experimental verification of the inverse Doppler effect in the NIM at optical frequencies at home and aboard.

  14. Vernier Delay Unit

    International Nuclear Information System (INIS)

    Pierce, W.B.

    1984-10-01

    This module will accept differential ECL pulses from the auxiliary rear panel or NIM level pulses from the front panel. The pulses are produced at the output with a fixed delay that is software programmable in steps of 0.1 ns over the range of 0.1 to 10.5 ns. Multiple outputs are available at the front panel. Minimum delay through the module is 9 ns

  15. A fast ADC interface with data reduction facilities for multi-parameter experiments in nuclear physics

    International Nuclear Information System (INIS)

    Liebl, W.; Franz, N.; Ziegler, G.

    1982-01-01

    A modular ADC interface system for multi-parameter experiments with single NIM ADCs is described. 16 fast ADCs are handled by CAMAC modules and data buses in order to build up a sophisticated hardware system which is able to take coincidence data and singles spectra in parallel. The coincidence logic is handled by one of the interface modules; the interface allows online data reduction. The further expansion of the system will be discussed. (orig.)

  16. Socijalni kapital i prostor

    OpenAIRE

    Ignjatović, Suzana; tomanović, Smiljka

    2012-01-01

    Rad razmatra prostorne aspekte socijalnog kapitala. U prvom delu rada razmatramo kako se prostor shvata u ključnim teorijama socijalnog kapitala. Uključene su tri grupe teorija o socijalnom kapitalu: ključni autori (Bourdieu, Coleman, Putnam), ekonomske/razvojne teorije i mrežne teorije. Analiza pokazuje da autori u različitoj meri shvataju prostor u zavisnosti od svojih teorijskih pristupa socijalnom kapitalu. Drugi deo rada je produbljena komparativna analiza dinamike socijalnog kapitala u ...

  17. Gamma spectrometric system based on the personal computer Pravetz-83

    International Nuclear Information System (INIS)

    Yanakiev, K; Grigorov, T.; Vuchkov, M.

    1985-01-01

    A gamma spectrometric system based on a personal microcomputer Pravets-85 is described. The analog modules are NIM standard. ADC data are stored in the memory of the computer via a DMA channel and a real-time data processing is possible. The results from a series of tests indicate that the performance of the system is comparable with that of comercially avalable computerized spectrometers Ortec and Canberra

  18. Brand Activation Batik Semarangan melalui Event “Cah Semarang Duwe Batik”

    OpenAIRE

    Saputra, Ginanjar; Setiabudi, Djoko; Ulfa, Nurist Surayya

    2013-01-01

    Nama : Ginanjar SaputraNIM : D2C008088Judul : Brand Activation Batik Semarangan melalui Event “Cah Semarang Duwe Batik” Abstrak Koperasi Sekar Arum sebagai sebuah lembaga koperasi dibawah naungan TP – PKK Kota Semarang yang salah satunya fokus terhadap batik semarangan, tentu harus dapat melestarikan dan mengembangkan produk batik semarangan sehingga dapat menjadi produk andalan dari Kota Semarang. Akan tetapi terjadi permasalahan dimana produk batik semarangan ini belum banyak dikenal oleh w...

  19. Compound list: nimesulide [Open TG-GATEs

    Lifescience Database Archive (English)

    Full Text Available nimesulide NIM 00136 ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Human/i...n_vitro/nimesulide.Human.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vi...tro/nimesulide.Rat.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vivo/Liv...er/Single/nimesulide.Rat.in_vivo.Liver.Single.zip ftp://ftp.biosciencedbc.jp/arch

  20. Description of the MHS Health Level 7 Radiology for Public Health Surveillance

    Science.gov (United States)

    2014-03-01

    0704-0188 r Lbhe: r;.. ) ort n:) bur:l ?n fcr ths co:IV..ct\\or of i1lom:tioo is e~t n:~I:M tv £1\\’?ft:)? 1 t"vJrr.err~>~f. )’" ISo ? , irck.K’ r:, tho...records, and outpatient/inpatient pharmacy transactions. Consequently, surveillance methods are largely disease-specific, but this specificity depends

  1. Description of the MHS Health Level 7 Microbiology Laboratory for Public Health Surveillance

    Science.gov (United States)

    2012-10-01

    co:IV..ct\\or of i1lom:tioo is e~t n:~I:M tv £1\\’?ft:)? 1 t"vJrr.err~>~f. )’" ISo ? , irck.K’ r:, tho? tir? for r.,.,\\1"’~’· 1:) instr J-:1 :11s, so?er...activities at the request of the DODGEIS. The HL7 data source includes records from anatomic pathology, chemistry, microbiology, pharmacy , and radiology

  2. Pärnut ootab kirev kultuuriaasta / Karin Klaus

    Index Scriptorium Estoniae

    Klaus, Karin

    2007-01-01

    Pärnu linnavalitsuse kultuuriosakonna juhataja Jana Moosari sõnul 2007. aasta kultuuriürituste toetuste saajate hulgas on: MTÜ David Oistrahhi festival, MTÜ Pärnu Kontserdibüroo, muusikafestival "Muusikamoos", MTÜ XXI Sajandi Orkester (Klaudia Taevi nim. ooperilauljate konkursi korraldamine), MTÜ Suupilliklubi Piccolo, Pärnu kontserdimaja, MTÜ Arnold Scönbergi Ühing, MTÜ Jazzkaare Sõprade Ühing

  3. Interpretasi Khalayak dalam Rubrik Goresan Hati pada Majalah Sekar

    OpenAIRE

    Wahyu Pertiwi, Astuti Dwi; Nugroho, AdI; Lukmantoro, Triyono

    2013-01-01

    Nama : Astuti Dwi Wahyu PertiwiNIM : D2C009126Judul : Interpretasi Khalayak dalam Rubrik Goresan Hati padaMajalah SekarABSTRAKPerempuan senantiasa dijadikan objek yang tepat dalam setiap bidikan panahmedia massa, khususnya di Indonesia. Berbagai masalah pribadi perempuan yangterungkap di media massa menjadikan posisi perempuan semakin termarjinalkan.Salah satu media massa yang melanggengkan praktik publikasi masalah pribadiyang dilakukan para perempuan adalah Majalah Sekar dengan nama rubrikn...

  4. Antidotal Efficacy of a New Combination in Treatment of Subacute T-2 Toxin Poisoning in Rats

    International Nuclear Information System (INIS)

    Jacevic, V. M.; Bocarov-Stancic, A. S.; Resanovic, R. D.; Djordjevic, S. B.; Bokonjic, D. R.

    2007-01-01

    Trichothecene mycotoxin, T-2 toxin is a natural metabolite of Fusarium fungi. T-2 toxin possesses several properties (significant persistence in the environment, cheap manufacture, difficult detection and absence of a specific antidote) that make it a very dangerous potential chemical warfare agent. In our previous experiments, nonsteroidal anti-inflammatory drug (NSAID) nimesulide (NIM), as a selective COX-2 inhibitor, and zeolite absorbent (Min-a-zel Plus, MINplus) administered separately showed a good protective effects against general toxicity induced by T-2 toxin (T2). The aim of this study was to evaluate the antidotal potential of the combination of these two antidotes. T2 was given in a dose of 0.15 mg/kg sc (0.1 LD50), 5 times per week, 4 weeks to adult Wistar rats. Protected animals were given NIM (20 mg/kg im) or/and MINplus (40 mg/kg po) each time immediately after T2. Mortality, general condition, body weight gain, food and water consumption and gut alterations of the animals were registered on a daily basis during 4 weeks. Treatment with NIM or/and MINplus significantly reduced mortality of the rats treated only with T2. Body weight gain, food and water consumption were significantly decreased in T2-treated animals compared to control ones (p < 0.001), what was not the case in the protected rats. In the groups treated with NIM and MINplus gut alterations were significantly less severe than those observed in animals receiving T2 alone (p less than 0.001). These results imply that combined treatment with nimesulide and zeolite absorbent affords a significant protection against subacute T-2 toxin poisoning in rats.(author)

  5. Resepsi Pemirsa Tentang Diskriminasi Gender dalam Tayangan Kakek-Kakek Narsis di Trans TV

    OpenAIRE

    Saputro, Angga Widhi; Sunarto, Sunarto; Lestari, Sri Budi

    2013-01-01

    SINama : Angga Widhi SaputroNIM : D2C007006Judul : Resepsi Pemirsa Tentang Diskriminasi Gender dalam Tayangan Kakek-KakekNarsis di Trans TVPenelitian ini dilatarbelakangi oleh banyaknya bentuk diskriminasi gender yang ada di media.Hal ini tidak terlepas dari adanya budaya patriarki yang ada di Balik produksi teks danwacana yang ada dalam media. Media kerap menampilkan perempuan sebagai objek seks danlaki-laki sebagai subjeknya. Tayangan talk show bernama Kakek-Kakek Narsis diduga turutmempeng...

  6. A PC-Linux-based data acquisition system for the STAR TOFp detector

    International Nuclear Information System (INIS)

    Liu Zhixu; Liu Feng; Zhang Bingyun

    2003-01-01

    Commodity hardware running the open source operating system Linux is playing various important roles in the field of high energy physics. This paper describes the PC-Linux-based Data Acquisition System of STAR TOFp detector. It is based on the conventional solutions with front-end electronics made of NIM and CAMAC modules controlled by a PC running Linux. The system had been commissioned into the STAR DAQ system, and worked successfully in the second year of STAR physics runs

  7. Introduction to FASTBUS

    International Nuclear Information System (INIS)

    Logg, C.A.

    1982-11-01

    FASTBUS is a standardized modular 32-bit data-bus system for performing data acquisition, data processing, and control in high energy physics and other applications. It has been developed by the Fast System Design Group of the U.S. NIM Committee. Presented here is an overview of the FASTBUS hardware specification, the operation of the FASTBUS protocol, the implications that the use of FASTBUS has for software systems, and some of the computer to FASTBUS interfaces developed to date

  8. Марина Голуб: Сильной быть трудно / Ксения Репсон

    Index Scriptorium Estoniae

    Репсон, Ксения

    2011-01-01

    Teatrifestivali "Kuldne Mask Eestis" ("Золотая маска в Эстонии") raames tuleb novembris 2011 Tallinna külalisetendustega Moskva A. Tšehhovi nim. Kunstiteater. Lev Ehrenburgi lavastuses "Vassa Železnova" (Maksim Gorki teose järgi) mängib peaosa Marina Golub, näitlejannast ja tema rollidest

  9. O teh, tshi pamjatniki mõ vidim / Julia Totskaja

    Index Scriptorium Estoniae

    Totskaja, Julia

    2008-01-01

    Meenutatakse Kreenholmi manufaktuuriga seotud isikuid, kelle mälestusmärgid asuvad Narvas Gerassimovi nim. kultuurimaja juures. Kirjeldatud lühidalt mälestusmärke ja nimetatud nende autorid. Amalie Kreisbergi monumendi (1957) autor on Leningradi skulptor Nikolai Dõdõkin, Vassili Gerassimovi monumendi (1957) autor Aram Airijev, August Abeli monumendi (1974) autor ukraina skulptor Mihhail Lõssenko ja Fjodor Afanasjevi monumendi (1957) autor on L. Mess

  10. Tensile Strain Dependence of Critical Current for RHQ-Nb3Al Wires

    OpenAIRE

    Jin, Xinzhe; Oguro, Hidetoshi; Nakamoto, Tatsushi; Awaji, Satoshi; Ogitsu, Toru; Tsuchiya, Kiyosumi; Yamamoto, Akira; Kikuchi, Akihiro; Takeuchi, Takao

    2011-01-01

    KEK and NIMS have been jointly developing Nb3Al superconducting wire with a rapid heating and quenching (RHQ) method towards high field accelerator magnets in the Large Hadron Collider (LHC) luminosity upgrade. A15-type superconductors such as Nb3Al and Nb3Sn exhibit strain dependence with respect to their critical currents. Therefore, a thorough understanding of strain behavior is necessary for high field accelerator magnet development, which will be critical for the luminosity upgrade of th...

  11. Ühiskool luuakse Austria firma kavandi järgi / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas, 1954-

    2011-01-01

    Tallinna Muusikakeskkooli, Georg Otsa nim. Tallinna Muusikakooli ja Tallinna Balletikooli ühise maja arhitektuurikonkursi võitis Austria firma Atelier Thomas Pucher ZT GmbH töö "Vaikuse aed". Teise koha pälvis arhitektuuribüroo Emil Urbel töö "Octopus" ja kolmanda koha Ninja Stuudio töö "Pausid & poosid". Pikemalt võidutööst

  12. Improving yield and water use efficiency of apple trees through intercrop-mulch of crown vetch (Coronilla varia L.) combined with different fertilizer treatments in the Loess Plateau

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, W.; Li, Y.; Gong, Q.; Zhang, H.; Zhao, Z.; Zheng, Z.; Zhai, B.; Wang, Z.

    2016-07-01

    Improving water use efficiency (WUE) and soil fertility is relevant for apple production in drylands. The effects of intercrop-mulch (IM) of crown vetch (Coronilla varia L.) combined with different fertilizer treatments on WUE of apple trees and soil fertility of apple orchards were assessed over three years (2011, 2013 and 2014). A split-plot design was adopted, in which the main treatments were IM and no intercrop-mulch (NIM). Five sub-treatments were established: no fertilization (CK); nitrogen and phosphorus fertilizer (NP); manure (M); N, P and potassium fertilizer (NPK); and NPK fertilizer combined with manure (NPKM). Due to mowing and mulching each month during July–September, the evapotranspiration for IM was 17.3% lower than that of NIM in the dry year of 2013. Additionally, the soil water storage of NPKM treatment was higher than that of CK during the experimental period. Thus, single fruit weight and fruit number per tree increased with IM and NPKM application. Moreover, applying NPKM with IM resulted in the highest yield (on average of three years), which was 73.25% and 130.51% greater than that of CK in IM and NIM, respectively. The WUE of NPKM combined with IM was also the highest in 2013 and 2014 (47.69 and 56.95% greater than applying IM alone). In addition, due to application of IM combined with NPKM, soil organic matter was increased by 25.8% compared with that of CK (in NIM). Additionally, application of IM combined with NPKM obtained more economic net return, compared to other combinations. Therefore, applying NPKM with IM is recommended for improving apple production in this rain-fed agricultural area.

  13. Critical Mass in the Boardroom of Croatian Banks

    OpenAIRE

    Kramaric Tomislava Pavic; Miletic Marko

    2017-01-01

    This paper investigates the influence of gender diversity in the boardroom of Croatian banks on their performance. Specifically, we deal with both management and supervisory boards. Moreover, based on critical mass theory, the authors try to find out what constitutes critical mass. Using a static panel analysis on a sample of all commercial banks that operated in the period 2002-2014, three models were estimated with return on assets (ROA), return on equity (ROE) and net interest margin (NIM)...

  14. The Relationship between CSR and Banks' Financial Performance: Evidence from Turkey

    OpenAIRE

    TASKIN, Dilvin

    2015-01-01

    Purpose: To analyze the bidirectional relationship between CSR practices of Turkish banks and their financial performance, which is proxied by ROE, ROA and NIM for the year 2013.Originality/value: The paper focus on the changing nature of the Turkish banks which face greater competition and their attempts at practicing CSRDesign/methodology/approach: The study uses content analysis to analyze the degree of CSR on a CSR index and uses regression analysis to determine the link between performan...

  15. Kampanye Pr Radio Ssfm “Assik Ala Ssfm”

    OpenAIRE

    Putra, Jeffry Septian; Setiabudi, Djoko; Naryoso, Agus

    2013-01-01

    JUDUL : Kampanye PR Radio SSFM “Assik Ala SSFM”NAMA : Jeffry Septian PutraNIM : D2C607024ABSTRAKSIPersaingan radio saat ini semakin ketat, industri media siaran perlu memahamidan mengenali ekspektasi atau apa yang diinginkan para pendengar. Pengelola radioperlu strategi untuk mendapatkan perhatian dari para pendengarnya terlebih dari sisipemasaran yang akan memberikan dampak bagi kelancaran merebut perhatianpendengar. Untuk menciptakan strategi yang tepat dalam membuat mengelola radioagar tet...

  16. Audit Media Relations Humas Sekretariat Daerah Provinsi Jawa Tengah untuk Peningkatan Publisitas

    OpenAIRE

    Farhatiningsih, Lizzatul; Pradekso, Tandiyo; Naryoso, Agus

    2013-01-01

    Nama : Lizzatul FarhatiningsihNIM : D2C009011Judul : Audit Media Relations Humas Sekretariat Daerah ProvinsiJawa Tengah untuk Peningkatan PublisitasABSTRAKPenelitian ini dilatarbelakangi karena kurang berperannya Biro HumasSetda Jawa Tengah dalam melakukan fungsi kehumasan terhadap PemerintahProvinsi Jawa Tengah. Humas telah melakukan banyak kegiatan namun efeknyapada pemberitaan tentang Pemerintah Provinsi yang muncul belum terasa. Namunkesesuaian melakukan banyak kegiatan tersebut belum dii...

  17. Standard software for CAMAC

    International Nuclear Information System (INIS)

    Lenkszus, F.R.

    1978-01-01

    The NIM Committee (National Instrumentation Methods Committee) of the U.S. Department of Energy and the ESONE Committee of European Laboratories have jointly specified standard software for use with CAMAC. Three general approaches were followed: the definition of a language called IML for use in CAMAC systems, the definition of a standard set of subroutine calls, and real-time extensions to the BASIC language. This paper summarizes the results of these efforts. 1 table

  18. Międzyrzecki Rejon Umocniony – w oczekiwaniu na adaptacje i modernizacje

    Directory of Open Access Journals (Sweden)

    Bartosz Michalak

    2018-04-01

    W artykule przedstawiono historię oraz opis kompleksu a także propozycje adaptacji schronów na nowe cele. Istnieje kilka koncepcji a realizacja tych planów byłaby cenną inicjatywą związaną z ochroną tego wyjątkowego obszaru i znajdujących się na nim obiektów inżynierskich.

  19. Near-Infrared Mapping Spectrometer for investigation of Jupiter and its satellites

    International Nuclear Information System (INIS)

    Aptaker, I.M.

    1988-01-01

    The Near-Infrared-Mapping Spectrometer (NIMS) is one of the science instruments in the Galileo mission, which will explore Jupiter and its satellites in the mid-1990's. The NIMS experiment will map geological units on the surfaces of the Jovian satellites and characterize their mineral content; and, for the atmosphere of Jupiter, investigate cloud properties and the spatial and temporal variability of molecular abundances. The optics are gold-coated reflective and consist of a telescope and a grating spectrometer. The balance of the instrument includes a 17-detector (silicon and indium antimonide) focal plane array, a tuning fork chopper, microprocessor-controlled electronics, and a passive radiative cooler. A wobbling secondary mirror in the telescope provides 20 pixels in one dimension of spatial scanning in a pushbroom mode with 0.5 mr x 0.5 mr instantaneous field of view. The spectral range is 0.7-5.2 microns; resolution is 0.025 micron. NIMS is the first infrared experiment to combine both spatial and spectral mapping capability in one instrument

  20. [Efficacy of extracts of plants in engorged females of Boophilus microplus from the mesoregion West of Maranhão, Brazil.].

    Science.gov (United States)

    Costa, Francisco B; Vasconcelos, Pádua Suely Da S; Silva, Ana Maria M; Brandão, Vivian M; Da Silva, Iran A; Teixeira, Whaubtyfran C; Guerra, Rita De Maria S N; Dos Santos, Ana Clara G

    2008-09-01

    The objective was to evaluate the efficacy of hydro-alcoholic extracts of nim and citronela at 20% and eucalipto at 10% in Boophilus microplus engorged females collected in cattle naturally infected from the mesoregion West of Maranhão. At the laboratory the females were separated, weighted and distributed in six groups of 10, in duplicate. Each group was immersed in 10mL of the solution of the extracts, for two minutes. In the nim and citronela extracts there was 32% e 17%, respectively, while larval emergence the eucalipto extracts demonstrated 96% of efficacy. In the groups treated by Cipermetrina + Clorpirifós + Citronetal and Deltametrina (positive controls) the mortality occurred after 48h of treatment, while the groups immersed in distilled water (negative control) showed 100% of eggs mass and larval emergence. According to the results, it can be concluded that the extract of eucalipto could be used as acaricide in the control of B. microplus females since it was efficient in vitro, however to nim and citronela showed not efficacy. B. microplus females were not resistant to the chemical compounds used in this experiment.

  1. Twisted boundary states and representation of generalized fusion algebra

    International Nuclear Information System (INIS)

    Ishikawa, Hiroshi; Tani, Taro

    2006-01-01

    The mutual consistency of boundary conditions twisted by an automorphism group G of the chiral algebra is studied for general modular invariants of rational conformal field theories. We show that a consistent set of twisted boundary states associated with any modular invariant realizes a non-negative integer matrix representation (NIM-rep) of the generalized fusion algebra, an extension of the fusion algebra by representations of the twisted chiral algebra associated with the automorphism group G. We check this result for several concrete cases. In particular, we find that two NIM-reps of the fusion algebra for su(3) k (k=3,5) are organized into a NIM-rep of the generalized fusion algebra for the charge-conjugation automorphism of su(3) k . We point out that the generalized fusion algebra is non-commutative if G is non-Abelian and provide some examples for G-bar S 3 . Finally, we give an argument that the graph fusion algebra associated with simple current extensions coincides with the generalized fusion algebra for the extended chiral algebra, and thereby explain that the graph fusion algebra contains the fusion algebra of the extended theory as a subalgebra

  2. Controle da infestação por Ornithonyssus sylviarum (Canestrini e Fanzago, 1877 (Acari: Macronyssidae em poedeiras comerciais utilizando extrato de Azadirachta indica Control of Ornithonyssus sylviarum (Canestrini and Fanzago, 1877 (Acari: Macronyssidae infestation in commercial laying hens by using Azadirachta indica extract

    Directory of Open Access Journals (Sweden)

    Nilce M. Soares

    2008-12-01

    Full Text Available O presente trabalho teve por objetivo avaliar a eficácia de um produto à base de extrato de nim, no controle da infestação por O. sylviarum em poedeiras comerciais. O experimento foi realizado observando-se a eficácia do extrato de nim a 2% após duas, três e quatro aplicações com intervalo de sete dias. Os resultados obtidos permitem concluir que o extrato de nim a 2% é efetivo no controle da infestação por O. sylviarum, sendo necessárias pelo menos três pulverizações semanais do produto para que haja o controle efetivo do parasito.This study evaluated the effectiveness of a neem extract-based product to control O. sylviarum infestations in commercial laying hens. The birds were divided in 3 groups, which received 2, 3, or 4 applications of the product at 7 day intervals. The results obtained allow the conclusion that the neem extract at 2"% is effective to control infestations by O. sylviarum, and at least 3 sprays of the product are required weekly for an effective control of the parasite.

  3. Literary awards 2003 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2004-01-01

    Riigi kultuuripreemia - Vello Salo (elutööpreemia) ; Eesti Kultuurkapitali aastapreemia - Toomas Liiv ("Luuletused 1968-2002") ; Kultuurkapitali kirjanduse aastapreemiad: proosa - Nikolai Baturin ("Kentaur"), luule - Asko Künnap ("Ja sisalikud vastasid (kolmes kirjas)"), esseistika - Toomas Raudam ("Teie"), näitekirjandus - Mati Unt ("Vend Antigone, ema Oidipus", "Stiil, ehk, Mis on maailma nimi", "Kärbeste saar"), lastekirjandus - Katrin Reimus ("Haldjatants"), tõlge eesti keelde - Jaak Rähesoo (J. Joyce'i "Kunstniku noorpõlve portree" ja "Pagulaste" tõlked), tõlge eesti keelest - Eric Dickens (J. Krossi "Paigallennu" tõlge), artiklipreemia - Arne Merilai (järelsõna antoloogiale "Eesti ballaad"), venekeelsete autorite kirjandusauhind - Marina Tervonen (luulekogu "Ületamine") ; B. Alveri kirjandusauhind - Erkki Luuk ("Ornitoloogi pealehakkamine") ; F. Tuglase novelliauhind - Lauri Pilter ("Teisik"), Ilmar Jaks (novell "Armer Adolf" ja novellikogu "Pimedus") ; A. H. Tammsaare nim. kirjanduspreemia - Rein Veidemann ("Lastekodu") ; E. Vilde nim. kirjandusauhind - Eeva Park ("Lõks lõpmatuses") ; Nukitsa auhind - Janno Põldma ja Heiki Ernits ("Lepatriinude jõulud") ; K. E. Söödi nim. lasteluulepreemia - Jaanus Vaiksoo (luulekogu "Kellassepaproua") ; Eesti Raudtee ja Sirbi kirjandusauhind - Andres Vanapa ("Päti vile") ja Kristiina Ehin ("Simunapäev")

  4. An examination of the relationship between CSR disclosure and financial performance: The case of Polish banks

    Directory of Open Access Journals (Sweden)

    Łukasz Matuszak

    2017-12-01

    Full Text Available The purpose of this study is twofold. First, this study investigates the trends of corporate social responsibility (CSR reporting and financial performance (FP in commercial banks in Poland. Second, this study examines the impact of the CSR disclosure of the banks on their financial performance (ROA, ROE, NIM. Sample consists of 18 banks. The data from annual reports for the period of 8 years (2008 – 2015 were both hand collected and obtained from Notoria Servis Database. A content analysis is used to measure the level of CSR disclosures and a panel data analysis is employed to examine the CSR-FP relationship. Software: GRETL. Two key findings: (1 Positive relationship between banks’ CSR disclosures and their profitability measured by ROA and ROE. However, the relationship between banks’ CSR disclosures and NIM is negative. Statistical analysis did not report any significant effect of CSR activities on ROA, ROE and NIM ratios. (2 Banks’ CSR activities are not dominant predictor of their profitability as compared with control variables. To our best knowledge this research is the first quantitative analysis regarding banking sector in Poland. Further, this study was conducted in emerging market with different socio-economic context and regulations compared to developed market. The findings contribute to and increase the understanding of the relationship between CSR disclosures and FP. Finally, this study has important implications for policy makers, managers, investors, and others.

  5. Ação de Inseticidas Botânicos sobre a Preferência Alimentar e sobre Posturas de Spodoptera frugiperda (J.E. Smith (Lepidoptera: Noctuidae em Milho

    Directory of Open Access Journals (Sweden)

    Fábio Mazzonetto

    2013-04-01

    Full Text Available O presente trabalho objetivou comparar o efeito de diferentes extratos de origem vegetal na preferência alimentar e na postura da lagarta do cartucho Spodoptera frugiperda (J.E. Smith em folhas de milho. Extratos aquosos a 10% p/v de Chenopodium ambrosioides (Linnaeus (Erva de Santa Maria, Corymbia citriodora (Hill & Johnson (Eucalipto Cheiroso, Chrysanthemum leucanthemum (Linnaeus (Crisântemo e Azadirachta indica (A. Juss (Nim foram aplicados em discos de folhas de milho e oferecidos às lagartas em testes com e sem chance de escolha. A atratividade das lagartas pelos discos com os extratos não diferiu da testemunha no teste com chance de escolha, porém os extratos de Nim e Crisântemo apresentaram efeito fagodeterrente a S. frugiperda. Nos testes sem chance de escolha, o tratamento que mais repeliu as lagartas foi utilizando extrato de Nim, representando possível alternativa para o controle das lagartas desta espécie. Nenhum dos extratos aquosos das espécies vegetais testadas apresentou efeito ovicida.

  6. Evaluating the clinical utility of the Validity-10 for detecting amplified symptom reporting for patients with mild traumatic brain injury and comorbid psychological health conditions.

    Science.gov (United States)

    Dretsch, Michael N; Williams, Kathy; Staver, Tara; Grammer, Geoffrey; Bleiberg, Joseph; DeGraba, Thomas; Lange, Rael T

    2017-01-01

    The objective of this study was to compare the Validity-10 scale with the PAI Negative Impression Management Scale (PAI-NIM) for detecting exaggerated symptom reporting in active-duty military service members (SMs) admitted with unremitting mild TBI symptoms and comorbid psychological health conditions (mTBI/PH). Data were analyzed from 254 SMs who completed the Neurobehavioral Symptom Inventory (NSI) and Personality Assessment Inventory (PAI) as a part of a larger battery of self-report symptom scales upon admission to the intensive-outpatient TBI treatment program at a military medical center. Symptom exaggeration was operationalized using the PAI Negative Impression Management Scale (PAI-NIM). A PAI-NIM score of ≥73 was categorized as positive for symptom exaggeration (SVTpos), while a lower score was categorized as negative for symptom exaggeration (SVTneg). SMs in the SVTpos group (n = 34) had significantly higher scores (p ≤ .004) on the PAI clinical scales as well as on the NSI total score (range: d = 0.59-1.91) compared to those who were SVTneg (n = 220). The optimal cut-score for the NSI Val-10 scale to identify possible symptom exaggeration was ≥26 (sensitivity = .29, specificity = .95, PPP = .74, NPP = .71). In patients suffering from mTBI/PH, the Validity-10 requires a higher cut-score than previously reported to be useful as a metric of exaggerated symptom reporting.

  7. Literary awards 2002 / Piret Viires

    Index Scriptorium Estoniae

    Viires, Piret, 1963-

    2003-01-01

    Riigi kultuuripreemia - Hando Runnel (elutööpreemia) ; Balti Assamblee kirjandusauhind - Jaan Tätte ("Sild" ja "Palju õnne argipäevaks") ; A. H. Tammsaare nim. romaaniauhind - Andrus Kivirähk ("Rehepapp") ; Eesti Kultuurkapitali aastapreemia - Aleksander Suuman ("Tondihobu tõugud vetikatega") ; Kultuurkapitali kirjanduse aastapreemiad: proosa - Jüri Ehlvest ("Hobune eikusagilt"), luule - Karl Martin Sinijärv ("Artutart & 39"), esseistika - Peeter Mudist ("Ratsukäik"), näitekirjandus - Vaino Vahing ("Mängud ja kõnelused"), lastekirjandus - Heino Kiik ("Kuresaapad"), tõlge eesti keelde - Mati Sirkel (Franz Kafka "Hiina müüri ehitamisel" tõlge), tõlge eesti keelest - Antoine Chalvin (Jaan Kaplinski "Le désir de la pousicre" tõlge), artiklipreemia - Tõnu Õnnepalu ("Kui... Küpsemine. Aleksander Suumani kaks luuletust ja üks raamat ("Meil siin Hüperboreas")", ilmus Loomingus, nr. 5-6), venekeelsete autorite kirjandusauhind - Mihhail Veller (viimase 10 aasta proosaloomingu eest) ; B. Alveri kirjandusauhind - Leo Kunnas ("Sõdurjumala teener") ja Ülar Ploom ("Üks ja kogu"); 2002. a. romaanivõistluse võitja - Nikolai Baturin ("Kentaur") ; A. H. Tammsaare nim. kirjanduspreemia - Elem Treier ("Tammsaare elu härra Hansenina") ; E. Vilde nim. kirjandusauhind - Doris Kareva ("Mandragora") ; F. Tuglase novelliauhind - Jüri Ehlvest ("Hobune eikusagilt", Looming, 2002, nr. 1) ja Jaan Undusk ("Armastus raamatu vastu", ilmus kogumikus "Puudutus"); Juhan Liivi luuleauhind - Andres Ehin (luuletus "sügaval maa all elavad...", Looming, 2002, nr. 4)

  8. Development and validation of a novel RP-HPLC method for simultaneous determination of paracetamol, phenylephrine hydrochloride, caffeine, cetirizine and nimesulide in tablet formulation

    Directory of Open Access Journals (Sweden)

    A.P. Dewani

    2015-07-01

    Full Text Available The present work describes development and validation of a high-performance liquid chromatography–diode array detection (HPLC–DAD procedure for the analysis of phenylephrine hydrochloride (PHE, paracetamol (PAR, caffeine anhydrous (CAF, cetirizine Dihydrochloride (CET, nimesulide (NIM in pharmaceutical mixture. Effective chromatographic separation of PHE, PAR, CAF, CET and NIM was achieved using a Kinetex-C18 (4.6 mm, 150 mm, 5 mm column with gradient elution of the mobile phase composed of 10 mM phosphate buffer (pH 3.3 and acetonitrile. The elution was a three step gradient elution program step-1 started initially with 2% (by volume acetonitrile and 98% phosphate buffer (pH 3.3 for first 2 min. In step-2 acetonitrile concentration changed linearly to 20% up to 12 min the analysis was concluded by step-3 changing acetonitrile to 2% up to 20 min. The proposed HPLC method was statistically validated with respect to linearity, ranges, precision, accuracy, selectivity and robustness. Calibration curves were linear in the ranges of 5–100, 100–1000 and 10–200 mg/mL for PHE, PAR, CAF, CET and NIM respectively, with correlation coefficients >0.9996. The HPLC method was applied to tablet dosage form in which the analytes were successfully quantified with good recovery values with no interfering peaks from the excipients.

  9. Monte Carlo Simulation of Callisto's Exosphere

    Science.gov (United States)

    Vorburger, Audrey; Wurz, Peter; Galli, André; Mousis, Olivier; Barabash, Stas; Lammer, Helmut

    2014-05-01

    Whereas Callisto's surface has been mapped as early as in 1980 by the two Voyager missions, Callisto's tenuous atmosphere, also called an exosphere, was not directly observed until the Galileo mission in 1999. The Galileo Near-Infrared Mapping Spectrometer detected a CO2 signal up to 100 km above the surface [Carlson, Science, 1999]. Radio occultation measurements, also conducted by Galileo, led to the detection of an ionosphere with inferred densities much higher than can be explained by the measured CO2 exosphere, though [Kliore et al., J. Geophys. Res, 2002]. Insight about Callisto's exosphere is expected to be boosted by the Neutral Ion Mass Spectrometer (NIM) of the Particle Environment Package (PEP) on board the planned JUpiter ICy moons Explorer (JUICE) mission, which will conduct the first-ever direct sampling of the exospheres of Europa, Ganymede, and Callisto. To ensure that NIM's mass resolution and mass range will be sufficient for NIM to detect most expected species in Callisto's exosphere, we model said exosphere ab initio. Since Callisto is thought to consist to about equal parts of both icy and rocky components [Showman and Malhotra, Science, 1999], we model particle release from an icy as well as from a mineral surface separately. For the ice component, we investigate two different compositions, for reducing and oxidising conditions, which find analogy in the initial gas phase conditions in the solar nebula [Mousis et al., Planet. Space Sci., submitted]. For the non-ice material, the mineral surface, we investigate surfaces with compositions similar to CI chondrites and L/LL type chondrites, both of which have been suggested to represent Callisto's non-ice material best [Kuskov and Kronrod, Icarus, 2005 and Moore et al., Cambridge University Press, 2004]. For all mentioned materials, we compute density profiles for particles released by either surface sublimation or ion induced sputtering up to an altitude of 100'000 km. Our results show that close

  10. Oxidative generation of guanine radicals by carbonate radicals and their reactions with nitrogen dioxide to form site specific 5-guanidino-4-nitroimidazole lesions in oligodeoxynucleotides.

    Science.gov (United States)

    Joffe, Avrum; Mock, Steven; Yun, Byeong Hwa; Kolbanovskiy, Alexander; Geacintov, Nicholas E; Shafirovich, Vladimir

    2003-08-01

    A simple photochemical approach is described for synthesizing site specific, stable 5-guanidino-4-nitroimidazole (NIm) adducts in single- and double-stranded oligodeoxynucleotides containing single and multiple guanine residues. The DNA sequences employed, 5'-d(ACC CG(1)C G(2)TC CG(3)C G(4)CC) and 5'-d(ACC CG(1)C G(2)TC C), were a portion of exon 5 of the p53 tumor suppressor gene, including the codons 157 (G(2)) and 158 (G(3)) mutation hot spots in the former sequence with four Gs and the codon 157 (G(2)) mutation hot spot in the latter sequence with two Gs. The nitration of oligodeoxynucleotides was initiated by the selective photodissociation of persulfate anions to sulfate radicals induced by UV laser pulses (308 nm). In aqueous solutions, of bicarbonate and nitrite anions, the sulfate radicals generate carbonate anion radicals and nitrogen dioxide radicals by one electron oxidation of the respective anions. The guanine residue in the oligodeoxynucleotide is oxidized by the carbonate anion radical to form the neutral guanine radical. While the nitrogen dioxide radicals do not react with any of the intact DNA bases, they readily combine with the guanine radicals at either the C8 or the C5 positions. The C8 addition generates the well-known 8-nitroguanine (8-nitro-G) lesions, whereas the C5 attack produces unstable adducts, which rapidly decompose to NIm lesions. The maximum yields of the nitro products (NIm + 8-nitro-G) were typically in the range of 20-40%, depending on the number of guanine residues in the sequence. The ratio of the NIm to 8-nitro-G lesions gradually decreases from 3.4 in the model compound, 2',3',5'-tri-O-acetylguanosine, to 2.1-2.6 in the single-stranded oligodeoxynucleotides and to 0.8-1.1 in the duplexes. The adduct of the 5'-d(ACC CG(1)C G(2)TC C) oligodeoxynucleotide containing the NIm lesion in codon 157 (G(2)) was isolated in HPLC-pure form. The integrity of this adduct was established by a detailed analysis of exonuclease digestion

  11. Constant electrical resistivity of Ni along the melting boundary up to 9 GPa

    Science.gov (United States)

    Silber, Reynold E.; Secco, Richard A.; Yong, Wenjun

    2017-07-01

    Characterization of transport properties of liquid Ni at high pressures has important geophysical implications for terrestrial planetary interiors, because Ni is a close electronic analogue of Fe and it is also integral to Earth's core. We report measurements of the electrical resistivity of solid and liquid Ni at pressures 3-9 GPa using a 3000 t multianvil large volume press. A four-wire method, in conjunction with a rapid acquisition meter and polarity switch, was used to overcome experimental challenges such as melt containment and maintaining sample geometry and to mitigate the extreme reactivity/solubility of liquid Ni with most thermocouple and electrode materials. Thermal conductivity is calculated using the Wiedemann-Franz law. Electrical resistivity of solid Ni exhibits the expected P dependence and is consistent with earlier experimental values. Within experimental uncertainties, our results indicate that resistivity of liquid Ni remains invariant along the P-dependent melting boundary, which is in disagreement with earlier prediction for liquid transition metals. The potential reasons for such behavior are examined qualitatively through the impact of P-independent local short-range ordering on electron mean free path and the possibility of constant Fermi surface at the onset of Ni melting. Correlation among metals obeying the Kadowaki-Woods ratio and the group of late transition metals with unfilled d-electron band displaying anomalously shallow melting curves suggests that on the melting boundary, Fe may exhibit the same resistivity behavior as Ni. This could have important implications for the heat flow in the Earth's core.

  12. Magnetization, resistivity, specific heat and ab initio calculations of Gd5Sb3.

    Science.gov (United States)

    Samatham, S Shanmukharao; Patel, Akhilesh Kumar; Lukoyanov, Alexey V; Suresh, K G

    2018-06-07

    We report on the combined results of structural, magnetic, transport and calorimetric properties of Mn5Si3-type hexagonal Gd5Sb3, together with ab-initio calculations. It exhibits a ferromagnetic (FM)-like transition at 265 K, antiferromagnetic (AFM) Néel transition at 95.5 K followed by a spin-orientation transition at 62 K. The system is found to be in AFM state down to 2 K in a field of 70 kOe. The FM-AFM phase coexistence is not noticeable despite large positive Curie-Weiss temperature (θCW = 223.5 ± 0.2 K). Instead, low-temperature AFM and high-temperature FM-like phases are separated in large temperatures. Temperature-magnetic field (H-T) phase diagram reveals field-driven complex magnetic phases. Within the AFM phase, the system is observed to undergo field-driven spin-orientation transitions. Field-induced tricritical and quantum critical points appear to be absent due to strong AFM nature and by the intervention of FM-like state between paramagnetic and AFM states, respectively. The metallic behavior of the compound is inferred from resistivity along with large Sommerfeld parameter. However, no sign of strong electron-correlations is reasoned from the Kadowaki-Wood's ratio A2 ∼ 1.9×10-6 μΩ.cm.(mol.K)2(mJ)-2, despite heavy γ. Essentially, ab initio calculations accounting for electronic correlations confirm AFM nature of low-temperature magnetic state in Gd5Sb3 and attainable FM ordering in agreement with experimental data. © 2018 IOP Publishing Ltd.

  13. Abdominal obesity: causal factor or simply a symptom of obesity-related health risk

    Directory of Open Access Journals (Sweden)

    Oh S

    2014-07-01

    Full Text Available Sechang Oh,1 Kiyoji Tanaka,2 Jin-won Noh,3 Rina So,2,4 Takehiko Tsujimoto,2 Hiroyuki Sasai,1,4 Mijung Kim,5 Junichi Shoda11Faculty of Medicine, University of Tsukuba, Tsukuba, Ibaraki, Japan; 2Faculty of Health and Sports Science, University of Tsukuba, Tsukuba, Ibaraki, Japan; 3Department of Healthcare Management, Eulji University, Seongnam-si, Gyeonggi-do, Republic of Korea; 4Japan Society for the Promotion of Science, Tokyo, Japan; 5Faculty of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki, JapanBackground: Abdominal fat (AF reduction is advocated in the treatment of obesity-related diseases. Nonetheless, recent studies have shown additional beneficial effects against obesity-related health risks, independent of AF reduction. Therefore it is important to determine whether AF plays a causal role in promoting metabolic disorders or is simply a symptom of increased obesity-related health risk factors. Clarification of the primary role of AF in the pathogenesis of obesity-related disease is also important.Objective: This retrospective study was conducted with the objectives of 1 comparison between groups exhibiting equivalent amounts of AF loss that resulted from distinct treatments (exercise and dietary restriction with respect to degrees of improvement in obesity-related health risk factors and 2 determination of definite differences in the outcomes of obesity-related health risk in subjects receiving identical treatment (exercise but exhibiting a remarkable difference in AF reduction.Design: In 66 subjects who completed a 12-week exercise or dietary restriction program, 17 parameters (systolic blood pressure [SBP] and diastolic blood pressure [DBP]; high-sensitivity C-reactive protein [hs-CRP]; leptin, adiponectin, tumor necrosis factor [TNF]-α, interleukin [IL]-6; alanine aminotransferase [ALT], gamma glutamyl transpeptidase [γGT]; lipid profile: high-density lipoprotein cholesterol [HDLC], triglyceride [TG

  14. Late pest control in determinate tomato cultivars Controle de pragas tardias em cultivares de tomateiro de crescimento determinado

    Directory of Open Access Journals (Sweden)

    Arlindo Leal Boiça Júnior

    2007-12-01

    Full Text Available The usage of insecticidal plants and others insect resistant varieties can be strong allies to the Integrated Pest Management (IPM, being able to reduce the number of insecticides applications and to minimize its effect to the man and the environment.The following control techniques were compared in field conditions, investigating the late pest control of two determinate tomato cultivars: a Conventional - sprayings of metamidophos, buprofezin, acephate, cipermetrin, abamectin, permetrin, teflubenzuron and lufenuron, applied every three to six days; b IPM - action threshold of each pest to the spraying of imidacloprid, triflumuron, lufenuron and abamectin; c IPM - Azadirachta indica (neem - Action threshold of each pest to the spraying of the nim oil (1.2% of azadirachtin at a concentration of 0.5%. The IPM and IPM - Neem control techniques were efficient controlling the late pest of the tomato cultivar, not differing from the conventional treatment that presented the lowest levels of infestation. The conventional control technique, IPM and IPM-neem promoted bigger tomato production with increasements of up to 74%. The number of sprayings was reduced up to 77% with the IPM and IPM - neem techniques, when compared to the conventional method. The neem product may be a promising alternative to the late pest control in the tomato field that adjusts to the IPM.O uso de plantas inseticidas e de variedades pode ser forte aliado ao Manejo Integrado de Pragas (MIP, podendo reduzir o número de aplicações de inseticidas e minimizar seus efeitos ao homem e ao meio ambiente. Em condições de campo, visando o controle de pragas tardias do tomateiro em duas cultivares de crescimento determinado, compararam-se as seguintes táticas de controle: a Convencional - pulverizações com os produtos metamidofós, buprofezin, acefato, cipermetrina, abamectina, permetrina, teflubenzuron e lufenuron, aplicados em intervalos de três a seis dias; b MIP - nível de a

  15. Tritium in Japanese precipitation following the March 2011 Fukushima Daiichi Nuclear Plant accident

    Energy Technology Data Exchange (ETDEWEB)

    Matsumoto, Takuya, E-mail: t.matsumoto@iaea.org [Isotope Hydrology Section, Division of Physical and Chemical Sciences, International Atomic Energy Agency, Vienna International Centre, 1400 Vienna (Austria); Maruoka, Teruyuki [Division of Integrative Environmental Sciences Graduate School of Life and Environmental Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba City, Ibaraki 305-8572 (Japan); Shimoda, Gen [Geological Survey of Japan, National Institute of Advanced Industrial Science and Technology, 1-1-1 Higashi, Tsukuba City, Ibaraki 305-8561 (Japan); Obata, Hajime [Atmosphere and Ocean Research Institute, The University of Tokyo, 5-1-5, Kashiwanoha, Kashiwa-shi, Chiba 277-8564 (Japan); Kagi, Hiroyuki [Geochemical Research Center, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Suzuki, Katsuhiko [Japan Agency for Marin-Earth Science and Technology, 2-15, Natsushima, Yokosuka, Kanagawa 237-0061 (Japan); Yamamoto, Koshi [Graduate School of Environmental Studies, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Mitsuguchi, Takehiro [215 Ooma Akadoji-cho Konan, 483-8226 (Japan); Usa Marine Biological Institute, Kochi University, 194 Inoshiri, Usa, Tosa, Kochi 781-1164 (Japan); Hagino, Kyoko; Tomioka, Naotaka [Institute for Study of the Earth' s Interior, Okayama University at Misasa, 827 Yamada, Misasa, Tottori 682-0193 (Japan); Sambandam, Chinmaya; Brummer, Daniela; Klaus, Philipp Martin; Aggarwal, Pradeep [Isotope Hydrology Section, Division of Physical and Chemical Sciences, International Atomic Energy Agency, Vienna International Centre, 1400 Vienna (Austria)

    2013-02-15

    Tritium concentrations in Japanese precipitation samples collected after the March 2011 accident at the Fukushima Dai-ichi Nuclear Power Plant (FNPP1) were measured. Values exceeding the pre-accident background were detected at three out of seven localities (Tsukuba, Kashiwa and Hongo) southwest of the FNPP1 at distances varying between 170 and 220 km from the source. The highest tritium content was found in the first rainfall in Tsukuba after the accident; however concentrations were 500 times less than the regulatory limit for tritium in drinking water. Tritium concentrations decreased steadily and rapidly with time, becoming indistinguishable from the pre-accident values within five weeks. The atmospheric tritium activities in the vicinity of the FNPP1 during the earliest stage of the accident was estimated to be 1.5 × 10{sup 3} Bq/m{sup 3}, which is potentially capable of producing rainwater exceeding the regulatory limit, but only in the immediate vicinity of the source. - Highlights: ► We measured the {sup 3}H contents of Japanese rain collected after the Fukushima accident. ► {sup 3}H level became 30 times higher than pre-accident level in the first rain at Tsukuba. ► Some locality within 220 km from the source showed elevated {sup 3}H levels. ► These high {sup 3}H signals disappear in a few weeks. ► Atmospheric {sup 3}H level at the source during the earliest stage was estimated to be 1500 Bq/m{sup 3}.

  16. Change of iron species and iron solubility in Asian dust during the long-range transport from western China to Japan

    Directory of Open Access Journals (Sweden)

    Y. Takahashi

    2011-11-01

    Full Text Available In the North Pacific, transport and deposition of mineral dust from Asia appear to be one of major sources of iron which can regulate growth of phytoplankton in the ocean. In this process, it is essential to identify chemical species of iron contained in Asian dust, because bioavailability of iron in the ocean is strongly influenced by the solubility of iron, which in turn is dependent on iron species in the dust. Here, we report that clay minerals (illite and chlorite in the dusts near the source collected at Aksu (western China can be transformed into ferrihydrite by atmospheric chemical processes during their long-range transport to eastern China (Qingdao and Japan (Tsukuba based on the speciation by X-ray absorption fine structure (XAFS and other methods such as X-ray diffraction and chemical extraction. As a result, Fe molar ratio in Aksu (illite : chlorite : ferrihydrite = 70 : 25 : 5 was changed to that in Tsukuba (illite : chlorite : ferrihydrite = 65 : 10 : 25. Moreover, leaching experiments were conducted to study the change of iron solubility. It was found that the iron solubility for the dust in Tsukuba (soluble iron fraction: 11.8 % and 1.10 % for synthetic rain water and seawater, respectively was larger than that in Aksu (4.1 % and 0.28 %, respectively, showing that iron in the dust after the transport becomes more soluble possibly due to the formation of ferrihydrite in the atmosphere. Our findings suggested that secondary formation of ferrihydrite during the transport should be considered as one of important processes in evaluating the supply of soluble iron to seawater.

  17. Medical set-up of boron neutron capture therapy (BNCT) for malignant glioma at the Japan research reactor (JRR)-4

    International Nuclear Information System (INIS)

    Yamamoto, T.; Matsumura, A.; Nose, T.; Shibata, Y.; Nakai, K.; Sakurai, F.; Kishi, T.; Kumada, H.; Yamamoto, K.; Torii, Y.

    2001-01-01

    The University of Tsukuba project for boron neutron capture therapy (BNCT) was initiated at the Japan Atomic Energy Research Institute (JAERI) in 1992. The clinical study for BNCT began at the Japan Research Reactor (JRR)-2 of the JAERI in November 1995. By the end of 1998, a new medical irradiation facility had been installed in JRR-4 of that included a new medical treatment room and patient-monitoring area adjacent to the irradiation room. The medical treatment room was built to reflect a hospital-type operation room that includes an operating table with a carbon head frame, anesthesia apparatus with several cardiopulmonary monitors, etc. Following craniotomy in the treatment room, a patient under anesthesia is transported into the irradiation room for BNCT. The boron concentration in tissue is measured with prompt gamma ray analysis (PGA) and simultaneously by inductively coupled plasma atomic emission spectroscopy (ICP-AES) methods. For the immediate pre- and post-BNCT care, a collaborating neurosurgical department of the University of Tsukuba was prepared in the vicinity of the JAERI. The long term follow-up is done at the University of Tsukuba Hospital. Epithermal neutron beam also became available at the new JRR-4. By changing the thickness and/or the configuration of heavy water, a cadmium plate, and a graphite reflector, the JRR-4 provides a variety of neutron beams, including three typical beams (Epithermal mode and Thermal modes I and II). Intraoperative BNCT using the thermal beam is planned to study at the beginning of the clinical trial. The ongoing development of the JAERI Computational Dosimetry System (JCDS) and radiobiological studies have focused in the application of the epithermal beam for BNCT. After obtaining these basic data, we are planning to use the epithermal beam for intraoperative BNCT. (author)

  18. Recent trends of plutonium deposition observed in Japan: comparison with naturallithogenic radionuclides, thorium isotopes

    International Nuclear Information System (INIS)

    Hirose, K.; Igarashi, Y.; Aoyama, M.

    2005-01-01

    Plutonium in monthly deposition samples from 2000 to end of 2003 collected to Tsukuba (the Meteorological Research Institute), Japan is reported, together with monthly thorium deposition. The annual deposition of 239,240 Pri during the past 18 years. ranged from 1.7 to 7.8 mBq m -2 y -1 shows no systematic inter-annual variation. However, a maximum annual 239,240 Pu deposition (7.8 mBq m -2 y -1 ) was observed in 2002. On the other hand, monthly 239,240 Pu depositions show a typical seasonal variation with a maximum in spring season (March to April), which corresponds to the seasonal cycle of generation of dust storms in the East Asian arid area. Thorium, which is a typical lithogenic radionuclide, reflects soil-derived particles in the atmospheric dust. The monthly Th deposition showed a typical seasonal trend with a maximum in spring and minimum in summer. The 230 Th/ 232 Th activity ratios in the deposition samples significantly differed from that in surface soils collected in Tsukuba area, which means that a significant part of thorium in deposition samples is not derived from suspension of local soil particles. The result reveals that the resent 239,240 Pu deposition observed in Japan are attributed to resuspension of deposited plutonium; resuspended plutonium originates from the East Asian continent desert and arid areas. These findings suggest that a significant amount of soil dust observed in Tsukuba is attributable to the long-range transport of continental dust from the East Asian arid areas. Plutonium in deposition samples as does thorium would become a proxy of the environmental change in the Asian continent.

  19. The solar UV exposure time required for vitamin D3 synthesis in the human body estimated by numerical simulation and observation in Japan

    Science.gov (United States)

    Nakajima, Hideaki; Miyauchi, Masaatsu; Hirai, Chizuko

    2013-04-01

    After the discovery of Antarctic ozone hole, the negative effect of exposure of human body to harmful solar ultraviolet (UV) radiation is widely known. However, there is positive effect of exposure to UV radiation, i.e., vitamin D synthesis. Although the importance of solar UV radiation for vitamin D3 synthesis in the human body is well known, the solar exposure time required to prevent vitamin D deficiency has not been well determined. This study attempted to identify the time of solar exposure required for vitamin D3 synthesis in the body by season, time of day, and geographic location (Sapporo, Tsukuba, and Naha, in Japan) using both numerical simulations and observations. According to the numerical simulation for Tsukuba at noon in July under a cloudless sky, 2.3 min of solar exposure are required to produce 5.5 μg vitamin D3 per 600 cm2 skin. This quantity of vitamin D represents the recommended intake for an adult by the Ministry of Health, Labour and Welfare, and the 2010 Japanese Dietary Reference Intakes (DRIs). In contrast, it took 49.5 min to produce the same amount of vitamin D3 at Sapporo in the northern part of Japan in December, at noon under a cloudless sky. The necessary exposure time varied considerably with the time of the day. For Tsukuba at noon in December, 14.5 min were required, but at 09:00 68.7 min were required and at 15:00 175.8 min were required for the same meteorological conditions. Naha receives high levels of UV radiation allowing vitamin D3 synthesis almost throughout the year. According to our results, we are further developing an index to quantify the necessary time of UV radiation exposure to produce required amount of vitamin D3 from a UV radiation data.

  20. 2014 Defects in Semiconductors Gordon Research Conference & Gordon Research Seminar. Research Area 1: Materials Science, 1.3 Physical Properties of Materials

    Science.gov (United States)

    2014-08-01

    invite leading experts from the full range of industry to academia to cover the topics of wide bandgap nitride and oxide semiconductors , the...Tsukuba University) " Positron Annihilation Studies in InGaN" 12:10 pm - 12:30 pm Discussion 9 12:30 pm Lunch 1:30 pm - 4:00 pm Free Time 4:00 pm...SECURITY CLASSIFICATION OF: The Gordon Research Conference on DEFECTS IN SEMICONDUCTORS was held at Bentley University in Waltham, Massachusetts