18 Ka BP records of climatic changes, Bay of Bengal: Isotopic and sedimentological evidences
Digital Repository Service at National Institute of Oceanography (India)
Chauhan, O.S.; Suneethi, J.
are also identified at 10.3 and 11.5 Ka BP. The later event matches well with that of the ‘Younger Dryas’ event of world climate models. The beginning of the Holocene is marked by lighter d18O values (at around 9.5 Ka BP), which has been interpreted...
The paleoclimatic events and cause in the Okinawa Trough during 50 kaBP
Institute of Scientific and Technical Information of China (English)
无
2001-01-01
Planktonic foraminiferal d18O record for core DGKS9603 from the Okinawa Trough shows a series of climatic fluctuations and sudden cooling events in short time scale during 50 kaBP, which appear to correlate closely to the Younger Dryas and Heinrich events H1-5 recorded in Chine-se loess, the South China Sea, the North Atlantic cores and the Greenland ice cores. Three polarity reversal events, cor-relating to Gothenburg, Mungo and Laschamp events, ap-proximately correspond to Heinrich events H1, H3 and H5 respectively, which could be a cause of global climate changes. The d18O curve of the Okinawa Trough is well asso-ciated with the grain size record of the Lijiayuan loess profile in northwestern China and is somewhat different from the climate fluctuations documented in the Greenland ice cores. These correlation results indicate that regional factors play an important role in controlling the climate changes in the East Asia, and the East Asian Monsoon could be the promi-nent regional controlling factor.
Hagstrum, J. T.; Firestone, R. B.; West, A.
2009-12-01
Studies of Late Pleistocene megafaunal fossils and their ancient DNA from Beringia (eastern Siberia, Alaska, and the emerged Bering Strait) indicate sharp declines in steppe bison population diversity and horse body size, extinction of the Alaskan wild ass, and local extinctions of brown bear and woolly mammoth genetic lines beginning at about 37 ka B.P. Beringia is also well known for its remarkably preserved Late Pleistocene frozen animal mummies. 14C ages of these mummies are bimodally distributed, having peaks coincident with the earlier ~37 ka B.P., and ~13 ka B.P. Younger Dryas, onset extinction events. Associated with the ~37 ka B.P. event are, for example, the Berezovka mammoth, headless Selerikan horse, steppe bison “Blue Babe”, and baby mammoths “Dima” and “Lyuba”. Analyses of these and other mummies indicate that they died instantly, in mostly healthy condition, with gut contents and high fat reserves indicative of a late summer to autumn season. An assortment of uneaten limbs and other body parts from a variety of species have also been found. Uniformitarian death scenarios inadequately account for the lack of evidence of normal predation and scavenging. Extensive internal injuries (e.g. large bone fractures, hemorrhaging) and apparent rapid burial of the mummies also indicate that something truly unusual happened at the time of these extinction events. We have discovered what appear to be micrometeorites embedded in seven Alaskan mammoth tusks and a Siberian bison skull acquired from commercial sources. 14C ages for five of these fossils have a weighted mean age of 33 ± 2 ka B.P. Laser ablation ICP-MS and XRF analyses of the particles indicate high Fe contents with compositions enriched in Ni and depleted in Ti, similar to Fe meteorites and unlike any natural terrestrial sources. Microprobe analyses of a Fe-Ni sulfide grain from tusk 2 also show that it contains between 3 and 20 weight percent Ni. SEM images and XRF analyses of a bison
Zhang, Wenchao; Yan, Hong; Dodson, John; Cheng, Peng; Liu, Chengcheng; Li, Jianyong; Lu, Fengyan; Zhou, Weijian; An, Zhisheng
2018-04-01
Numerous Holocene paleo-proxy records exhibit a series of centennial-millennial scale rapid climatic events. Unlike the widely acknowledged 8.2 ka climate anomaly, the likelihood of a significant climate excursion at around 9.2 cal ka BP, which has been notably recognized in some studies, remains to be fully clarified in terms of its magnitude and intensity, as well as its characteristics and spatial distributions in a range of paleoclimatic records. In this study, a peat sediment profile from the Dajiuhu Basin in central China was collected with several geochemical proxies and a pollen analysis carried out to help improve understanding of the climate changes around 9.2 cal ka BP. The results show that the peat development was interrupted abruptly at around 9.2 cal ka BP, when the chemical weathering strength decreased and the tree-pollen declined. This suggests that a strong drier regional climatic event occurred at around 9.2 cal ka BP in central China, which was, in turn, probably connected to the rapid 9.2 ka climate event co-developing worldwide. In addition, based on the synthesis of our peat records and the other Holocene hydrological records from Asian summer monsoon (ASM) region, we further found that the 9.2 ka event probably constituted the strongest abrupt collapse of the Asian monsoon system during the full Holocene interval. The correlations between ASM and the atmospheric 14C production rate, the North Atlantic drift ice records and Greenland temperature indicated that the weakened ASM event at around 9.2 cal ka BP could be interpreted by the co-influence of external and internal factors, related to the changes of the solar activity and the Atlantic Meridional Overturning Circulation (AMOC).
DEFF Research Database (Denmark)
Hede, Mikkel Ulfeldt; Rasmussen, Peter; Noe-Nygaard, Nanna
2010-01-01
ecosystems to the 8.2 ka cold event. A reduced pollen production by thermophilous deciduous tree taxa in the period c. 8250–8000 cal yr BP reveal that the forest ecosystem was affected by low temperatures during the summer and winter/early-spring seasons. This finding is consistent with the timing of the 8.......2 ka cold event as registered in the Greenland ice cores. At Højby Sø, the climate anomaly appears to have started 200–250 yr earlier than the 8.2 ka cold event as the lake proxy data provide strong evidence for a precipitation-induced distinct increase in catchment soil erosion beginning around 8500...... cal yr BP. Alteration of the terrestrial environment then resulted in a major aquatic ecosystem change with nutrient enrichment of the lake and enhanced productivity, which lasted until c. 7900 cal yr BP. Keywords: 8.2 ka cold event; Lake sediments; Palaeoclimate; Pollen; Macrofossils; Geochemistry...
Directory of Open Access Journals (Sweden)
K. Seelos
2010-03-01
Full Text Available A high resolution continuous reconstruction of last glacial wind directions is based on provenance analysis of eolian sediments in a sediment core from the Dehner dry Maar in the Eifel region (Germany. This Maar is suitable to archive easterly wind directions due to its location west of the Devonian carbonate basins of the Eifel-North-South-Zone. Thus, eolian sediments with high clastic carbonate content can be interpreted as an east wind signal. The detection of such east wind sediments is applied by a new module of the RADIUS grain size analyze technique. The investigated time period from 40.3–12.9 ka BP can be subclassified in three units: The first unit covers the periods of the ending GIS-9, H4, and GIS-8. With the exception of H4 (40–38 ka BP the content of organics in our record is relatively high. With the end of GIS-8 (38–36.5 ka the content of organics decrease and the content of dust increases rapidly. The second time slice (36–24 ka BP has an increased content of dust accumulation and a high amount of east winds layers (up to 19% of the dust storms per century came from the east. In comparison, the subsequent period (24–12.9 ka BP is characterized by lower east wind sediments again. Increased frequencies of east wind occur during the time intervals corresponding with the Heinrich events H1 and H2. The unusual H3 show no higher east wind frequency but so do its former and subsequent Greenland stadials. The late LGM (21–18 ka BP is characterized by a slightly elevated east wind frequency again.
Energy Technology Data Exchange (ETDEWEB)
Wiersma, A.P.; Renssen, H. [Vrije Universiteit Amsterdam, Faculty of Earth and Life Sciences, Amsterdam (Netherlands); Goosse, H.; Fichefet, T. [Universite Catholique de Louvain, Institut d' Astronomie et de Geophysique George Lemaitre, Louvain-la-Neuve (Belgium)
2006-12-15
To improve our understanding of the mechanism causing the 8.2 ka BP event, we investigated the response of ocean circulation in the ECBilt-CLIO-VECODE (Version 3) model to various freshwater fluxes into the Labrador Sea. Starting from an early Holocene climate state we released freshwater pulses varying in volume and duration based on published estimates. In addition we tested the effect of a baseline flow (0.172 Sv) in the Labrador Sea to account for the background-melting of the Laurentide ice-sheet on the early Holocene climate and on the response of the overturning circulation. Our results imply that the amount of freshwater released is the decisive factor in the response of the ocean, while the release duration only plays a minor role, at least when considering the short release durations (1, 2 and 5 years) of the applied freshwater pulses. Furthermore, the experiments with a baseline flow produce a more realistic early Holocene climate state without Labrador Sea Water formation. Meltwater pulses introduced into this climate state produce a prolonged weakening of the overturning circulation compared to an early Holocene climate without baseline flow, and therefore less freshwater is needed to produce an event of similar duration. (orig.)
A 230 ka record of glacial and interglacial events from Aurora Cave, Fiordland, New Zealand
International Nuclear Information System (INIS)
Williams, P.W.
1996-01-01
Caves overrun by glaciers are known to accumulate dateable evidence of past glacial and interglacial events. Results are reported from an investigation of Aurora Cave on the slopes above Lake Te Anau in Fiordland. The cave commenced to form before c. 230 ka B.P. Sequences of glaciofluvial sediments interbedded with speleothems are evidence of the number and timing of glacial advances and the status of intervals between them. Twenty-six uranium series dates on speleothems underpin a chronology of seven glacial advances in the last 230 ka, with the peak of the late Otira glaciation, Aurora 3 advance, at c. 19 ka B.P. With five advances in the Otiran, the last glaciation is more complex than previously recognised. Comparison of the record with that recorded offshore from DSDP Site 594 reveals little matching, but the correspondence of the Aurora sequence with that interpreted from other onshore deposits is more convincing. Glacial deposits on slopes above the cave for a further 660 m may be evidence of the 'missing' glacial events of the mid-early Pleistocene. (author). 44 refs., 12 figs., 5 tabs
Railsback, L. Bruce; Liang, Fuyuan; Brook, G. A.; Voarintsoa, Ny Riavo G.; Sletten, Hillary R.; Marais, Eugene; Hardt, Ben; Cheng, Hai; Edwards, R. Lawrence
2018-04-01
The climatic event between 4.2 and 3.9 ka BP known as the "4.2 ka event" is commonly considered to be a synchronous global drought that happened as one pulse. However, careful comparison of records from around the world shows that synchrony is possible only if the published chronologies of the various records are shifted to the extent allowed by the uncertainties of their age data, that several records suggest a two-pulsed event, and that some records suggest a wet rather than dry event. The radiometric ages constraining those records have uncertainties of several decades if not hundreds of years, and in some records the event is represented by only one or two analyses. This paper reports a new record from Stalagmite DP1 from northeastern Namibia in which high 230Th/232Th activity ratios allow small age uncertainties ranging between only 10-28 years, and the event is documented by more than 35 isotopic analyses and by petrographic observation of a surface of dissolution. The ages from Stalagmite DP1 combine with results from 11 other records from around the world to suggest an event centered at about 4.07 ka BP with bracketing ages of 4.15 to 3.93 ka BP. The isotopic and petrographic results suggest a two-pulsed wet event in northeastern Namibia, which is in the Southern Hemisphere's summer rainfall zone where more rain presumably fell with southward migration of the Inter-Tropical Convergence Zone as the result of cooling in the Northern Hemisphere. Comparison with other records from outside the region of dryness from the Mediterranean to eastern Asia suggests that multiple climatic zones similarly moved southward during the event, in some cases bringing wetter conditions that contradict the notion of global drought.
Bergadà, M. Mercè; Cervelló, Josep M.; Edo, Manel; Cebrià, Artur; Oms, F. Xavier; Martínez, Pablo; Antolín, Ferran; Morales, Juan Ignacio; Pedro, Mireia
2018-03-01
The stratigraphic, sedimentary and palaeoenvironmental features reflected in cavities in the Catalan Coastal Ranges of NE Iberia (Can Sadurní and Guineu caves) characterize the periods of pronounced climatic and human complexity that occurred c. 13.0-6.0 cal ka BP. This includes the stages of the Younger Dryas and Mid/Early Holocene, the latter being one of the periods of so-called Rapid Climatic Changes (RCCs). These caves, like others in Mediterranean contexts, are the result of an old duct originating in the saturated zone of the karst system and open to the outside; recording a succession of different detrital and anthropic episodes of the Epipaleolithic, Mesolithic and Neolithic communities. From this study it can be seen that paleoclimatic events do not always present clear signals in the karst records, especially c. 12.7-7.4 cal ka BP, corresponding to the Epipaleolithic and Mesolithic. It is characterized by a stratigraphic discontinuity in which there are phases with predominantly detrital sedimentation alternating with hiatus intervals. Detrital sedimentation formed by fine material colluvium with gravitational movements or solifluction processes in fresh and humid conditions. It appears in the following chronological intervals: 12.7-12.2 cal ka BP, 11.5/11.1-10.7/10.4 cal ka BP and 8.2-8.0 cal ka BP (less humid). Hiatus phases are represented in the rest of the sequence up to c. 7.4 cal ka BP. From the sedimentary point of view these stages of hiatus are indicative of phases of stability or lack of episodes with seasonal contrasts; a fact that would cause interruptions to detrital deposition in the interior of the caves. In contrast, in the period c. 7.4 to 6.0 cal ka BP, attributed to the Middle and Early Neolithic, there is a certain stratigraphic continuity. From the sedimentary point of view it is distinguished by a variability of processes that responds to accumulative episodes of short duration characteristic of morphogenesis of the slopes in an
Roverato, M.; Capra, L.
2010-12-01
Colima volcano is an andesitic stratovolcano located in the western part of the Trans-Mexican Volcanic Belt (TMVB) and at the southern end of the N-S trending Colima graben, about 70 km from the Pacific Ocean coast. It is probably the most active Mexican volcano in historic time and one of the most active of North America. Colima volcano yielded numerous partial edifice collapses with emplacement of debris avalanche deposits (DADs) of contrasting volume, morphology, texture and origin. This work has the aim to provide the evidences of how the climatic condition during the 13 ka flank collapse of the Colima volcano affected the textural characteristic and the mobility of the debris avalanche and debris flow originated from this event that occurred just after the Last Glacial Maximum in Mexico (18.4-14.5 ka 14C BP with snow line at 3600 m a.s.l. up to 13 ka BP). The 13,000 yrs old debris avalanche deposit, here named Tonila (TDAD) presents the typical debris avalanche textural characteristics (angular to sub-angular clasts, coarse matrix, jigsaw fit) but at approximately 13 km from the source, the deposit transforms to an hybrid phase with debris avalanche fragments imbedded in a finer, homogenous and indurated matrix more similar to a debris flow deposit. The debris avalanche deposit is directly overly by debris flows, often more than 10 m thick that contains large amount of logs from pine tree, mostly accumulated toward the base and imbricated down flow. Fluvial deposits also occur throughout all successions, representing periods of stream and river reworking highly localized and re-establishment. All these evidences point to the presence of water in the mass previous to the failure. The event here described represent an anomalous event between the previously described deposit associated to volcanic complex, and evidence as climatic condition can alter and modifies the depositional sequences incrementing the hazard.
Digital Repository Service at National Institute of Oceanography (India)
Sijinkumar, A.V.; Nath, B.N.; Possnert, G.; Aldahan, A.
abundance, and which matches well with the Pacific records influenced by the Kuroshio Current. Additionally, two significant minimum events of P. obliquiloculata are also seen during the Younger Dryas (YD) and late Last Glacial Maximum (LGM, 20-18 cal ka... (LGM, 20-18 cal ka BP, Younger Dryas (YD, 13-10.5 cal ka BP) and late Holocene (4.5-3 cal ka BP). Northern core SK 168 shows distinctive minimum events and the intensity of variation reduces towards the south. The Holocene PME is a little longer...
Niedermeyer, E. M.; Mulch, A.; Pross, J.
2017-12-01
The "8.2 ka event" has been an abrupt and prominent climate perturbation during the Holocene, and is characterized by an episode of generally colder and dryer conditions in the Northern Hemisphere realm. However, evidence to what extent this event has had an impact on climate in the Mediterranean region is ambiguous, in particular with respect to rainfall, temperature and vegetation change on land. Here we present a new, high-resolution record (ø 15 years during the event) of paleotemperatures from the Tenaghi Philippon peat deposit, Eastern Macedonia, Greece, using the MBT'/CBT index based on brGDGTs (branched Glycerol-Dialkyl-Glycerol-Tetraethers). Our data show fairly stable temperatures before the event, which is initiated at 8.1 ka by an abrupt and continuous cooling during the first 35 years of the event. After a short, 10-year episode of minimum temperatures, the event is ended by a similarly abrupt and continuous warming within 38 years. Comparison of our record with a previous study of the stable hydrogen isotopic composition of higher-plant waxes (δDwax) on the same core1 shows that changes in temperature occurred simultaneously with shifts in atmospherics moisture sources (Mediterranean vs Atlantic). Interestingly, further comparison of our data with a previous palynological study of the same core2 reveals that changes in vegetation associated with the 8.2 ka event precede shifts in hydrology and temperature by 100 years. This suggests either pronounced changes in seasonality of temperature and rainfall after the onset of the 8.2 ka event, i.e. at the peak of the event, or that changes in local atmospheric circulation (moisture sources) and temperature where not the initial trigger of changes in vegetation. References: Pross, J., Kotthoff, U., Müller, U.C., Peyron, O., Dormoy, I., Schmiedl, G., Kalaitzidis, S. and Smith, A.M. (2009): Massive perturbation in terrestrial ecosystems of the Eastern Mediterranean region associated with the 8.2 kyr B.P
Institute of Scientific and Technical Information of China (English)
侯献华; 郑绵平; 杨振京; 杨庆华; 毕志伟
2011-01-01
This paper obtained the data of the cores based on U-series age from ZK02 borehole at ridge of Dalangtan in the western Qaidam basin, where 34 samples from the sludge containing gypsum silt were selected of select for 130 ka BP (90.5 m and above) and the pollen analysis was done. Based on the pollen characteristics, the assemblage of the pollen from the bottom upwards can be divided into six zones to analyze the ancient vegetation succession in the last interglacial (130 ka BP) state in this area. The results showed as follows: in the period of 130 ka BP (the last interglacial period), the vegetation in the western Qaidam basin obviously changed compared with the very significant environment. Overall, the spruce, fir and pine trees consisted of some cold temperate coniferous forest had expanded for five times to the surrounded Zhongshan area, and even extends towards the basin. But thegrass of Gramineae, Compositae, Artemisia as the main component occupied the basin, which showed the climate that was mild climate controlled by the summer monsoon flow from the East Asia to the West, while vegetation flourished, the enhanced soil expanded, water being desalinized, the lake larger in the interstadial period, particularly that in the first pollen assemblage I ( 130 -92 ka BP) and the pollen assemblage IV (56.2 -49 ka BP) in the duration of sedimentation when the plant diversity increased. In addition to the grassland vegetation in the basin, on the wetlands around the lake the plant was growing quite flonrishing, which demonstrated that the two periods were the most enhanced summer monsoon circulation with more adequate rainfall and the forest expanding fast in the mountains. The river flow was incresing and salt lake became desaltinized. The emergent grasses were growing at the edge of the marsh in the lake area. In particular in 49 ka BP ago or so, coniferous forest was growing associated with mountain cedar. Thus it suggested that the place was affected by the
A role for icebergs in the 8.2 ka climate event
Wiersma, A.P.; Jongma, J.I.
2009-01-01
We investigate the potential role of icebergs in the 8.2 ka climate event, using a coupled climate model equipped with an iceberg component. First, we evaluate the effect of a large iceberg discharge originating from the decaying Laurentide ice sheet on ocean circulation, compared to a release of an
Tegzes, A. D.; Jansen, E.; Telford, R. J.
2014-02-01
The so-called "8.2 ka Event" has been widely regarded as a major climate perturbation over the Holocene. It is most readily identifiable in the oxygen-isotope records from Greenland ice cores as an approximately 160 yr-long cold interval between 8250-8090 yr BP. The prevailing view has been that the cooling over Greenland, and potentially over the northern North Atlantic at least, was triggered by the catastrophic final drainage of the Agassiz-Ojibway proglacial lake as part of the remnant Laurentide Ice Sheet collapsed over Hudson Bay at around 8420 ± 80 yr BP. The consequent freshening of surface waters in the northern North Atlantic Ocean and the Nordic Seas resulted in weaker overturning, hence reduced northward heat transport. Here we present proxy records from site JM97-MD95-2011 on the mid-Norwegian Margin indicating a (sharp) decline in the strength of the eastern branch of the Atlantic Inflow into the Nordic Seas immediately following a uniquely large drop in (sub)surface ocean temperatures coeval with the lake outbursts. We propose that the final drainage of Lake Agassiz-Ojibway was accompanied by a major iceberg discharge from Hudson Bay, which resulted in the cooling of the northward-directed northern Gulf Stream-North Atlantic Drift-Norwegian Atlantic Current system. Since our current-strength proxy records from the mid-Norwegian Margin do not evidence an exceptionally strong reduction in the main branch of the Atlantic Inflow into the Nordic Seas at the time, we argue that a chilled northward-directed (sub)surface-current system and an already colder background climate state could be the main factors responsible for the 8.2 ka climate perturbation.
Response of benthic foraminifera to 4.2 ka cooling event in the Nakdong River delta, southeast Korea
Takata, H.; Khim, B. K.; Cheong, D.; Shin, S.
2016-02-01
Here we report the change of benthic foraminifera in response to 4.2 ka cooling event in the Nakdong River delta (southeastern Korea). It has been known that this cooling event caused climatic deteriorations in the world, which is closely related to the decline/development of the civilizations (e.g., Kawahata et al., 2009). This event was also correlated to one of Bond Events in the North Atlantic. Because coastal sediment depositions have been influenced by both oceanographic and terrestrial climatic changes, the study may provide us clue to understand the possible teleconnection of the cooling event between the North Atlantic and the East Asian margin. We investigated fossil benthic foraminiferal faunas and planktonic/total foraminiferal ratio (P/T ratio) at two borehole cores, ND-01 and ND-02 (landward and seaward sites, respectively). Common constituents are taxa from bay to shelf environments in the East Asian margin. Biotic response of benthic foraminifera partly changed after 4.2 ka showing that Haynesina sp. A (opportunistic species?) decreased significantly at core ND-01. In addition, P/T ratio at both core sites showed temporal decline at 4.2 ka. This suggests the decreasing influence of the seawater relative to the coastal water. Holocene fluctuations of the Tsushima Warm Current, a branch of Kuroshio, flowing off the Nakdong River delta, have been documented. The decline pattern of P/T ratio in this area is similar to that of total sulfur content in Lake Tougou-ike, southwestern Japan at 4 ka which was interpreted as the influence of the small sea-level falling (Kato et al., 2003). According to the similar stratigraphic variation patterns between our and their studies, our finding suggests that this event was not regional but related to the fluctuations of the Tsushima Warm Current. Thus, biotic response of benthic foraminifera in the Nakdong River delta recorded 4.2 ka cooling event related to temporal weakening of the Tsushima Warm Current.
DEFF Research Database (Denmark)
Schwab, C.; Kinkel, Hanno; Weinelt, M.
2013-01-01
in coccolithophore assemblages and changes in the abundance of siliceous plankton (diatoms) indicate a southward shift of the Azores Front (AzF), and hence a southward retreat of the North Atlantic subtropical gyre, as well as an increased productivity, during glacial Marine Isotope Stage (MIS) 4, Termination II...... and during cold substages of MIS 5. Furthermore we hypothesize that the ecological changes led to distinct evolutionary patterns of coccolithophores, resulting e.g. in a dominance of Gephyrocapsa ornata between 76 and 105ka BP. Additionally, high-resolution analysis of MIS 5e indicate a short reversal...... towards cool conditions during MIS 5e, corresponding to a basin-wide cooling event. Full interglacial conditions are reached only late in the Azores region. During MIS 5e an increased advection of Subantarctic Mode Water (SAMW), and/or the possibility to occupy new habitats after glacial conditions...
Molecular Paleoclimate Reconstructions over the Last 9 ka from a Peat Sequence in South China
Wang, Xinxin; Huang, Xianyu; Sachse, Dirk; Ding, Weihua; Xue, Jiantao
2016-01-01
To achieve a better understanding of Holocene climate change in the monsoon regions of China, we investigated the molecular distributions and carbon and hydrogen isotope compositions (δ13C and δD values) of long-chain n-alkanes in a peat core from the Shiwangutian (SWGT) peatland, south China over the last 9 ka. By comparisons with other climate records, we found that the δ13C values of the long-chain n-alkanes can be a proxy for humidity, while the δD values of the long-chain n-alkanes primarily recorded the moisture source δD signal during 9–1.8 ka BP and responded to the dry climate during 1.8–0.3 ka BP. Together with the average chain length (ACL) and the carbon preference index (CPI) data, the climate evolution over last 9 ka in the SWGT peatland can be divided into three stages. During the first stage (9–5 ka BP), the δ13C values were depleted and CPI and Paq values were low, while ACL values were high. They reveal a period of warm and wet climate, which is regarded as the Holocene optimum. The second stage (5–1.8 ka BP) witnessed a shift to relatively cool and dry climate, as indicated by the more positive δ13C values and lower ACL values. During the third stage (1.8–0.3 ka BP), the δ13C, δD, CPI and Paq values showed marked increase and ACL values varied greatly, implying an abrupt change to cold and dry conditions. This climate pattern corresponds to the broad decline in Asian monsoon intensity through the latter part of the Holocene. Our results do not support a later Holocene optimum in south China as suggested by previous studies. PMID:27505008
Molecular Paleoclimate Reconstructions over the Last 9 ka from a Peat Sequence in South China.
Directory of Open Access Journals (Sweden)
Xinxin Wang
Full Text Available To achieve a better understanding of Holocene climate change in the monsoon regions of China, we investigated the molecular distributions and carbon and hydrogen isotope compositions (δ13C and δD values of long-chain n-alkanes in a peat core from the Shiwangutian (SWGT peatland, south China over the last 9 ka. By comparisons with other climate records, we found that the δ13C values of the long-chain n-alkanes can be a proxy for humidity, while the δD values of the long-chain n-alkanes primarily recorded the moisture source δD signal during 9-1.8 ka BP and responded to the dry climate during 1.8-0.3 ka BP. Together with the average chain length (ACL and the carbon preference index (CPI data, the climate evolution over last 9 ka in the SWGT peatland can be divided into three stages. During the first stage (9-5 ka BP, the δ13C values were depleted and CPI and Paq values were low, while ACL values were high. They reveal a period of warm and wet climate, which is regarded as the Holocene optimum. The second stage (5-1.8 ka BP witnessed a shift to relatively cool and dry climate, as indicated by the more positive δ13C values and lower ACL values. During the third stage (1.8-0.3 ka BP, the δ13C, δD, CPI and Paq values showed marked increase and ACL values varied greatly, implying an abrupt change to cold and dry conditions. This climate pattern corresponds to the broad decline in Asian monsoon intensity through the latter part of the Holocene. Our results do not support a later Holocene optimum in south China as suggested by previous studies.
PM : Cabinet likely to choose TNK-BP
2005-01-01
Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole
Reducing uncertainty in Climate Response Time Scale by Bayesian Analysis of the 8.2 ka event
Lorenz, A.; Held, H.; Bauer, E.; Schneider von Deimling, T.
2009-04-01
We analyze the possibility of uncertainty reduction in Climate Response Time Scale by utilizing Greenland ice-core data that contain the 8.2 ka event within a Bayesian model-data intercomparison with the Earth system model of intermediate complexity, CLIMBER-2.3. Within a stochastic version of the model it has been possible to mimic the 8.2 ka event within a plausible experimental setting and with relatively good accuracy considering the timing of the event in comparison to other modeling exercises [1]. The simulation of the centennial cold event is effectively determined by the oceanic cooling rate which depends largely on the ocean diffusivity described by diffusion coefficients of relatively wide uncertainty ranges. The idea now is to discriminate between the different values of diffusivities according to their likelihood to rightly represent the duration of the 8.2 ka event and thus to exploit the paleo data to constrain uncertainty in model parameters in analogue to [2]. Implementing this inverse Bayesian Analysis with this model the technical difficulty arises to establish the related likelihood numerically in addition to the uncertain model parameters: While mainstream uncertainty analyses can assume a quasi-Gaussian shape of likelihood, with weather fluctuating around a long term mean, the 8.2 ka event as a highly nonlinear effect precludes such an a priori assumption. As a result of this study [3] the Bayesian Analysis showed a reduction of uncertainty in vertical ocean diffusivity parameters of factor 2 compared to prior knowledge. This learning effect on the model parameters is propagated to other model outputs of interest; e.g. the inverse ocean heat capacity, which is important for the dominant time scale of climate response to anthropogenic forcing which, in combination with climate sensitivity, strongly influences the climate systems reaction for the near- and medium-term future. 1 References [1] E. Bauer, A. Ganopolski, M. Montoya: Simulation of the
Cabinet chooses TNK-BP, but doors remain open
2005-01-01
Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega
Wang, J.; Ma, Q.; Huang, L.; Ju, J.; Guo, Y.; Lin, X.; Li, Y.; Zhu, L.
2017-12-01
event occurred at 11.8 cal ka BP. During the Holocene, carbonate dissolution was identified at 9.76 to 3.44 cal ka BP which indicated a high moisture availability hence high lake level even the lake became an open system. More detailed results and comparison with other studies are still in progress to have an insight into the record and its possible controlling mechanism.
Directory of Open Access Journals (Sweden)
D.-D. Rousseau
2013-09-01
Full Text Available At present, major dust storms are occurring at mid-latitudes in the Middle East and Asia, as well as at low latitudes in Northern Africa and in Australia. Western Europe, though, does not experience such dramatic climate events, except for some African dust reaching it from the Sahara. This modern situation is of particular interest, in the context of future climate projections, since the present interglacial is usually interpreted, in this context, as an analog of the warm Eemian interval. European terrestrial records show, however, major dust events during the penultimate interglacial and early glacial. These events are easily observed in loess records by their whitish-color deposits, which lie above and below dark chernozem paleosols in Central European records of Marine Isotope Stage (MIS 5 age. We describe here the base of the Dolni Vestonice (DV loess sequence, Czech Republic, as the reference of such records. The dust is deposited during intervals that are characterized by poor vegetation – manifested by high δ13C values and low magnetic susceptibility – while the fine sand and clay in the deposits shows grain sizes that are clearly different from the overlying pleniglacial loess deposits. Some of these dust events have been previously described as "Markers" or Marker Silts (MS by one of us (G. Kukla, and are dated at about 111–109 ka and 93–92 ka, with a third and last one slightly visible at about 75–73 ka. Other events correspond to the loess material of Kukla's cycles, and are described as eolian silts (ES; they are observed in the same DV sequence and are dated at about 106–105 ka, 88–86 ka, and 78.5–77 ka. These dates are determined by considering the OSL ages with their errors measured on the studied sequence, and the comparison with Greenland ice-core and European speleothem chronologies. The fine eolian deposits mentioned above, MS as well as ES, correspond to short events that lasted about 2 ka; they are
Institute of Scientific and Technical Information of China (English)
LI Tiegang; XIANG Rong; SUN Rongtao; CAO Qiyuan
2005-01-01
A piston sediment core E017 from the middle-southern Okinawa Trough was investigated. A preliminary study of the deep-water evolution since 18 cal. ka BP was performed based on the quantitative census data of benthic foraminiferal fauna, together with planktonic foraminiferal oxygen and carbon isotope, AMS14C dating, and the previous results achieved in the southern Okinawa Trough. The result shows that the benthic fauna was dominated by Bulimina aculeata (d'Orbigny), Uvigerina peregrina (Cushman), Hispid Uvigerina and Uvigerina dirupta (Todd) during the glaciation-deglaciation before 9.2 cal. ka BP, while Epistominella exigua (Brady), Pullenia bulloides (d'Orbigny), Cibicidoides hyalina (Hofker), Sphaeroidina bulloides (d'Orbigny) and Globocassidulina subglobosa (Brady) predominated the fauna in the post-glacial period after 9.2 cal. ka BP. The benthic foraminifera accumulation rate (BFAR), paleoproductivity estimates and benthic foraminiferal assemblage conformably indicate that surface water paleoproductivity and organic matter flux during the glaciation-deglaciation were higher than those of the post-glacial period in the middle-southern Okinawa Trough, and gradually enhanced from the southern to the central Okinawa Trough during the glaciation-deglaciation, which could be caused by the discrepancy of the terrigenous nutrients supply. High abundances of E. exigua, an indicator of pulsed organic matter input, after 9.2 cal. ka BP may indicate that the intensity of seasonally riverine pulsed flux during the post-glacial period was stronger than that of the glaciation-deglaciation period, and the seasonal influx in the central trough might be stronger than in the south. The temporal distributions of the typical species indicating bottom water oxygen content and ventilation condition show that the ventilation of the bottom water during the post-glacial period is more active than the glaciation-deglaciation, which reflects that the evolution of the intermediate and
Barrell, David J. A.; Almond, Peter C.; Vandergoes, Marcus J.; Lowe, David J.; Newnham, Rewi M.
2013-08-01
Our review of paleoclimate information for New Zealand pertaining to the past 30,000 years has identified a general sequence of climatic events, spanning the onset of cold conditions marking the final phase of the Last Glaciation, through to the emergence to full interglacial conditions in the early Holocene. In order to facilitate more detailed assessments of climate variability and any leads or lags in the timing of climate changes across the region, a composite stratotype is proposed for New Zealand. The stratotype is based on terrestrial stratigraphic records and is intended to provide a standard reference for the intercomparison and evaluation of climate proxy records. We nominate a specific stratigraphic type record for each climatic event, using either natural exposure or drill core stratigraphic sections. Type records were selected on the basis of having very good numerical age control and a clear proxy record. In all cases the main proxy of the type record is subfossil pollen. The type record for the period from ca 30 to ca 18 calendar kiloyears BP (cal. ka BP) is designated in lake-bed sediments from a small morainic kettle lake (Galway tarn) in western South Island. The Galway tarn type record spans a period of full glacial conditions (Last Glacial Coldest Period, LGCP) within the Otira Glaciation, and includes three cold stadials separated by two cool interstadials. The type record for the emergence from glacial conditions following the termination of the Last Glaciation (post-Termination amelioration) is in a core of lake sediments from a maar (Pukaki volcanic crater) in Auckland, northern North Island, and spans from ca 18 to 15.64 ± 0.41 cal. ka BP. The type record for the Lateglacial period is an exposure of interbedded peat and mud at montane Kaipo bog, eastern North Island. In this high-resolution type record, an initial mild period was succeeded at 13.74 ± 0.13 cal. ka BP by a cooler period, which after 12.55 ± 0.14 cal. ka BP gave way to a
A 150-ka-long record for the volcano-tectonic deformation of Central Anatolian Volcanic Province
Karabacak, Volkan; Tonguç Uysal, I.; Ünal-İmer, Ezgi; Mutlu, Halim; Zhao, Jian-xin
2017-04-01
The Anatolian Block represents one of the most outstanding examples of intra-plate deformation related to continental collision. Deformation related to the convergence of the Afro-Arabian continent toward north gives rise to widespread and intense arc volcanism in the Central Anatolia. All the usual studies on dating the volcano-tectonic deformation of the region are performed entirely on volcanic events of the geological record resulted in eruptions. However, without volcanic eruption, magma migration and related fluid pressurization also generate crustal deformation. In the current study has been funded by the Scientific and Technological Research Council of Turkey with the project no. 115Y497, we focused on fracture systems and their carbonate veins around the Ihlara Valley (Cappadocia) surrounded by well-known volcanic centers with latest activities of the southern Central Anatolian Volcanic Province. We dated 37 samples using the Uranium-series technique and analyzed their isotope systematics from fissure veins, which are thought to be controlled by the young volcanism in the region. Our detailed fracture analyses in the field show that there is a regional dilatation as a result of a NW-SE striking extension which is consistent with the results of recent GPS studies. The Uranium-series results indicate that fracture development and associated carbonate vein deposition occurred in the last 150 ka. Carbon and oxygen isotope systematics have almost remained unchanged in the studied time interval. Although veins in the region were precipitated from fluids primarily of meteoric origin, fluids originating from water-rock interaction also contribute for the deposition of carbonate veins. The age distribution indicates that the crustal deformation intensified during 7 different period at about 4.7, 34, 44, 52, 83, 91, 149 ka BP. Four of these periods (4.7, 34, 91, 149 ka BP) correspond to the volcanic activities suggested in the previous studies. The three crustal
Ka-band InSAR Imaging and Analysis Based on IMU Data
Directory of Open Access Journals (Sweden)
Shi Jun
2014-02-01
Full Text Available Compared with other bands, the millimeter wave Interferometric Synthetic Aperture Radar (InSAR has high accuracy and small size, which is a hot topic in InSAR research. On the other hand, shorter wavelength causes difficulties in 2D imaging and interferometric phase extraction. In this study, the imaging and phase performance of the streaming Back Projection (BP method combined with IMU data are analyzed and discussed on the basis of actual Ka-band InSAR data. It is found that because the wavelength of the Ka-band is short, it is more sensitive to the antenna phase-center history. To ensure the phase-preserving capacity, the IMU data must be used with accurate motion error compensation. Furthermore, during data processing, we verify the flat-earth-removing capacity of the BP algorithm that calculates and compensates the master and slave antenna phase centers individually.
Late Quaternary glaciation history of monsoon-dominated Dingad basin, central Himalaya, India
Shukla, Tanuj; Mehta, Manish; Jaiswal, Manoj K.; Srivastava, Pradeep; Dobhal, D. P.; Nainwal, H. C.; Singh, Atul K.
2018-02-01
The study presents the Late Quaternary glaciation history of monsoon-dominated Dokriani Glacier valley, Dingad basin, central Himalaya, India. The basin is tested for the mechanism of landforms preservation in high relief and abundant precipitation regimes of the Higher Himalaya. Field geomorphology and remote sensing data, supported by Optical Stimulated Luminescence (OSL) dating enabled identification of five major glacial events of decreasing magnitude. The oldest glacial stage, Dokriani Glacial Stage I (DGS-I), extended down to ∼8 km (2883 m asl) from present-day snout (3965 m asl) followed by other four glaciations events viz. DGS-II, DGS-III, DGS-IV and DGS-V terminating at ∼3211, 3445, 3648 and ∼3733 m asl respectively. The DGS-I glaciation (∼25-∼22 ka BP) occurred during early Marine Isotope Stage (MIS) -2, characterized as Last Glacial Maximum (LGM) extension of the valley. Similarly, DGS-II stage (∼14-∼11 ka BP) represents the global cool and dry Older Dryas and Younger Dryas event glaciation. The DGS-III glaciation (∼8 ka BP) coincides with early Holocene 8.2 ka cooling event, the DGS-IV glaciations (∼4-3.7 ka BP) corresponds to 4.2 ka cool and drier event, DGS-V (∼2.7-∼1 ka BP) represents the cool and moist late Holocene glacial advancement of the valley. This study suggests that the Dokriani Glacier valley responded to the global lowering of temperature and variable precipitation conditions. This study also highlights the close correlation between the monsoon-dominated valley glaciations and Northern Hemisphere cooling events influenced by North Atlantic climate.
Wu, Jing; Liu, Qiang; Wang, Luo; Chu, Guo-qiang; Liu, Jia-qi
2016-01-01
The Great Khingan Mountain range, Northeast China, is located on the northern limit of modern East Asian Summer Monsoon (EASM) and thus highly sensitive to the extension of the EASM from glacial to interglacial modes. Here, we present a high-resolution pollen record covering the last glacial maximum and the early Holocene from a closed crater Lake Moon to reconstruct vegetation history during the glacial-interglacial transition and thus register the evolution of the EASM during the last deglaciation. The vegetation history has gone through distinct changes from subalpine meadow in the last glacial maximum to dry steppe dominated by Artemisia from 20.3 to 17.4 ka BP, subalpine meadow dominated by Cyperaceae and Artemisia between 17.4 and 14.4 ka BP, and forest steppe dominated by Betula and Artemisia after 14.4 ka BP. The pollen-based temperature index demonstrates a gradual warming trend started at around 20.3 ka BP with interruptions of several brief events. Two cold conditions occurred around at 17.2-16.6 ka BP and 12.8-11.8 ka BP, temporally correlating to the Henrich 1 and the Younger Dryas events respectively, 1and abrupt warming events occurred around at 14.4 ka BP and 11.8 ka BP, probably relevant to the beginning of the Bølling-Allerød stages and the Holocene. The pollen-based moisture proxy shows distinct drought condition during the last glacial maximum (20.3-18.0 ka BP) and the Younger Dryas. The climate history based on pollen record of Lake Moon suggests that the regional temperature variability was coherent with the classical climate in the North Atlantic, implying the dominance of the high latitude processes on the EASM evolution from the Last Glacial Maximum (LGM) to early Holocene. The local humidity variability was influenced by the EASM limitedly before the Bølling-Allerød warming, which is mainly controlled by the summer rainfall due to the EASM front covering the Northeast China after that.
Directory of Open Access Journals (Sweden)
Jing Wu
Full Text Available The Great Khingan Mountain range, Northeast China, is located on the northern limit of modern East Asian Summer Monsoon (EASM and thus highly sensitive to the extension of the EASM from glacial to interglacial modes. Here, we present a high-resolution pollen record covering the last glacial maximum and the early Holocene from a closed crater Lake Moon to reconstruct vegetation history during the glacial-interglacial transition and thus register the evolution of the EASM during the last deglaciation. The vegetation history has gone through distinct changes from subalpine meadow in the last glacial maximum to dry steppe dominated by Artemisia from 20.3 to 17.4 ka BP, subalpine meadow dominated by Cyperaceae and Artemisia between 17.4 and 14.4 ka BP, and forest steppe dominated by Betula and Artemisia after 14.4 ka BP. The pollen-based temperature index demonstrates a gradual warming trend started at around 20.3 ka BP with interruptions of several brief events. Two cold conditions occurred around at 17.2-16.6 ka BP and 12.8-11.8 ka BP, temporally correlating to the Henrich 1 and the Younger Dryas events respectively, 1and abrupt warming events occurred around at 14.4 ka BP and 11.8 ka BP, probably relevant to the beginning of the Bølling-Allerød stages and the Holocene. The pollen-based moisture proxy shows distinct drought condition during the last glacial maximum (20.3-18.0 ka BP and the Younger Dryas. The climate history based on pollen record of Lake Moon suggests that the regional temperature variability was coherent with the classical climate in the North Atlantic, implying the dominance of the high latitude processes on the EASM evolution from the Last Glacial Maximum (LGM to early Holocene. The local humidity variability was influenced by the EASM limitedly before the Bølling-Allerød warming, which is mainly controlled by the summer rainfall due to the EASM front covering the Northeast China after that.
A 130 ka reconstruction of rainfall on the Bolivian Altiplano
Placzek, C. J.; Quade, J.; Patchett, P. J.
2013-02-01
New efforts to link climate reconstructions from shoreline deposits and sediment cores yield an improved and more detailed lake history from the Bolivian Altiplano. On the Southern Altiplano, 10 lake oscillations have been identified from this new unified chronology, each coincident with North Atlantic cold events such as Heinrich Events H5, H2, H1, and the Younger Dryas. By coupling this new lake history to a hydrologic budget model we are able to evaluate precipitation variability on the Southern Bolivian Altiplano over the last 130 ka. These modeling efforts underscore the relative aridity of the Altiplano during the rare and small lake cycles occurring between 80 and 20 ka, when colder temperatures combined with little or no change in rainfall produced smaller paleolakes. Relative aridity between 80 and 20 ka contrasts with the immense Tauca lake cycle (18.1-14.1 ka), which was six times larger than modern Lake Titicaca and coincided with Heinrich Event 1. This improved paleolake record from the Southern Altiplano reveals a strong link between central Andean climate and Atlantic sea-surface temperature gradients during the late Pleistocene, even though today rainfall variability is driven mostly by Pacific sea-surface temperature anomalies associated with El Niño/Southern Oscillation. However, not all Heinrich Events appear to result in lake expansions, most conspicuously during the global cold interval between 80 and 20 ka when the Altiplano and Amazon Basin were relatively arid.
Benson, Larry; Smoot, J.P.; Lund, S.P.; Mensing, S.A.; Foit, F.F.; Rye, R.O.
2013-01-01
A synthesis of old and new paleoclimatic data from the Pyramid and Winnemucca lake basins indicates that, between 48.0 and 11.5·103 calibrated years BP (hereafter ka), the climate of the western Great Basin was, to a degree, linked with the climate of the North Atlantic. Paleomagnetic secular variation (PSV) records from Pyramid Lake core PLC08-1 were tied to the GISP2 ice-core record via PSV matches to North Atlantic sediment cores whose isotopic and(or) carbonate records could be linked to the GISP2 δ18O record. Relatively dry intervals in the western Great Basin were associated with cold Heinrich events and relatively wet intervals were associated with warm Dansgaard-Oeschger (DO) oscillations. The association of western Great Basin dry events with North Atlantic cold events (and vice versa) switched sometime after the Laurentide Ice Sheet (LIS) reached its maximum extent. For example, the Lahontan highstand, which culminated at 15.5 ka, and a period of elevated lake level between 13.1 and 11.7 ka were associated with cold North Atlantic conditions, the latter period with the Youngest Dryas event. Relatively dry periods were associated with the Bølling and Allerød warm events. A large percentage of the LIS may have been lost to the North Atlantic during Heinrich events 1 and 2 and may have resulted in the repositioning of the Polar Jet Stream over North America. The Trego Hot Springs, Wono, Carson Sink, and Marble Bluff tephras found in core PLC08-1 have been assigned GISP2 calendar ages of respectively, 29.9, 33.7, 34.1, and 43.2 ka. Given its unique trace-element chemistry, the Carson Sink Bed is the same as Wilson Creek Ash 15 in the Mono Lake Basin. This implies that the Mono Lake magnetic excursion occurred at approximately 34 ka and it is not the Laschamp magnetic excursion. The entrance of the First Americans into the northern Great Basin is dated to approximately 14.4 ka, a time when the climate was relatively dry. Evidence for human occupation of
Carcaillet, Christopher; Hörnberg, Greger; Zackrisson, Olle
2012-11-01
New studies indicate the presence of early Holocene ice-free areas far north in Scandinavia. Post-glacial fire and vegetation were investigated based on sedimentary charcoal and pollen from two small lakes in northern Sweden. Accumulation of organic sediment started around 10,900 and 9200 cal yr BP, showing that both lake valleys were ice-free extremely early given their northerly location. Fire events started after 9600 cal yr BP and became less common around the '8.2-ka event'. Woody vegetation provided fuel that contributed to fires. The first vegetation in our pollen record consisted of Hippophae, Dryas, grasses and sedges. Subsequently broadleaved trees (Betula, Salix) increased in abundance and later Pinus, Alnus, ferns and Lycopodium characterized the vegetation. Pollen from Larix, Picea and Malus were also found. The change in vegetation composition was synchronous with the decrease in lake-water pH in the region, indicating ecosystem-scale processes; this occurred during a period of net global and regional warming. The changes in fire frequency and vegetation appear independent of regional trends in precipitation. The reconstructed fire history and vegetation support the scenario of early ice-free areas far north in Scandinavia during early Holocene warming, creating favorable conditions for woody plants and wildfires.
Directory of Open Access Journals (Sweden)
Kuraszkiewicz Kamil O.
2016-06-01
Full Text Available The work of the Polish-Egyptian Archaeological Mission at Saqqara revealed a cemetery of palace officials that was in use during the late Old Kingdom. The evidence found during the exploration of the tombs indicates that the tomb builders were aware of the problems resulting from torrential rains in last years of functioning of the cemetery and that architectural solutions have been invented against these problems. The discussed phenomena seem to be directly related to the 4.2 ka event.
A New Ka-Band Scanning Radar Facility: Polarimetric and Doppler Spectra Measurements of Snow Events
Oue, M.; Kollias, P.; Luke, E. P.; Mead, J.
2017-12-01
Polarimetric radar analyses offer the capability of identification of ice hydrometeor species as well as their spatial distributions. In addition to polarimetric parameter observations, Doppler spectra measurements offer unique insights into ice particle properties according to particle fall velocities. In particular, millimeter-wavelength radar Doppler spectra can reveal supercooled liquid cloud droplets embedded in ice precipitation clouds. A Ka-band scanning polarimetric radar, named KASPR, was installed in an observation facility at Stony Brook University, located 22 km west of the KOKX NEXRAD radar at Upton, NY. The KASPR can measure Doppler spectra and full polarimetric variables, including radar reflectivity, differential reflectivity (ZDR), differential phase (φDP), specific differential phase (KDP), correlation coefficient (ρhv), and linear depolarization ratio (LDR). The facility also includes a micro-rain radar and a microwave radiometer capable of measuring reflectivity profiles and integrated liquid water path, respectively. The instruments collected initial datasets during two snowstorm events and two snow shower events in March 2017. The radar scan strategy was a combination of PPI scans at 4 elevation angles (10, 20, 45, and 60°) and RHI scans in polarimetry mode, and zenith pointing with Doppler spectra collection. During the snowstorm events the radar observed relatively larger ZDR (1-1.5 dB) and enhanced KDP (1-2 ° km-1) at heights corresponding to a plate/dendrite crystal growth regime. The Doppler spectra showed that slower-falling particles ( 1 m s-1). The weakly increased ZDR could be produced by large, faster falling particles such as quasi-spherical aggregates, while the enhanced KDP could be produced by highly-oriented oblate, slowly-falling particles. Below 2 km altitude, measurements of dual wavelength ratio (DWR) based on Ka and S-band reflectivities from the KASPR and NEXRAD radars were available. Larger DWR (>10 dB) suggested
Holocene fire activity and vegetation response in South-Eastern Iberia
Gil-Romera, Graciela; Carrión, José S.; Pausas, Juli G.; Sevilla-Callejo, Miguel; Lamb, Henry F.; Fernández, Santiago; Burjachs, Francesc
2010-05-01
Since fire has been recognized as an essential disturbance in Mediterranean landscapes, the study of long-term fire ecology has developed rapidly. We have reconstructed a sequence of vegetation dynamics and fire changes across south-eastern Iberia by coupling records of climate, fire, vegetation and human activities. We calculated fire activity anomalies (FAAs) in relation to 3 ka cal BP for 10-8 ka cal BP, 6 ka cal BP, 4 ka cal BP and the present. For most of the Early to the Mid-Holocene uneven, but low fire events were the main vegetation driver at high altitudes where broadleaved and coniferous trees presented a highly dynamic post-fire response. At mid-altitudes in the mainland Segura Mountains, fire activity remained relatively stable, at similar levels to recent times. We hypothesize that coastal areas, both mountains and lowlands, were more fire-prone landscapes as biomass was more likely to have accumulated than in the inland regions, triggering regular fire events. The wet and warm phase towards the Mid-Holocene (between ca 8 and 6 ka cal BP) affected the whole region and promoted the spread of mesophytic forest co-existing with Pinus, as FAAs appear strongly negative at 6 ka cal BP, with a less important role of fire. Mid and Late Holocene landscapes were shaped by an increasing aridity trend and the rise of human occupation, especially in the coastal mountains where forest disappeared from ca 2 ka cal BP. Mediterranean-type vegetation (evergreen oaks and Pinus pinaster- halepensis types) showed the fastest post-fire vegetation dynamics over time.
Jennings, A. E.; Andrews, J. T.
2008-12-01
A complex sequence of abrupt glacial advances and retreats punctuate the late phases of Laurentide Ice Sheet deglaciation. These episodes have been reconstructed from interpretation and mapping of glacial deposits on land and in marine basins proximal to the former ice margins in Hudson Strait, Hudson Bay, and the SE Baffin Island shelf. As these events likely produced pulses of freshwater discharge into the North Altantic, which may be responsible for rapid climate change, their timing and magnitude need to be understood. The timing of these events is well constrained by radiocarbon ages, but the ocean reservoir age in ice proximal areas is subject to very large uncertainties, making it difficult to determine calibrated ages for the glacial events so that they can be compared to other climate records. We suggest that the sequence of high detrital carbonate peaks in Holocene and Late Glacial sediments in the Cartwright Saddle of the Labrador shelf provides a template of the abrupt glacial events of the NE margin of the Laurentide Ice Sheet, particularly events that issued from Hudson Strait and Hudson Bay, but possibly including events in Baffin Bay. Once the Labrador Shelf was deglaciated and the local ice had retreated inland, the Cartwright Saddle was a distal trap for sediments released from Hudson Strait and other ice sheet outlets farther north as their sediments and meltwater were carried southwards by surface currents. Core MD99-2236 contains a sediment record beginning c. 13.9 cal ka. We assume a marine reservoir age for the Cartwright Saddle of 450 yrs, which is reasonable given the ice distal and oceanic position of the site. Carbonate was measured on average at a 30 yr time resolution. Carbonate values are elevated between 11.7 and 7 cal kyr BP, with six spikes exceeding 30 percent. Each spike corresponds to a light isotope spike in foraminifers, suggesting that each major spike is associated with a pulse of glacial meltwater. Elevated IRD counts
Sea level and global ice volumes from the Last Glacial Maximum to the Holocene.
Lambeck, Kurt; Rouby, Hélène; Purcell, Anthony; Sun, Yiying; Sambridge, Malcolm
2014-10-28
The major cause of sea-level change during ice ages is the exchange of water between ice and ocean and the planet's dynamic response to the changing surface load. Inversion of ∼1,000 observations for the past 35,000 y from localities far from former ice margins has provided new constraints on the fluctuation of ice volume in this interval. Key results are: (i) a rapid final fall in global sea level of ∼40 m in sea level, the main phase of deglaciation occurred from ∼16.5 ka BP to ∼8.2 ka BP at an average rate of rise of 12 m⋅ka(-1) punctuated by periods of greater, particularly at 14.5-14.0 ka BP at ≥40 mm⋅y(-1) (MWP-1A), and lesser, from 12.5 to 11.5 ka BP (Younger Dryas), rates; (iv) no evidence for a global MWP-1B event at ∼11.3 ka BP; and (v) a progressive decrease in the rate of rise from 8.2 ka to ∼2.5 ka BP, after which ocean volumes remained nearly constant until the renewed sea-level rise at 100-150 y ago, with no evidence of oscillations exceeding ∼15-20 cm in time intervals ≥200 y from 6 to 0.15 ka BP.
Duprat-Oualid, Fanny; Begeot, Carole; Rius, Damien; Millet, Laurent; Magny, Michel
2016-04-01
changes at millennial/pluri-millennial scale. The well-known afforestation of the Late-Glacial interstadial and the Holocene (with pine and hazel-dominated forests respectively) are recorded. Our results also reveal a three-phase sequence in the Last-Glacial. The persistence of very cold conditions between 24 and 30 kyr cal. BP favored a drastic steppe grassland. In contrast, trees proportion increased during the two other periods (14.7-24 and 30-45 kyr cal. BP) in correlation with a relative favorable climate. Second, the respons of vegetation to centennial scale climatic events is characterized by the successive rapid establishment of two different landscapes. GS are dominated by steppic taxa (Artemisia, Helianthemum), whereas more or less complete ecological successions Juniperus-Betula-Pinus seem to occur for most GIs when edaphic conditions became more favorable. Therefore, we suggest a global forcing defined by the strong impact of the climate variability on vegetation changes. We also propose the contribution of local characteristics (latitude, topography) which favored flora migration and long distance pollen inputs from refuge areas. Heiri O., Koinig K.A., Spötl C., Barrett S, Brauer A., Drescher-Schneider R., Gaar D., Ivy-Ochs S., Kerschner H., Luetscher M., Moran A., Nicolussi K., Preusser F., Schmidt R., Schoeneich P., Schwörer C., Sprafke T., Terhorst B., Tinner W. -2014- "Palaeoclimate records 60-8 ka in the Austrian and Swiss Alps and their forelands", Quaternary Science Review, 106 : 186-205.
Directory of Open Access Journals (Sweden)
X. Crosta
2012-03-01
Full Text Available Opal content and diatom assemblages were analysed in core GeoB4905-4 to reconstruct siliceous productivity changes in the eastern Gulf of Guinea during the last 40 000 yr. Opal and total diatom accumulation rates presented low values over the considered period, except during the Last Glacial Maximum and between 15 000 calendar years Before Present (15 cal. ka BP and 5.5 cal. ka BP, the so-called African Humid Period, when accumulation rates of brackish and freshwater diatoms at the core site were highest. Conversely, accumulation rates of windblown diatoms exhibited an opposite pattern with higher values before and after the African Humid Period and greatest values during Heinrich Events, the Younger Dryas and since 5.5 cal. ka BP.
Our results demonstrate that siliceous productivity in the eastern Gulf of Guinea was directly driven by the nutrient load from local rivers, whose discharges were forced by precipitation changes over western Equatorial Africa and/or modification of the fluvio-deltaic systems forced by sea level changes. Precipitation in this region is controlled by the West African monsoon which is, in turn, partly dependent on the presence and intensity of the Atlantic Cold Tongue (ACT. Our results therefore suggest that the ACT was weakened, warmer trade winds were less vigorous, and cloud convection and precipitation were greater during the AHP though centennial-to-millennial timescale dry events were observed at ∼10 cal. ka BP, ∼8.5 cal. ka BP and ∼6 cal. ka BP. Conversely, the ACT was more intense, trade winds were more vigorous and African climate was more arid during H1, the Younger Dryas and after 5.5 cal. ka BP into the present.
Werner, Christian; Liakka, Johan; Schmid, Manuel; Fuentes, Juan-Pablo; Ehlers, Todd A.; Hickler, Thomas
2017-04-01
Vegetation composition and establishment is strongly dependent on climate conditions but also a result of vegetation dynamics (competition for light, water and nutrients). In addition, vegetation exerts control over the development of landscapes as it mediates the climatic and hydrological forces shaping the terrain via hillslope and fluvial processes. At the same time, topography as well as soil texture and soil depth affect the microclimate, soil water storage and rooting space that is defining the environmental envelope for vegetation development. Within the EarthShape research program (www.earthshape.net) we evaluate these interactions by simulating the co-evolution of landscape and vegetation with a dynamic vegetation model (LPJ-GUESS) and a landscape evolution model (LandLab). LPJ-GUESS is a mechanistic model driven by daily or monthly weather data and explicitly simulates vegetation physiology, succession, competition and water and nutrient cycling. Here we present the results of first transient vegetation simulations from 21kyr BP to present-day using the TraCE-21ka climate dataset for four focus sites along the coastal cordillera of Chile that are exposed to a substantial meridional climate gradient (ranging from hyper-arid to humid-temperate conditions). We show that the warming occurring in the region from LGM to present, in addition to the increase of atmospheric CO2 concentrations, led to a shift in vegetation composition and surface cover. Future work will show how these changes resonate in the dynamics of hillslope and fluvial erosion and ultimately bi-directional feedback mechanisms of vegetation development and landscape evolution/ soil formation (see also companion presentation by Schmid et al., this session).
Directory of Open Access Journals (Sweden)
Anna L Shen
Full Text Available We have previously described a mouse model of human posterior polymorphous corneal dystrophy (PPCD and localized the causative mutation to a 6.2 Mbp region of chromosome 2, termed Ppcd1. We now show that the gene rearrangement linked to mouse Ppcd1 is a 3.9 Mbp chromosomal inversion flanked by 81 Kbp and 542 bp deletions. This recombination event leads to deletion of Csrp2bp Exons 8 through 11, Dzank1 Exons 20 and 21, and the pseudogene Znf133. In addition, we identified translocation of novel downstream sequences to positions adjacent to Csrp2bp Exon 7 and Dzank1 Exon 20. Twelve novel fusion transcripts involving Csrp2bp or Dzank1 linked to downstream sequences have been identified. Eight are expressed at detectable levels in PPCD1 but not wildtype eyes. Upregulation of two Csrp2bp fusion transcripts, as well as upregulation of the adjacent gene, Ovol2, was observed. Absence of the PPCD1 phenotype in animals haploinsufficient for Csrp2bp or both Csrp2bp and Dzank1 rules out haploinsufficiency of these genes as a cause of mouse PPCD1. Complementation experiments confirm that PPCD1 embryonic lethality is due to disruption of Csrp2bp expression. The ocular expression pattern of Csrp2bp is consistent with a role for this protein in corneal development and pathogenesis of PPCD1.
Pini, R.; Ravazzi, C.; Donegana, M.
2009-06-01
The pollen record of the long succession of marine and continental deposits filling the subsident north-Adriatic foredeep basin (NE Italy) documents the history of vegetation, the landscape evolution and the climate forcing during the last 215 ka at the south-eastern Alpine foreland. The chronology relies on several 14C determinations as well as on estimated ages of pollen-stratigraphical and sea-level event tie-points derived from comparison with high-resolution marine records, speleothemes and ice cores. Mixed temperate rainforests persisted throughout MIS 7a-7c, being replaced by conifer forests after the local glacioeustatic regression during early MIS 6. The Alpine piedmont facing the Adriatic foredeeep was glaciated at the culmination of the penultimate glaciation, as directly testified by in situ fluvioglacial aggradation related to the building of a large morainic amphitheatre. The pollen record allows correlation with other European records and with the IRD from N-Atlantic and off Iberia, thus the duration of the penultimate glacial culmination at the southalpine fringe is estimated less than 13 ka between 148 ± 1 and >135 ka. The site was not reached by the Last Interglacial maximum sea transgression and enregistered a typical, though incomplete, Eemian forest record, lacking Mediterranean evergreen trees. A complex sequence of stadial-interstadial episodes is reconstructed during the Early and Middle Würm: major xerophyte peaks match IRD maxima occurred during Heinrich events in deep-sea cores offshore Iberia and in the N-Atlantic and allows to frame lumps of interstadial phases, marked by Picea peaks, each one including several DO warm events. Broad-leaved thermophilous forests disappeared from the north-eastern plain of Italy at the end of the Early Würm, whereas reduced populations of Abies and Fagus probably sheltered even during the Last Glacial Maximum. A renewed fluvioglacial in situ deposition between 30.4 ± 0.4 and 21.6 ± 0.5 ka cal BP sets
The evolution of deserts with climatic changes in China since 150 ka B.P.
Institute of Scientific and Technical Information of China (English)
董光荣; 陈惠忠; 王贵勇; 李孝泽; 邵亚军; 金炯
1997-01-01
According to the bioclimatic zones, dune mobility and the fabric characteristics of stratigraphic sedimentary facies, the deserts in China are divided into Eastern, Western, Central and Northwestern deserts. Based on the records of stratigraphical facies, climatic proxies, historical data, etc. in each desert region, the evolution of deserts with climatic changes in time and space since 150 ka B. P. in China are dealt with; then the evolution of deserts in relation to the glacial climatic fluctuations caused by solar radiation changes, underlying surface variation and their feedback mechanism is discussed through comparison with global records; finally, in consideration of global wanning due to increasing of greenhouse gases such as CO2, the possible tendency of the evolution of deserts and the climatic changes is discussed.
Revel, Marie; Colin, Christophe; Bernasconi, Stephano; Combourieu-Nebout, Nathalie; Ducassou, Emmanuelle; Rolland, Yann; Bosch, Delphine
2014-05-01
The Nile delta sedimentation constitutes a continuous high resolution (1.6 mm/year) record of Ethiopian African monsoon regime intensity. Multiproxy analyses performed on core MS27PT recovered in hemipelagic Nile sediment margin (Blue/White Nile River suspended matter frequency fluctuations during the last 21 cal. ka BP. The radiogenic Sr and Nd isotopes, clay mineralogy, bulk elemental composition and palynological analyses reveal large changes in source components, oscillating between a dominant aeolian Saharan contribution during the LGM and the Late Holocene (~4 to 2 cal. ka BP), a dominant Blue/Atbara Nile River contribution during the early Holocene (15 to 8.4 cal. ka BP) and a probable White Nile River contribution during the Middle Holocene (8.4 to 4 cal. ka BP). The following main features are highlighted: 1. The rapid shift from the LGM arid conditions to the African Humid Period (AHP) started at about 15 cal. ka BP. AHP extends until 8.4 cal. ka BP, and we suggest that the Ethiopian African Monsoon maximum between 12 and 8 cal. ka BP is responsible for a larger Blue/Atbara Nile sediment load and freshwater input into the Eastern Mediterranean Sea. 2. The transition between the AHP and the arid Late Holocene is gradual and occurs in two main phases between 8.4 and 6.5 cal. ka BP and 6.5 to 3.2 cal. ka BP. We suggest that the main rain belt shifted southward from 8.4 to ~4 cal. ka BP and was responsible for progressively reduced sediment load and freshwater input into the eastern Mediterranean Sea. 3. The aridification along the Nile catchments occurred from ~4 to 2 cal. ka BP. A dry period, which culminates at 3.2 cal. ka BP, and seems to coincide with a re-establishment of increased oceanic primary productivity in the western Mediterranean Sea. We postulate that the decrease in thermo-haline water Mediterranean circulation could be part of a response to huge volumes of fresh-water delivered principally by the Nile River from 12 to 8.4 cal. ka BP in the
Jones, Samantha Elsie; Burjachs, Francesc; Ferrer-García, Carlos; Giralt, Santiago; Schulte, Lothar; Fernández-López de Pablo, Javier
2018-03-01
This article focuses on a former salt lake in the upper Vinalopó Valley in south-eastern Spain. The study spans the Late Pleistocene through to the Late Holocene, although with particular focus on the period between 11 ka cal BP and 3000 ka cal BP (which spans the Mesolithic and part of the Bronze Age). High resolution multi-proxy analysis (including pollen, non pollen palynomorphs, grain size, X-ray fluorescence and X-ray diffraction) was undertaken on the lake sediments. The results show strong sensitivity to both long term and small changes in the evaporation/precipitation ratio, affecting the surrounding vegetation composition, lake-biota and sediment geochemistry. To summarise the key findings the main general trends identified include: 1) Hyper-saline conditions and low lake levels at the end of the Late Glacial 2) Increasing wetness and temperatures which witnessed an expansion of mesophilic woodland taxa, lake infilling and the establishment of a more perennial lake system at the onset of the Holocene 3) An increase in solar insolation after 9 ka cal BP which saw the re-establishment of pine forests 4) A continued trend towards increasing dryness (climatic optimum) at 7 ka cal BP but with continued freshwater input 5) An increase in sclerophyllous open woody vegetation (anthropogenic?), and increasing wetness (climatic?) is represented in the lake record between 5.9 and 3 ka cal BP 6) The Holocene was also punctuated by several aridity pulses, the most prominent corresponding to the 8.2 ka cal BP event. These events, despite a paucity of well dated archaeological sites in the surrounding area, likely altered the carrying capacity of this area both regionally and locally, particularly during the Mesolithic-Neolithic transition, in terms of fresh water supply for human/animal consumption, wild plant food reserves and suitable land for crop growth.
The impact of MIS-3 climate events at the transition from Neanderthals to modern humans in Europe
Staubwasser, M.; Dragusin, V.; Assonov, S.; Ersek, V.; Hoffmann, D.; Veres, D.; Onac, B. P.
2017-12-01
We report on last glacial stable C and O isotope records from two U-Th dated speleothems from Romania. The southerly record (Ascunsa Cave, South Carpathians) from the Danube region matches the pacing and relative change in amplitude of the Greenland ice temperature record at 30-50 ka BP as well as the abundance of coastal winter sea ice in the Black Sea. The northerly record (Tausoare Cave, East Carpathians) in parts shares the pacing of events with the Greenland or the southern Romanian record, but best matches northern Black Sea summer season temperature change. Heinrich events do not stand out in either record, but the temperature amplitudes of Greenland stadials and Black Sea records are generally reproduced. Based on similarity with the Black Sea we interpret the combined two speleothem records in terms of seasonal temperature change in central Eastern Europe. A climatic influence on the transition from Neanderthals to modern humans has long been suspected. However, the diachronous and spatially complex archaeologic succession across the Middle-Upper Paleolithic (MUPL) in Europe ( 38 - 48 ka) is difficult to reconcile with the millennial-scale pacing of northern hemisphere paleoclimate. Two extreme cold events at 44.0-43.3 recorded and 40.7-39.8 ka in the speleothems bracket the dates of the first known appearance of modern humans - the Aurignacian complex - and the disappearance of Neanderthals from most of Europe. These cold events are coeval with Greenland Stadials GS-12 and GS-10. The speleothem records generally match the paleosol/loess succession from central Europe across the MUPL. The combined record suggests that permafrost advance may have made central Europe uninhabitable at least during winter. The combined paleoclimate and archaeologic records suggest that depopulation-repopulation cycles may have occurred during and after each cold event. Repopulation of central Europe geographically favored the modern human Aurignacians from SE Europe.
NALPS: a precisely dated European climate record 120–60 ka
Directory of Open Access Journals (Sweden)
R. Boch
2011-11-01
Full Text Available Accurate and precise chronologies are essential in understanding the rapid and recurrent climate variations of the Last Glacial – known as Dansgaard-Oeschger (D-O events – found in the Greenland ice cores and other climate archives. The existing chronological uncertainties during the Last Glacial, however, are still large. Radiometric age data and stable isotopic signals from speleothems are promising to improve the absolute chronology. We present a record of several precisely dated stalagmites from caves located at the northern rim of the Alps (NALPS, a region that favours comparison with the climate in Greenland. The record covers most of the interval from 120 to 60 ka at an average temporal resolution of 2 to 22 yr and 2σ-age uncertainties of ca. 200 to 500 yr. The rapid and large oxygen isotope shifts of 1 to 4.5‰ occurred within decades to centuries and strongly mimic the Greenland D-O pattern. Compared to the updated Greenland ice-core timescale (GICC05modelext the NALPS record confirms the timing of rapid warming and cooling transitions between 118 and 106 ka, but suggests younger ages for D-O events between 106 and 60 ka. As an exception, the timing of the rapid transitions into and out of the stadial following GI 22 is earlier in NALPS than in the Greenland ice-core timescale. In addition, there is a discrepancy in the duration of this stadial between the ice-core and the stalagmite chronology (ca. 2900 vs. 3650 yr. The short-lived D-O events 18 and 18.1 are not recorded in NALPS, provoking questions with regard to the nature and the regional expression of these events. NALPS resolves recurrent short-lived climate changes within the cold Greenland stadial and warm interstadial successions, i.e. abrupt warming events preceding GI 21 and 23 (precursor-type events and at the end of GI 21 and 25 (rebound-type events, as well as intermittent cooling events during GI 22 and 24. Such superimposed events have not yet been documented
Zhang, Enlou; Chang, Jie; Sun, Weiwei; Cao, Yanmin; Langdon, Peter; Cheng, Jun
2018-06-01
Investigating potential forcing mechanisms of terrestrial summer temperature changes from the Asian summer monsoon influenced area is of importance to better understand the climate variability in these densely populated regions. The results of spectral and wavelet analyses of the published chironomid reconstructed mean July temperature data from Tiancai Lake on the SE Tibetan Plateau are presented. The evidence of solar forcing of the summer temperature variability from the site on centennial timescales where key solar periodicities (at 855 ± 40, 465 ± 40, 315 ± 40 and 165 ± 40 year) are revealed. By using a band-pass filter, coherent fluctuations were found in the strength of Asian summer monsoon, Northern Hemisphere high latitude climate and high elevation mid-latitude (26°N) terrestrial temperatures with solar sunspot cycles since about 7.6 ka. The two abrupt cooling events detected from the Tiancai Lake record, centered at ∼9.7 and 3.5 ka were examined respectively. Coupled with the paleoclimate modeling results, the early Holocene event (9.7 ka) is possibly linked to an ocean-atmospheric feedback mechanism whereas the latter event (3.5 ka) may be more directly related to external forcing.
International Nuclear Information System (INIS)
Boee, Reidulv; Lepland, Aivo; Blikra, Lars Harald; Longva, Oddvar; Soenstegaard, Eivind
2002-01-01
The Ormen Lange Gas Field was discovered in the Norwegian Sea outside the Moere og Romsdal in 1997. The development of this field which is located in the area of the Storegga Slide, requires safety assessment. The project aims to collect and compile data on slides, avalanches and gravitational faults that may have resulted from large earthquakes or tsunamis in the north west of Western Norway. A major task in the present project has been to investigate the spatial extent and interpret the origin of a postulated mass movement event ca. 2000 years ago and to evaluate its causes, climate variations, a tsunami (possibly caused by an earthquake affecting the offshore area), and earthquake only affecting parts of Western Norway or a combination of an earthquake and a tsunami. Several other mass movements, including the Storegga Slide tsunami deposits and pre-Storegga Slide slide and debris flow deposits have been studied both in the fjord and the lake sediments. Five of the 16 investigated fjords (Dalsfjorden, Foerdefjorden, Syvdsfjorden, Voldafjorden, Oerstadfjorden) provide evidence for a 2000 - 2200 years BP (calendar years before present, i.e. 1950) event. Previous investigations show no indication of a large shelf edge slide in the Storegga area, that may have created a tsunami at that time, nor are any mass movement deposits found on land or in the investigated lakes. This suggests that the 2000 - 2200 BP debris flows and turbidites were most likely related to one or more earthquakes on land or close to the coast and not an offshore mega slide generated tsunami. The Storegga Slide (8200 BP) tsunami deposits are observed in cores over most of the investigated area, both in the deep fjords and in lakes. Striking similarity between major slide and debris flow deposits at the 2000 - 2200 BP and ca. 11000 - 11700 BP stratigraphic levels suggest a common triggering mechanism, probably earthquakes with epicentres in the Sunnfjord Sunnmoere region. A period of debris flows
14C ages and activity for the past 50 ka at Volcán Galeras, Colombia
Banks, N.G.; Calvache, V.M.L.; Williams, S.N.
1997-01-01
Volcán Galeras is the southernmost Colombian volcano with well-recorded historic activity. The volcano is part of a large and complex volcanic center upon which 400,000 people live. Historic activity has centered on a small-volume cone inside the youngest of several large amphitheaters that breach the west flank of the volcano, away from the city of Pasto (population 300,000). Lava flows (SiO2 between 54.6 and 64.7 wt.%) have dominated activity for more than 1 Ma, but explosive events have also occurred. Joint studies by volcanologists from Colombia, Ecuador, Peru, Bolivia, Argentina, and the United States produced 24 new14C ages and more than 100 stratigraphic sections to interpret the past 50 ka of activity at Galeras, including sector collapse events. The youngest collapse event truncated 12.8 ka lava flows and may have occurred as recently as 8 to 10 ka. Tephra-fall material rapidly thins and becomes finer away from the vent area. The only widespread marker in the < 10 ka section is a biotite-bearing tephra deposited between 4.1 and 4.5 ka from a source south of Galeras. It separates cryoturbated from largely undisturbed layers on Galeras, and thus dates a stratigraphic horizon which is useful in the interpretation of other volcanoes and geotectonics in the equatorial Andes. Pyroclastic flows during the past 50 ka have been small to moderate in volume, but they have left numerous thin deposits on the north and east flanks where lava flows have been impeded by crater and amphitheater walls. Many of the pyroclastic-flow deposits are lithic rich, with fines and clasts so strongly altered by hydrothermal action before eruption that they, as well as the sector collapse deposits, resemble waste dumps of leached cappings from disseminated sulfide deposits more than volcanogenic deposits. This evidence of a long-lived hydrothermal system indicates susceptibility to mass failure and explosive events higher than expected for a volcano built largely by lava flows and
Holocene aeolian activity in the Dinggye area (Southern Tibet, China)
Pan, Meihui; Wu, Yongqiu; Zheng, Yinghua; Tan, Lihua
2014-03-01
The Dinggye area (Southern Tibet) contains numerous aeolian sediments, including modern and ancient aeolian sand deposition. In this study, we determined the chronological sequences of several profiles of Holocene paleo-aeolian deposits using Optically Stimulate Luminescence (OSL) and radiocarbon (Accelerator Mass Spectrometry (AMS) 14C and conventional 14C) dating. Using the grain size, magnetic susceptibility, organic content and chrome characteristics of the deposits, we reconstructed the Holocene aeolian processes in the Dinggye area. The results from the paleo-aeolian depositional record indicate multiple changes in the intensity of aeolian activity and soil fixing with alternations between cool-dry and warm-humid climate conditions in the Dinggye area during the Holocene. From 12.8 ka B.P. to the present, the climate has fluctuated frequently. From 12.8 to 11.6 ka B.P. and from 9.3 to 4.9 ka B.P., the climate was warm and humid with weak aeolian activity, and a sandy paleosol developed. The peak Holocene megathermal period and the main period of pedogenesis in the study area was from 6.6 to 4.9 ka B.P. Between 11.6 and 9.3 ka B.P. and since 2.0 ka B.P., the sandlot expanded due to a cool, dry and windy climate; aeolian activity was strong and caused the development of moving dunes. The period between 4.9 and 2.0 ka B.P. was relatively cool and dry with slightly strengthened aeolian activity that developed stationary and semi-stationary dunes. In general, the Holocene events recorded by the paleo-aeolian deposits correspond well with those interpreted by other methods, such as records from ice-cores, lacustrine deposits and tree rings, but there are minor discrepancies between the methods.
Ostermann, Marc; Sanders, Diethard; Ivy-Ochs, Susan; Alfimov, Vasily; Rockenschaub, Manfred; Römer, Alexander
2012-10-15
In the Obernberg valley, the Eastern Alps, landforms recently interpreted as moraines are re-interpreted as rock avalanche deposits. The catastrophic slope failure involved an initial rock volume of about 45 million m³, with a runout of 7.2 km over a total vertical distance of 1330 m (fahrböschung 10°). 36 Cl surface-exposure dating of boulders of the avalanche mass indicates an event age of 8.6 ± 0.6 ka. A 14 C age of 7785 ± 190 cal yr BP of a palaeosoil within an alluvial fan downlapping the rock avalanche is consistent with the event age. The distal 2 km of the rock-avalanche deposit is characterized by a highly regular array of transverse ridges that were previously interpreted as terminal moraines of Late-Glacial. 'Jigsaw-puzzle structure' of gravel to boulder-size clasts in the ridges and a matrix of cataclastic gouge indicate a rock avalanche origin. For a wide altitude range the avalanche deposit is preserved, and the event age of mass-wasting precludes both runout over glacial ice and subsequent glacial overprint. The regularly arrayed transverse ridges thus were formed during freezing of the rock avalanche deposits.
Guo, Yongqiang; Huang, Chun Chang; Zhou, Yali; Pang, Jiangli; Zha, Xiaochun; Fan, Longjiang; Mao, Peini
2018-05-01
Palaeoflood slackwater deposits (SWDs) along the river banks have important implications for the reconstruction of the past hydro-climatic events. Two palaeoflood SWD beds were identified in the Holocene loess-soil sequences on the cliff river banks along the Gold Gorge of the upper Hanjiang River by field investigation and laboratory analysis. They have recorded two palaeoflood events which were dated by optically stimulated luminescence to 3.2-2.8 ka and 2.1-1.8 ka, respectively. The reliability of the ages obtained for the two events are further confirmed by the presence of archaeological remains and good regional pedostratigraphic correlation. The peak discharges of two palaeoflood events at the studied sites were estimated to be 16,560-17,930 m3/s. A correlation with the palaeoflood events identified in the other reaches shows that great floods occurred frequently during the episodes of 3200-2800 and 2000-1700 a BP along the upper Hanjiang River valley during the last 4000 years. These phases of palaeoflood events in central China are well correlated with the climatic variability identified by δ18O record in the stalagmites from the middle Yangtze River Basin and show apparent global linkages. Palaeoflood studies in a watershed scale also imply that strengthened human activities during the Shang dynasty (BCE 1600-1100) and Han dynasty (BCE206-CE265) may have caused accelerated soil erosion along the upper Hanjiang River valley.
Cvetkoska, Aleksandra; Levkov, Zlatko; Reed, Jane M.; Wagner, Bernd
2014-01-01
Lake Prespa (Macedonia/Albania/Greece) occupies an important location between Mediterranean and central European climate zones. Although previous multi-proxy research on the Late Glacial to Holocene sequence, core Co1215 (320cm; ca. 17cal ka BP to present), has demonstrated its great value as an
The 13 ka Pelée-Type Dome Collapse at Nevado de Toluca Volcano, México.
D'Antonio, M.; Capra, L.; Sarocchi, D.; Bellotti, F.
2007-05-01
The Nevado de Toluca is an active volcano located in the central sector of the Trans-Mexican Volcanic Belt, 80 km southwest of Mexico City. Activity at this andesitic to dacitic stratovolcano began ca. 2.6 Ma ago. During the last 42 ka, the volcano has been characterized by different eruptive styles, including five dome collapses dated at 37, 32, 28, 26, and 13 ka and five Plinian eruptions at 42 ka, 36 ka, 21.7 ka, 12.1 ka and 10.5 ka. The 13 ka dome collapse is the youngest event of this type, and originated a 0.11 km3 block-and-ash flow deposit on the north-eastern sector of the volcano. The deposit consists of two facies: channel-like, 10 m thick, monolitologic, that is composed of up to five units, with decimetric dacitic clasts set in a sandy matrix; and a lateral facies that consists of a gray, sandy horizon, up to 4 m thick, with a 30 cm-thick surge layer at the base. The main component is a dacitic lava, with different degree of vesciculation, with mineral association of Pl-Hbl-Opx. Plagioclases show two different textures: in equilibrium, with normal zoning (core = An37-64.3, rim = An30.7-45.8) or with spongy cellular texture with inverse zoning (core = An38-43.5, rim = An45-51.2). Hornblende is normally light green, barren of oxidation. The rock matrix contains up to 53 perc. of glass with abundant microlites, indicating over-pressure on the crystallizing magma and a rapid expulsion. All these stratigraphic and petrographic features indicate that the dome was quickly extruded on the summit of the volcano, probably triggered by a magma mixing process, and its collapse was accompanied by an explosive component, being classified as a Pelée-type event.
Befort, Daniel J.; Leckebusch, Gregor C.; Cubasch, Ulrich
2016-04-01
Proxy-based studies confirmed that the Indian Summer Monsoon (ISM) shows large variations during the Holocene. These changes might be explained by changes in orbital conditions and solar insolation but are also thought to be associated to changes in oceanic conditions, e.g. over the Indo-Pacific-Warm-Pool region. However, due to the nature of these (proxy-based) analyses no conclusion about atmospheric circulation changes during dry and wet epochs are possible. Here, a fully-coupled global climate simulation (AOGCM) covering the past 6000 years is analysed regarding ISM variability. Several dry and wet epochs are found, the most striking around 2ka BP (dry) and 1.7ka BP (wet). As only orbital parameters change during integration, we expect these "shorter-term" changes to be associated with changes in oceanic conditions. During 1.7ka BP the sea surface temperatures (SST) over the Northern Arabian Sea (NARAB) are significantly warmer compared to 2ka BP, whereas cooler conditions are found over the western Pacific Ocean. Additionally, significant differences are found over large parts of the North Atlantic. To explain in how far these different ocean basins are responsible for anomalous conditions during 1.7ka BP, several sensitivity experiments with changed SST/SIC conditions are carried out. It is found that neither the SST's in the Pacific nor in the Indian Ocean are able to reproduce the anomalous rainfall and atmospheric circulation patterns during 1.7ka on its own. Instead, anomalous dry conditions during 2ka BP and wet conditions during 1.7ka BP are associated with a shift of the Indo-Pacific-Warm-Pool (IPWP) and simultaneous anomalous sea-surface temperatures over the NARAB region. Eventually, it is tested in how far this hypothesis holds true for other dry and wet events in the AOGCM data during the whole 6000 years. In general, a shift of the IPWP without anomalous SST conditions over the NARAB region (and vice versa) is not sufficient to cause long
Ouyang, Tingping; Li, Mingkun; Zhao, Xiang; Zhu, Zhaoyu; Tian, Chengjing; Qiu, Yan; Peng, Xuechao; Hu, Qiao
2016-05-01
Magnetic property has been proved to be a sensitive proxy to climate change for both terrestrial and marine sediments. Based on the schedule frame established by AMS 14C dating of foraminifera, detail magnetic analyses were performed for core PC24 sediments at sampling intervals of 2 cm to discuss magnetic sensitivity of marine sediment to climate during Holocene for the northern South China Sea. The results indicated that: 1) Concentration dependent magnetic parameters are positive corresponding to variation of temperature. The frequency dependent susceptibility coefficient basically reflected the variation in humidity; 2) XARM/SIRM was more sensitive to detrital magnetite particles and SIRM/X was more effective to biogenic magnetite particles. Variations of XARM/SIRM and SIRM/X are corresponding to precipitation and temperature, respectively; 3) the Holocene Megathermal in the study area was identified as 7.5-3.4 cal. ka BP. The warmest stage of Holocene for the study area should be during 6.1 to 3.9 cal. ka BP; 4) The 8 ka cold event was characterized as cold and dry during 8.55 to 8.25 cal. ka BP; 5) During early and middle Holocene, the climate combinations were warm dry and cold wet. It turned to warm and wet after 2.7 cal. ka BP.
Directory of Open Access Journals (Sweden)
Tingping eOuyang
2016-05-01
Full Text Available Magnetic property has been proved to be a sensitive proxy to climate change for both terrestrial and marine sediments. Based on the schedule frame established by AMS 14C dating of foraminifera, detail magnetic analyses were performed for core PC24 sediments at sampling intervals of 2 cm to discuss magnetic sensitivity of marine sediment to climate during Holocene for the northern South China Sea. The results indicated that: 1 Concentration dependent magnetic parameters are positive corresponding to variation of temperature. The frequency dependent susceptibility coefficient basically reflected the variation in humidity; 2 XARM/SIRM was more sensitive to detrital magnetite particles and SIRM/X was more effective to biogenic magnetite particles. Variations of XARM/SIRM and SIRM/X are corresponding to precipitation and temperature, respectively; 3 the Holocene Megathermal in the study area was identified as 7.5-3.4 cal. ka BP. The warmest stage of Holocene for the study area should be during 6.1 to 3.9 cal. ka BP; 4 The 8 ka cold event was characterized as cold and dry during 8.55 to 8.25 cal. ka BP; 5 During early and middle Holocene, the climate combinations were warm dry and cold wet. It turned to warm and wet after 2.7 cal. ka BP.
Bohorodyts'ka and Starosamars'ka hundred (sotnya: administrative system and officer (starshyna corps
Directory of Open Access Journals (Sweden)
Repan, O. A.
2017-12-01
Full Text Available Bohorodyts'ka and Starosamars'ka hundred (sotnyais an unique Cossack formations. They existed in a territorial isolation from the Hetmanate and Slobozhanshchyna, on the lands of the Zaporozhian Sich. The study of these formations will better understand the policy of the Russian government in relation to the Sich, to find out the methods by which the state authorities planned to put Zaporizhzhya Cossacks under their control. We do not know when the Bohorodyts'ka hundred (sotnya arose. Now the first mention in the documents dates back to 1700. The Russian government planned to create a Cossack regiment (polk here, but in reality was founded a Cossack hundred (sotnya. Ivan Mazepa, as an autonomous ruler, wanted to include this formation in the structure of Hetmanate, but a hundred (sotnya was subject to the authority of a representative of the Russian administration – the Kiev governor. The hundreds (sotnya were liquidated as a result of Russia's defeat in the war with Turkey and the signing of the Prut peace in 1711. We do not know when the Cossack hundred (sotnya was restored under the name Starosamars'ka. This happened in the late 1730s – early 1740s. In 1744, the Starosamarsʼka hundreds became part of the Poltava regiment (polk of the Hetmanate. The administrative apparatus of the hundreds was predominantly similar to other hundreds of Hetmanates, but the real power of the Cossack officers was a bit lower here. During the existence of the Starosamars'ka hundreds, such a body of self-government was preserved as a council (rada that was not typical for the Hetmanate in this period. This was due to the fact that the peoples could easily escape from their power and move to neighboring settlements and recognize the jurisdiction of the Zaporozhska Sich. The population of hundreds and officers consisted mainly of immigrants from the left bank of the Dnieper, to a lesser extent – from immigrants from the right bank. Summing up, I note that the
Directory of Open Access Journals (Sweden)
de Groot S
2017-06-01
Full Text Available Stefanie de Groot,1 Hans Gelderblom,1 Marta Fiocco,2,3 Judith VMG Bovée,4 Jacobus JM van der Hoeven,1 Hanno Pijl,5 Judith R Kroep1 1Department of Medical Oncology, 2Department of Medical Statistics and Bioinformatics, Leiden University Medical Center, 3Mathematical Department, Leiden University, 4Department of Pathology, 5Department of Endocrinology, Leiden University Medical Center, Leiden, the Netherlands Background: Activation of the insulin-like growth factor 1 (IGF-1 pathway is involved in cell growth and proliferation and is associated with tumorigenesis, tumor progression, and therapy resistance in solid tumors. We examined whether variability in serum levels of IGF-1, IGF-2, and IGF-binding protein 3 (IGF-BP3 can predict event-free survival (EFS and overall survival (OS in Ewing sarcoma patients treated with chemotherapy.Patients and methods: Serum levels of IGF-1, IGF-2, and IGF-BP3 of 22 patients with localized or metastasized Ewing sarcoma treated with six cycles of vincristine/ifosfamide/doxorubicin/etoposide (VIDE chemotherapy were recorded. Baseline levels were compared with presixth cycle levels using paired t-tests and were tested for associations with EFS and OS. Continuous variables were dichotomized according to the Contal and O’Quigley procedure. Survival analyses were performed using Cox regression analysis.Results: High baseline IGF-1 and IGF-BP3 serum levels were associated with EFS (hazard ratio [HR] 0.075, 95% confidence interval [CI] 0.009–0.602 and HR 0.090, 95% CI 0.011–0.712, respectively in univariate and multivariate analyses (HR 0.063, 95% CI 0.007–0.590 and HR 0.057, 95% CI 0.005–0.585, respectively. OS was improved, but this was not statistically significant. IGF-BP3 and IGF-2 serum levels increased during treatment with VIDE chemotherapy (P=0.055 and P=0.023, respectively.Conclusion: High circulating serum levels of IGF-1 and IGF-BP3 and the molar ratio of IGF-1:IGF-BP3 serum levels were associated
Kario, Kazuomi; Tomitani, Naoko; Buranakitjaroen, Peera; Chen, Chen-Huan; Chia, Yook-Chin; Divinagracia, Romeo; Park, Sungha; Shin, Jinho; Siddique, Saulat; Sison, Jorge; Soenarta, Arieska Ann; Sogunuru, Guru Prasad; Tay, Jam Chin; Turana, Yuda; Wang, Ji-Guang; Wong, Lawrence; Zhang, Yuqing; Wanthong, Sirisawat; Hoshide, Satoshi; Kanegae, Hiroshi
2018-01-01
Home blood pressure (BP) monitoring is endorsed in multiple guidelines as a valuable adjunct to office BP measurements for the diagnosis and management of hypertension. In many countries throughout Asia, physicians are yet to appreciate the significant contribution of BP variability to cardiovascular events. Furthermore, data from Japanese cohort studies have shown that there is a strong association between morning BP surge and cardiovascular events, suggesting that Asians in general may benefit from more effective control of morning BP. We designed the Asia BP@Home study to investigate the distribution of hypertension subtypes, including white-coat hypertension, masked morning hypertension, and well-controlled and uncontrolled hypertension. The study will also investigate the determinants of home BP control status evaluated by the same validated home BP monitoring device and the same standardized method of home BP measurement among 1600 or more medicated patients with hypertension from 12 countries/regions across Asia. ©2017 Wiley Periodicals, Inc.
Wang, Jingzhong; Wu, Jinglu; Pan, Baotian; Jia, Hongjuan; Li, Xiao; Wei, Hao
2018-05-01
The origin and evolution of lakes in the Hetao Plain, northern China, were influenced by climate variation, channel migration, and human activity. We analyzed a suite of sediment cores from the region to investigate Yellow River channel migration and environmental change in this region over the Holocene. Short sediment cores show that environmental indicators changed markedly around CE 1850, a time that corresponds to flood events, when large amounts of river water accumulated in the western part of the Hetao Plain, giving rise to abundant small lakes. Multiple sediment variables (environmental proxies) from two long cores collected in the Tushenze Paleolake area show that sediments deposited between 12.0 and 9.0 cal ka BP were yellow clay, indicative of fluvial deposition and channel migration. From 9.0 to 7.5 cal ka BP, sand was deposited, reflecting a desert environment. From 7.5 to 2.2 cal ka BP, however, the sediments were blue-gray clay that represents lacustrine facies of Lake Tushenze, which owes its origin to an increase in strength of the East Asian monsoon. At about 2.2 cal ka BP, the north branch of the Yellow River was flooded, and the Tushenze Paleolake developed further. Around 2.0 cal ka BP, the paleolake shrank and eolian sedimentation was recorded. The analyzed sediment records are consistent with the written history from the region, which documents channel migration and environmental changes in the Hetao Plain over the Holocene.
BP Oil Company's approach to risk management
International Nuclear Information System (INIS)
Fryman, C.E.
1996-01-01
The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams
Improving Cry8Ka toxin activity towards the cotton boll weevil (Anthonomus grandis).
Oliveira, Gustavo R; Silva, Maria C M; Lucena, Wagner A; Nakasu, Erich Y T; Firmino, Alexandre A P; Beneventi, Magda A; Souza, Djair S L; Gomes, José E; de Souza, José D A; Rigden, Daniel J; Ramos, Hudson B; Soccol, Carlos R; Grossi-de-Sa, Maria F
2011-09-09
The cotton boll weevil (Anthonomus grandis) is a serious insect-pest in the Americas, particularly in Brazil. The use of chemical or biological insect control is not effective against the cotton boll weevil because of its endophytic life style. Therefore, the use of biotechnological tools to produce insect-resistant transgenic plants represents an important strategy to reduce the damage to cotton plants caused by the boll weevil. The present study focuses on the identification of novel molecules that show improved toxicity against the cotton boll weevil. In vitro directed molecular evolution through DNA shuffling and phage display screening was applied to enhance the insecticidal activity of variants of the Cry8Ka1 protein of Bacillus thuringiensis. Bioassays carried out with A. grandis larvae revealed that the LC50 of the screened mutant Cry8Ka5 toxin was 3.15-fold higher than the wild-type Cry8Ka1 toxin. Homology modelling of Cry8Ka1 and the Cry8Ka5 mutant suggested that both proteins retained the typical three-domain Cry family structure. The mutated residues were located mostly in loops and appeared unlikely to interfere with molecular stability. The improved toxicity of the Cry8Ka5 mutant obtained in this study will allow the generation of a transgenic cotton event with improved potential to control A. grandis.
Improving Cry8Ka toxin activity towards the cotton boll weevil (Anthonomus grandis
Directory of Open Access Journals (Sweden)
Gomes José E
2011-09-01
Full Text Available Abstract Background The cotton boll weevil (Anthonomus grandis is a serious insect-pest in the Americas, particularly in Brazil. The use of chemical or biological insect control is not effective against the cotton boll weevil because of its endophytic life style. Therefore, the use of biotechnological tools to produce insect-resistant transgenic plants represents an important strategy to reduce the damage to cotton plants caused by the boll weevil. The present study focuses on the identification of novel molecules that show improved toxicity against the cotton boll weevil. In vitro directed molecular evolution through DNA shuffling and phage display screening was applied to enhance the insecticidal activity of variants of the Cry8Ka1 protein of Bacillus thuringiensis. Results Bioassays carried out with A. grandis larvae revealed that the LC50 of the screened mutant Cry8Ka5 toxin was 3.15-fold higher than the wild-type Cry8Ka1 toxin. Homology modelling of Cry8Ka1 and the Cry8Ka5 mutant suggested that both proteins retained the typical three-domain Cry family structure. The mutated residues were located mostly in loops and appeared unlikely to interfere with molecular stability. Conclusions The improved toxicity of the Cry8Ka5 mutant obtained in this study will allow the generation of a transgenic cotton event with improved potential to control A. grandis.
International Nuclear Information System (INIS)
Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao
2003-01-01
A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)
Environmental response to the cold climate event 8200 years ago as recorded at Hoejby Soe, Denmark
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Peter (Geological Survey of Denmark and Greenland, Copenhagen (Denmark)); Ulfeldt Hede, M.; Noe-Nygaard, N. (Univ. of Copenhagen, Dept. of Geography and Geology, Copenhagen (Denmark)); Clarke, A.L. (APEM Manchester Lab., Stockport (United Kingdom)); Vinebrooke, R.D. (Univ. of Alberta, Dept. of Biological Science - Freshwater Biodiversity Lab., Edmonton (Canada))
2008-07-15
The need for accurate predictions of future environmental change under conditions of global warming has led to a great interest in the most pronounced climate change known from the Holocene: an abrupt cooling event around 8200 years before present (present = A.D. 1950), also known as the '8.2 ka cooling event' (ka = kilo-annum = 1000 years). This event has been recorded as a negative delta18OMICRON excursion in the central Greenland ice cores (lasting 160 years with the lowest temperature at 8150) and in a variety of other palaeoclimatic archives including lake sediments, ocean cores, speleothems, tree rings, and glacier oscillations from most of the Northern Hemisphere. In Greenland the maximum cooling was estimated to be 6 +- 2 deg. C while in southern Fennoscandia and the Baltic countries pollenbased quantitative temperature reconstructions indicate a maximum annual mean temperature decrease of around 1.5 deg. C. Today there is a general consensus that the primary cause of the cooling event was the final collapse of the Laurentide ice sheet near Hudson Bay and the associated sudden drainage of the proglacial Lake Agassiz into the North Atlantic Ocean around 8400 B.P. . This freshwater outflow, estimated to amount to c. 164,000 km3 of water, reduced the strength of the North Atlantic thermohaline circulation and thereby the heat transported to the North Atlantic region, resulting in an atmospheric cooling. The climatic consequences of this meltwater flood are assumed to be a good geological analogue for future climate-change scenarios, as a freshening of the North Atlantic is projected by almost all global-warming models and is also currently being registered in the region. In an ongoing project, the influence of the 8.2 ka cooling event on a Danish terrestrial and lake ecosystem is being investigated using a variety of biological and geochemical proxy data from a sediment core extracted from Hojby So, north-west Sjaelland. Here we present data on
Hydroclimate variability in the Nile River Basin during the past 28,000 years
Castañeda, Isla S.; Schouten, Stefan; Pätzold, Jürgen; Lucassen, Friedrich; Kasemann, Simone; Kuhlmann, Holger; Schefuß, Enno
2016-03-01
It has long been known that extreme changes in North African hydroclimate occurred during the late Pleistocene yet many discrepancies exist between sites regarding the timing, duration and abruptness of events such as Heinrich Stadial (HS) 1 and the African Humid Period (AHP). The hydroclimate history of the Nile River is of particular interest due to its lengthy human occupation history yet there are presently few continuous archives from the Nile River corridor, and pre-Holocene studies are rare. Here we present new organic and inorganic geochemical records of Nile Basin hydroclimate from an eastern Mediterranean (EM) Sea sediment core spanning the past 28 ka BP. Our multi-proxy records reflect the fluctuating inputs of Blue Nile versus White Nile material to the EM Sea in response to gradual changes in local insolation and also capture abrupt hydroclimate events driven by remote climate forcings, such as HS1. We find strong evidence for extreme aridity within the Nile Basin evolving in two distinct phases during HS1, from 17.5 to 16 ka BP and from 16 to 14.5 ka BP, whereas peak wet conditions during the AHP are observed from 9 to 7 ka BP. We find that zonal movements of the Congo Air Boundary (CAB), and associated shifts in the dominant moisture source (Atlantic versus Indian Ocean moisture) to the Nile Basin, likely contributed to abrupt hydroclimate variability in northern East Africa during HS1 and the AHP as well as to non-linear behavior of hydroclimate proxies. We note that different proxies show variable gradual and abrupt responses to individual hydroclimate events, and thus might have different inherent sensitivities, which may be a factor contributing to the controversy surrounding the abruptness of past events such as the AHP. During the Late Pleistocene the Nile Basin experienced extreme hydroclimate fluctuations, which presumably impacted Paleolithic cultures residing along the Nile corridor.
International Nuclear Information System (INIS)
Chan, J.G.
2000-01-01
Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Deep-Space Ka-Band Flight Experience
Morabito, D. D.
2017-11-01
Lower frequency bands have become more congested in allocated bandwidth as there is increased competition between flight projects and other entities. Going to higher frequency bands offers significantly more bandwidth, allowing for the use of much higher data rates. However, Ka-band is more susceptible to weather effects than lower frequency bands currently used for most standard downlink telemetry operations. Future or prospective flight projects considering deep-space Ka-band (32-GHz) telemetry data links have expressed an interest in understanding past flight experience with received Ka-band downlink performance. Especially important to these flight projects is gaining a better understanding of weather effects from the experience of current or past missions that operated Ka-band radio systems. We will discuss the historical flight experience of several Ka-band missions starting from Mars Observer in 1993 up to present-day deep-space missions such as Kepler. The study of historical Ka-band flight experience allows one to recommend margin policy for future missions. Of particular interest, we will review previously reported-on flight experience with the Cassini spacecraft Ka-band radio system that has been used for radio science investigations as well as engineering studies from 2004 to 2015, when Cassini was in orbit around the planet Saturn. In this article, we will focus primarily on the Kepler spacecraft Ka-band link, which has been used for operational telemetry downlink from an Earth trailing orbit where the spacecraft resides. We analyzed the received Ka-band signal level data in order to characterize link performance over a wide range of weather conditions and as a function of elevation angle. Based on this analysis of Kepler and Cassini flight data, we found that a 4-dB margin with respect to adverse conditions ensures that we achieve at least a 95 percent data return.
Middle Holocene Changes in Midwestern Precipitation Intensity Captured by Indiana Stalagmites
Akers, P. D.; Brook, G. A.; Liang, F.; Cheng, H.; Edwards, R. L.
2017-12-01
Three stalagmites collected from Upper Porter Cave in southern Indiana provide a record of Midwestern hydroclimate changes for the period 2.3-8.4 ka BP. Our record spans the Middle Holocene, known as a time of mid-continental drying for North America and used as an analog for warmer future climates. The spatial extent of this drying is not well constrained, and some eastern North American records show wetter conditions coinciding with the drying of the continental interior. Southern Indiana is located on the eastern periphery of mid-continental North America, and our stalagmite records can help constrain the eastern extent of drying. Upper Porter Cave floods easily during heavy rain events, and modern observations suggest frequent cave flooding prevents stalagmite growth. Thus, we view periods of stalagmite growth as a proxy for a less intense and possibly drier precipitation regime that limits cave flooding. All three stalagmites began growing 8.4 ka BP and stopped growing 7.5 ka BP. This hiatus at 7.5 ka BP is associated with laminae dissolution and greater sediment incorporation (see image), supporting increased precipitation intensity and cave flooding at this time. This contrasts with concurrent drying in the mid-continent and suggests a Middle Holocene with a steeper east-west precipitation gradient than present. This period of greater precipitation intensity extended until 4.9 ka BP when one stalagmite re-initiated growth, possibly due to mid-continental dryness expanding eastward into southern Indiana. This renewed growth was intermittent at 4.7-4.9, 3.6-4.2, and 2.3-3.1 ka BP, and multi-century flood-driven hiatuses separate these drier periods. A more intense precipitation regime that lasts until present provoked final growth cessation at 2.3 ka BP. Combined with other regional hydroclimate records, our stalagmite suggests that the transition from the Middle to Late Holocene was a period of unstable precipitation regimes for the eastern mid
Winterhalder, Sophie; Scholz, Denis; Mangini, Augusto; Spötl, Christoph; Jochum, Klaus Peter; Pajón, Jesús M.
2016-04-01
The tropical hydrological cycle plays a key role in regulating global climate, mainly through the export of heat and moisture to higher latitudes, and is highly sensitive to climate change, for instance due to changes in the position of the Intertropical Convergence Zone (ITCZ). Previous work on Caribbean stalagmites suggests a strong connection of precipitation variability to North Atlantic (NA) sea surface temperatures on multidecadal to millenial timescales (Fensterer et al., 2012; Fensterer et al., 2013; Winter et al., 2011). Cold phases in the NA potentially lead to a southward shift of the ITCZ and thus drier conditions in Cuba. On orbital timescales, Cuban stalagmites suggest a relation of speleothem δ18O values with the δ18O value of Caribbean surface waters (Fensterer et al., 2013). Here we present an expansion of the Cuban speleothem record covering the whole last glacial period from the end of MIS5c (97 ka BP) until 7 ka with hiatuses between 93-80 ka, 37-35 ka and 13-10 ka. Stalagmite Cuba medio (CM) has been precisely dated with 60 230Th/U-ages, mainly performed by the MC-ICPMS technique. The δ18O and δ13C records are completed by a continuous, high resolution LA-ICPMS trace element profile. These data allow for the first time to establish a multi-proxy climate reconstruction for the North Western Caribbean at decadal to centennial resolution for this period. The long-term variability of the δ18O values probably reflects rainfall amount in Cuba. The response to some Dansgaard/Oeschger and Heinrich stadials confirms the previously observed correlation between Caribbean and NA climate variability. However, this connection is not clearly imprinted throughout the record. Furthermore, trace elements, such as Mg, do not proof without ambiguity drier conditions in Cuba during NA cold events, such as the Heinrich stadials. This suggests that climate variability in Cuba was more complex during the last 100ka, and that the NA was not the only driving factor
Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.
Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W
2017-12-01
We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.
Ionization constants pKa of cardiolipin.
Olofsson, Gerd; Sparr, Emma
2013-01-01
Cardiolipin is a phospholipid found in the inner mitochondrial membrane and in bacteria, and it is associated with many physiological functions. Cardiolipin has a dimeric structure consisting of two phosphatidyl residues connected by a glycerol bridge and four acyl chains, and therefore it can carry two negative charges. The pKa values of the phosphate groups have previously been reported to differ widely with pKa1 = 2.8 and pKa2 = 7.5-9.5. Still, there are several examples of experimental observations from cardiolipin-containing systems that do not fit with this dissociation behavior. Therefore, we have carried out pH-titration and titration calorimetric experiments on two synthetic cardiolipins, 1,1',2,2'-tetradecanoyl cardiolipin, CL (C14:0), and 1,1',2,2'-tetraoctadecenoyl cardiolipin, CL (C18:1). Our results show that both behave as strong dibasic acids with pKa1 about the same as the first pKa of phosphoric acid, 2.15, and pKa2 about one unit larger. The characterization of the acidic properties of cardiolipin is crucial for the understanding of the molecular organization in self-assembled systems that contain cardiolipin, and for their biological function.
The Determination of "Apparent" pKa's. Part II: An Experiment Using Very Weak Acids (pKa's > 11.4).
Cawley, John J.
1995-01-01
Presents an experiment designed to show students that the Henderson-Hasselbalch equation will fail when they use this particular one-half titration technique for acids with large pKa's. Involves determining the apparent pKa for such acids and using that to calculate the true pKa. (JRH)
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
Macklin, M. G.; Fuller, I. C.; Lewin, J.; Maas, G. S.; Passmore, D. G.; Rose, J.; Woodward, J. C.; Black, S.; Hamlin, R. H. B.; Rowan, J. S.
2002-08-01
This paper presents a new correlation of Late and Middle Pleistocene fluvial sedimentary sequences in Greek, Libyan and Spanish river basins and evaluates river response to climate change over the Last Interglacial-Glacial Cycle. Over the past 200,000 years there have been at least 13 major alluviation episodes in the Mediterranean, although the amplitude, frequency and possibly, duration of these events varied significantly across the region. Parts of Oxygen Isotope Stage (OIS) 5 appears to have been periods of pronounced landscape change in many Mediterranean catchments with major river aggradation occurring at ˜109-111 ka (during OIS 5d) and most notably at ˜88 ka (OIS 5b/5a boundary). Other parts of OIS 5 appear to have been periods of relative fluvial inactivity. OIS 2 and 3 were both characterised by an apparent increase in the number of alluviation events, and this record of river behaviour parallels many other palaeoenvironmental records in the region which also show more frequent climate fluctuations between ˜12 and 65 ka. There is evidence for a high degree of synchrony in major river aggradation events across the Mediterranean in catchments with very different sizes, tectonic regimes and histories. Climate-related changes in catchment hydrology and vegetation cover over the last 200 ka would appear to be the primary control of large-scale (catchment wide) sedimentation over time periods of between 10 3 and 10 4 years.
Directory of Open Access Journals (Sweden)
Anil K Pokharia
Full Text Available Archaeological sites hold important clues to complex climate-human relationships of the past. Human settlements in the peripheral zone of Indus culture (Gujarat, western India are of considerable importance in the assessment of past monsoon-human-subsistence-culture relationships and their survival thresholds against climatic stress exerted by abrupt changes. During the mature phase of Harappan culture between ~4,600-3,900yrsBP, the ~4,100±100yrsBP time slice is widely recognized as one of the major, abrupt arid-events imprinted innumerous well-dated palaeo records. However, the veracity of this dry event has not been established from any archaeological site representing the Indus (Harappan culture, and issues concerning timing, changes in subsistence pattern, and the likely causes of eventual abandonment (collapse continue to be debated. Here we show a significant change in crop-pattern (from barley-wheat based agriculture to 'drought-resistant' millet-based crops at ~4,200 yrs BP, based on abundant macrobotanical remains and C isotopes of soil organic matter (δ13CSOM in an archaeological site at Khirsara, in the Gujarat state of western India. The crop-change appears to be intentional and was likely used as an adaptation measure in response to deteriorated monsoonal conditions. The ceramic and architectural remains of the site indicate that habitation survived and continued after the ~4,200yrsBP dry climatic phase, but with declined economic prosperity. Switching to millet-based crops initially helped inhabitants to avoid immediate collapse due to climatic stresses, but continued aridity and altered cropping pattern led to a decline in prosperity levels of inhabitants and eventual abandonment of the site at the end of the mature Harappan phase.
Human activity accelerating the rapid desertification of the Mu Us Sandy Lands, North China
Miao, Yunfa; Jin, Heling; Cui, Jianxin
2016-01-01
Over the past several thousand years, arid and semiarid China has experienced a series of asynchronous desertification events in its semiarid sandy and desert regions, but the precise identification of the driving forces of such events has remained elusive. In this paper we identify two rapid desertification events (RDEs) at ~4.6 ± 0.2 ka BP and ~3.3 ± 0.2 ka BP from the JJ Profile, located in the eastern Mu Us Sandy Lands. These RDEs appear to have occurred immediately following periods marked by persistently frequent and intense fires. We argue that such fire patterns, directly linked to an uncontrolled human use of vegetation as fuel, played a key role in accelerating RDEs by ensuring that the land surface was degraded beyond the threshold required for rapid desertification. This would suggest that the future use of a massive and sustained ecological program of vegetation rehabilitation should reduce the risk of destructive fire. PMID:26961705
Human activity accelerating the rapid desertification of the Mu Us Sandy Lands, North China.
Miao, Yunfa; Jin, Heling; Cui, Jianxin
2016-03-10
Over the past several thousand years, arid and semiarid China has experienced a series of asynchronous desertification events in its semiarid sandy and desert regions, but the precise identification of the driving forces of such events has remained elusive. In this paper we identify two rapid desertification events (RDEs) at ~4.6 ± 0.2 ka BP and ~3.3 ± 0.2 ka BP from the JJ Profile, located in the eastern Mu Us Sandy Lands. These RDEs appear to have occurred immediately following periods marked by persistently frequent and intense fires. We argue that such fire patterns, directly linked to an uncontrolled human use of vegetation as fuel, played a key role in accelerating RDEs by ensuring that the land surface was degraded beyond the threshold required for rapid desertification. This would suggest that the future use of a massive and sustained ecological program of vegetation rehabilitation should reduce the risk of destructive fire.
Ionization constants pKa of cardiolipin.
Directory of Open Access Journals (Sweden)
Gerd Olofsson
Full Text Available Cardiolipin is a phospholipid found in the inner mitochondrial membrane and in bacteria, and it is associated with many physiological functions. Cardiolipin has a dimeric structure consisting of two phosphatidyl residues connected by a glycerol bridge and four acyl chains, and therefore it can carry two negative charges. The pKa values of the phosphate groups have previously been reported to differ widely with pKa1 = 2.8 and pKa2 = 7.5-9.5. Still, there are several examples of experimental observations from cardiolipin-containing systems that do not fit with this dissociation behavior. Therefore, we have carried out pH-titration and titration calorimetric experiments on two synthetic cardiolipins, 1,1',2,2'-tetradecanoyl cardiolipin, CL (C14:0, and 1,1',2,2'-tetraoctadecenoyl cardiolipin, CL (C18:1. Our results show that both behave as strong dibasic acids with pKa1 about the same as the first pKa of phosphoric acid, 2.15, and pKa2 about one unit larger. The characterization of the acidic properties of cardiolipin is crucial for the understanding of the molecular organization in self-assembled systems that contain cardiolipin, and for their biological function.
Hoek, W.Z.; Bohncke, S.J.P.
The Last Termination, or Weichselian Lateglacial (ca 15-10 ka cal. BP), is a time period with rapid changes in climate and environment. The oxygen-isotope records of the Greenland ice-cores are regarded as the most complete climate proxy for the North Atlantic region. In The Netherlands several
Directory of Open Access Journals (Sweden)
Ostrow J
2010-03-01
Full Text Available Abstract Background Correct aqueous pKa values of unconjugated bilirubin (UCB, a poorly-soluble, unstable substance, are essential for understanding its functions. Our prior solvent partition studies, of unlabeled and [14C] UCB, indicated pKa values above 8.0. These high values were attributed to effects of internal H-bonding in UCB. Many earlier and subsequent studies have reported lower pKa values, some even below 5.0, which are often used to describe the behavior of UCB. We here review 18 published studies that assessed aqueous pKa values of UCB, critically evaluating their methodologies in relation to essential preconditions for valid pKa measurements (short-duration experiments with purified UCB below saturation and accounting for self-association of UCB. Results These re-assessments identified major deficiencies that invalidate the results of all but our partition studies. New theoretical modeling of UCB titrations shows remarkable, unexpected effects of self-association, yielding falsely low pKa estimates, and provides some rationalization of the titration anomalies. The titration behavior reported for a soluble thioether conjugate of UCB at high aqueous concentrations is shown to be highly anomalous. Theoretical re-interpretations of data in DMSO and dimethylformamide show that those indirectly-derived aqueous pKa values are unacceptable, and indicate new, high average pKa values for UCB in non-aqueous media (>11 in DMSO and, probably, >10 in dimethylformamide. Conclusions No reliable aqueous pKa values of UCB are available for comparison with our partition-derived results. A companion paper shows that only the high pKa values can explain the pH-dependence of UCB binding to phospholipids, cyclodextrins, and alkyl-glycoside and bile salt micelles.
Fade Mitigation Techniques at Ka-Band
Dissanayake, Asoka (Editor)
1996-01-01
Rain fading is the dominant propagation impairment affecting Ka-band satellite links and rain fade mitigation is a key element in the design of Ka-band satellite networks. Some of the common fade mitigation techniques include: power control, diversity, adaptive coding, and resource sharing. The Advanced Communications Technology Satellite (ACTS) provides an excellent opportunity to develop and test Ka-band rain impairment amelioration techniques. Up-link power control and diversity are discussed in this paper.
Curry, B. B.
2014-12-01
Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents
International Nuclear Information System (INIS)
Victor, David G.; House, Joshua C.
2006-01-01
Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate
pKa predictions for proteins, RNAs, and DNAs with the Gaussian dielectric function using DelPhi pKa.
Wang, Lin; Li, Lin; Alexov, Emil
2015-12-01
We developed a Poisson-Boltzmann based approach to calculate the pKa values of protein ionizable residues (Glu, Asp, His, Lys and Arg), nucleotides of RNA and single stranded DNA. Two novel features were utilized: the dielectric properties of the macromolecules and water phase were modeled via the smooth Gaussian-based dielectric function in DelPhi and the corresponding electrostatic energies were calculated without defining the molecular surface. We tested the algorithm by calculating pKa values for more than 300 residues from 32 proteins from the PPD dataset and achieved an overall RMSD of 0.77. Particularly, the RMSD of 0.55 was achieved for surface residues, while the RMSD of 1.1 for buried residues. The approach was also found capable of capturing the large pKa shifts of various single point mutations in staphylococcal nuclease (SNase) from pKa-cooperative dataset, resulting in an overall RMSD of 1.6 for this set of pKa's. Investigations showed that predictions for most of buried mutant residues of SNase could be improved by using higher dielectric constant values. Furthermore, an option to generate different hydrogen positions also improves pKa predictions for buried carboxyl residues. Finally, the pKa calculations on two RNAs demonstrated the capability of this approach for other types of biomolecules. © 2015 Wiley Periodicals, Inc.
Überlegungen zu der sumerischen Zeichen-Gruppe ŠÈ.KA
Directory of Open Access Journals (Sweden)
Such-Gutiérrez, Marcos
2003-12-01
Full Text Available This paper deals with the different readings and meanings of the signs ŠÈ.KA. One of these readings is Zì.KA or zì-KA/ka, which has been traditionally interpreted as a kind of flour or as the process of milling. However, a revision of the texts from the Third Dynasty of Ur (c. 2117-2008 B.C., in which the group of signs ZÌ.KA o zì-KA/ka appears, shows that this term is actually a kind of gift.
El presente artículo trata de las diferentes lecturas y significados del grupo de signos ŠÈ.KA. Entre dichas lecturas se encuentra la de ZÌ.KA o zì-KA/ka, que ha sido tradicionalmente interpretada bien como un tipo de harina, o bien como la acción que conduce a su fabricación. Sin embargo, una revisión de los textos de la III Dinastía de Ur (c. 2117-2008 a.C. en los que aparece el término ZÌ.KA o zì-KA/ka demuestra que, en realidad, con él se hace referencia a un tipo de regalo.
Lifescience Database Archive (English)
Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap
Ionization Constants pKa of Cardiolipin
Olofsson, Gerd; Sparr, Emma
2013-01-01
Cardiolipin is a phospholipid found in the inner mitochondrial membrane and in bacteria, and it is associated with many physiological functions. Cardiolipin has a dimeric structure consisting of two phosphatidyl residues connected by a glycerol bridge and four acyl chains, and therefore it can carry two negative charges. The pKa values of the phosphate groups have previously been reported to differ widely with pKa1 = 2.8 and pKa2 = 7.5-9.5. Still, there are several examples of experimental ob...
Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer
International Nuclear Information System (INIS)
Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy
2003-01-01
BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event
Digital Repository Service at National Institute of Oceanography (India)
Thamban, M.; Rao, V.P
). The early deglacial monsoon intensification started at approx. 16 ka B.P., which was further reduced during 12.5-11.5 ka B.P., synchronous with the global and regional climatic fluctuations. Maximum humidity was inferred between 9 and 6 ka B.P...
2018-01-01
Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.
Lifescience Database Archive (English)
Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000
Cataclysmic Rock Avalanche from El Capitan, Yosemite Valley, circa 3.6 ka
Stock, G. M.
2008-12-01
El Capitan in Yosemite Valley is one of the largest and most iconic granite faces in the world. Despite glacially steepened walls exceeding 90 degrees, a historic database shows relatively few rock falls from El Capitan in the past 150 years. However, a massive bouldery deposit beneath the southeast face suggests an earlier rock avalanche of unusually large size. Spatial analysis of airborne LiDAR data indicate that the rock avalanche deposit has a volume of ~2.70 x 106 m3, a maximum thickness of 18 m, and a runout distance of 660 m, roughly twice the horizontal extent of the adjacent talus. The deposit is very coarse on its distal edge, with individual boulder volumes up to 2500 m3. Cosmogenic 10Be exposure dates from boulders distributed across the deposit confirm this interpretation. Four 10Be samples are tightly clustered between 3.5 and 3.8 ka, with a mean age of 3.6 +/- 0.6 ka. A fifth sample gives a much older age of 22.0 ka, but a glacier occupied Yosemite Valley at this time, prohibiting deposition; thus, the older age likely results from exposure on the cliff face prior to failure. The similarity of ages and overall morphology suggest that the entire deposit formed during a single event. The mean exposure age coincides with inferred Holocene rupture of the northern Owens Valley and/or White Mountain fault(s) between 3.3 and 3.8 ka (Lee et al., 2001; Bacon and Pezzopane, 2007). This time coincidence, combined with the fact that historic rupture of the Owens Valley fault in A.D. 1872 generated numerous large rock falls in Yosemite Valley, strongly suggests that the El Capitan rock avalanche was triggered by a seismic event along the eastern margin of the Sierra Nevada circa 3.6 ka. As there is not an obvious "scar" on the expansive southeast face, the exact source area of the rock avalanche is not yet known. Detrital apatite U-Th/(He) thermochronometry can determine the elevation(s) from which rock fall boulders originate, but significant inter-sample age
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001
Lifescience Database Archive (English)
Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0
Arce, J. L.; Gardner, J. E.; Macías, J. L.
2013-01-01
The Nevado de Toluca volcano in Central Mexico has been active over the last ca. 42 ka, during which tens of km3 of pyroclastic material were erupted and two important Plinian-type eruptions occurred at ca. 21.7 ka (Lower Toluca Pumice: LTP) and ca. 10.5 ka (Upper Toluca Pumice: UTP). Samples from both the LTP and UTP contain plagioclase, amphibole, iron-titanium oxides, and minor anhedral biotite, set in a vesicular, rhyolitic, glassy matrix. In addition, UTP dacites contain orthopyroxene. Analysis of melt inclusions in plagioclase phenocrysts yields H2O contents of 2-3.5 wt.% for LTP and 1.3-3.6 wt.% for UTP samples. Ilmenite-ulvospinel geothermometry yields an average temperature of ~ 868 °C for the LTP magma (hotter than the UTP magma, ~ 842 °C; Arce et al., 2006), whereas amphibole-plagioclase geothermometry yields a temperature of 825-859 °C for the LTP magma. Water-saturated experiments using LTP dacite suggest that: (i) amphibole is stable above 100 MPa and below 900 °C; (ii) plagioclase crystallizes below 250-100 MPa at temperatures of 850-900 °C; and (iii) pyroxene is stable only below pressures of 200-100 MPa and temperatures of 825-900 °C. Comparison of natural and experimental data suggests that the LTP dacitic magma was stored at 150-200 MPa (5.8-7.7 km below the volcano summit). No differences in pressure found between 21.7 ka and 10.5 ka suggest that these two magmas were stored at similar depths. Orthopyroxene produced in lower temperature LTP experiments is compositionally different to those found in UTP natural samples, suggesting that they originated in two different magma batches. Whole-rock chemistry, petrographic features, and mineral compositions suggest that magma mixing was responsible for the generation of the dacitic Plinian LTP eruption.
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:
Lifescience Database Archive (English)
Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433
Lifescience Database Archive (English)
Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene
Lifescience Database Archive (English)
Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca
Lifescience Database Archive (English)
Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26
Lifescience Database Archive (English)
Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A
Energy Technology Data Exchange (ETDEWEB)
Colleoni, Florence [Centro Euro-Mediterraneo per i Cambiamenti Climatici, Bologna (Italy); UJF, CNRS, Laboratoire de Glaciologie et Geophysique de l' Environnement, Saint Martin d' Heres Cedex (France); Stockholm University, Department of Geological Sciences, Stockhlom (Sweden); Liakka, Johan [Stockholm University, Department of Meteorology, Stockholm (Sweden); Krinner, Gerhard; Peyaud, Vincent [UJF, CNRS, Laboratoire de Glaciologie et Geophysique de l' Environnement, Saint Martin d' Heres Cedex (France); Jakobsson, Martin [Stockholm University, Department of Geological Sciences, Stockhlom (Sweden); Masina, Simona [Centro Euro-Mediterraneo per i Cambiamenti Climatici, Istituto Nazionale di Geofisica e Vulcanologia, Bologna (Italy)
2011-08-15
This work focuses on the Late Saalian (140 ka) Eurasian ice sheets' surface mass balance (SMB) sensitivity to changes in sea surface temperatures (SST). An Atmospheric General Circulation Model (AGCM), forced with two preexisting Last Glacial Maximum (LGM, 21 ka) SST reconstructions, is used to compute climate at 140 and 21 ka (reference glaciation). Contrary to the LGM, the ablation almost stopped at 140 ka due to the climatic cooling effect from the large ice sheet topography. Late Saalian SST are simulated using an AGCM coupled with a mixed layer ocean. Compared to the LGM, these 140 ka SST show an inter-hemispheric asymmetry caused by the larger ice-albedo feedback, cooling climate. The resulting Late Saalian ice sheet SMB is smaller due to the extensive simulated sea ice reducing the precipitation. In conclusion, SST are important for the stability and growth of the Late Saalian Eurasian ice sheet. (orig.)
Erosion during extreme flood events dominates Holocene canyon evolution in northeast Iceland.
Baynes, Edwin R C; Attal, Mikaël; Niedermann, Samuel; Kirstein, Linda A; Dugmore, Andrew J; Naylor, Mark
2015-02-24
Extreme flood events have the potential to cause catastrophic landscape change in short periods of time (10(0) to 10(3) h). However, their impacts are rarely considered in studies of long-term landscape evolution (>10(3) y), because the mechanisms of erosion during such floods are poorly constrained. Here we use topographic analysis and cosmogenic (3)He surface exposure dating of fluvially sculpted surfaces to determine the impact of extreme flood events within the Jökulsárgljúfur canyon (northeast Iceland) and to constrain the mechanisms of bedrock erosion during these events. Surface exposure ages allow identification of three periods of intense canyon cutting about 9 ka ago, 5 ka ago, and 2 ka ago during which multiple large knickpoints retreated large distances (>2 km). During these events, a threshold flow depth was exceeded, leading to the toppling and transportation of basalt lava columns. Despite continuing and comparatively large-scale (500 m(3)/s) discharge of sediment-rich glacial meltwater, there is no evidence for a transition to an abrasion-dominated erosion regime since the last erosive event because the vertical knickpoints have not diffused over time. We provide a model for the evolution of the Jökulsárgljúfur canyon through the reconstruction of the river profile and canyon morphology at different stages over the last 9 ka and highlight the dominant role played by extreme flood events in the shaping of this landscape during the Holocene.
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52
Lifescience Database Archive (English)
Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
International Nuclear Information System (INIS)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola
2015-01-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs
Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells
Energy Technology Data Exchange (ETDEWEB)
Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se
2015-03-01
The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.
P. Martinez; F. Lamy; R. R. Robinson; L. Pichevin; I. Billy;
2006-01-01
We report a nitrogen isotope record (ODP Site 1233) from the southern Chile margin at 41�S. The site is located slightly south of the southern boundary of the Peru�Chile upwelling system and the associated oxygen minimum zone off Peru and northern Chile. We show that our nitrogen isotope record, from the time interval 0�50 calendar kiloyears before present (ka B.P.), bears an atypical pattern both in shape and timing when compared with records obtained from either the continental margin...
RADIOCARBON CHRONOLOGY OF HOLOCENE PALSA OF BOL’SHEZEMEL’SKAYA TUNDRA IN RUSSIAN NORTH
Directory of Open Access Journals (Sweden)
Yurij Vasil’chuk
2013-01-01
Full Text Available Six palsa mire in Usa River valley and in Vorkuta area in North-eastern part of European Russia were studied in detail. In total 75 new 14C dates from different palsa sections were obtained. In palsa mire near Bugry Settlement 3.2 m high palsa dated from 8.6 to 2.1 ka BP. The permafrost and palsa began 2.1 ka BP. In palsa mire near Usa Settlement low moor peat in 2 m high palsa dated 3690 BP, palsa began to heave at least 3700 BP. A low-moor peat of 2.5 m high palsa indicates the change in the hydrological-mineral regime during 7.1 to 6.3 ka BP, heaving commenced 6 ka BP. A number of 8 14C dates from 5.6 to 2.7 ka BP obtained from peat of 3 m high palsa. Near Abez’ Settlement palsa development began about 2.8 ka BP. There are both large and smaller palsas. Low-moor peat of 3.5 m high palsa is dated between 9180 BP to 6730 BP near Nikita Settlement. In Vorkuta area near Khanovey Settlement the northern most palsa is found. The 14C age of peat at slope of the palsa is much younger, than in an axial part, there is inversion of the dates: the date 3.5 ka BP is between dates 2.9 and 2.8 ka BP. It is probably caused by creep of peat downwards from a summit. This evidenced this frozen mound is real palsa, but not a residual form as a result of erosion.
Lifescience Database Archive (English)
Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406
Lifescience Database Archive (English)
Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,
Lifescience Database Archive (English)
Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801
Lifescience Database Archive (English)
Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0
Lifescience Database Archive (English)
Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-
A tropical warm pool in the Indian Ocean and its influence on ENSO over the past 137, 000 yrs BP
Digital Repository Service at National Institute of Oceanography (India)
Saraswat, R.; Nigam, R.; Weldeab, S.; Mackensen, A.
to the SST contrast over the same period in both WEP (~2.8 ?C) and EEP (~2.6?C). Down-core plot of SST difference bet- ween WEP and EIO shows that during the larger part of the last ~137 ka BP, EIO was either equally warm or warmer than WEP (Figure 3..., the difference in SST between EIO and EEP as well as between WEP and EEP was similar. During the isotopic stages 3 and 2, the SST difference bet- ween EIO and EEP was comparatively higher than the SST difference between WEP and EEP. However after the last...
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi
Lifescience Database Archive (English)
Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014
Lifescience Database Archive (English)
Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:
Ramos-Román, María J.; Jiménez-Moreno, Gonzalo; Camuera, Jon; García-Alix, Antonio; Anderson, R. Scott; Jiménez-Espejo, Francisco J.; Sachse, Dirk
2017-04-01
The Iberian Peninsula, located in the Mediterranean area, is an interesting location for paleoclimate studies due to its geographic situation between arid and humid climates. Sediments from peat bogs and lakes from Sierra Nevada, in southeastern Iberian Peninsula, have been very informative in terms of how vegetation and wetland environments were impacted by Holocene climate change. These studies are essential if we want to understand the past climate change in the area, which is the key to identify the possible environmental response of the Sierra Nevada ecosystems to future climate scenarios. Padul basin, located in the southwest of the Sierra Nevada mountain range, contains a ca. 100 m-thick peat bog sedimentary sequence that was deposited during the past 1 Ma making this area interesting for paleoenvironmental and paleoclimatic reconstructions. A new 43 m-long sedimentary record has recently been retrieved from the Padul peat bog. In this study we have developed a multiproxy analysis of the Holocene part of the Padul-15-05 core including pollen analysis, XRF-core scanner, magnetic susceptibility and organic geochemistry, supported by an age control based on AMS radiocarbon dates, providing with information about vegetation and climate variability during the past 9.9 cal ka BP. This multiproxy reconstruction of the Padul-15-05 evidences the Mediterranean as a sensitive area with respect to global-scale climate system, showing relevant climate episodes such as the ca. 8, 7.5, 6.5 and 5.5 cal ka BP events during the early and middle Holocene. The trend to aridification to the late Holocene is interrupted by more arid and humid periods as the Iberian Roman Humid Period (from ca. 3 to 1.6 cal ka BP), the Dark Ages (from ca. 1.5 to 1.1 cal ka BP), the Medieval Climate Anomaly (from ca. 1.1 to 1.3 cal ka BP) and the Little Ice Age period (from ca. 500 to 100 cal yr BP).
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l
The potentials for creating sustainable rural tourism in Bačka
Directory of Open Access Journals (Sweden)
Stankov Uglješa
2007-01-01
Full Text Available Average rural household in Bačka mostly depend on agricultural activities. Modern society changes, especially changes in agriculture production imply need for diversification of business activities. Rural tourism can be important part of rural economy for some villages in Bačka. Fertile plain, Danube, Tisa and other smaller rivers, animals and games represent base of natural tourist attractions of rural tourism. However, main competitive advantages of Bačka are anthropogenic values. Traditional pannonian houses, baroques churches, numerous rural festivities, and "melting point" of different nationalities make good base for rural tourism development. Different combinations of rural attractions create several tourist experiences of this region: authentic tourist experience at "szalashes", particular tourist experience in villages, intensive tourist experience of rural events and manifestations, not authentic tourist experiences of pseudo rural attractions and complex tourist experience in rural areas. Regarding to emitive centers of rural tourist demand can be specified tree regions for development of rural tourism - region of Novi Sad, Subotica, and Sombor. Rural tourism can make a valuable contribution to rural economies, job creation, landscape conservation, retention of rural population, support to rural culture and tradition, nature conservation and other. At the same time, rural tourism is facing various limitations. With in this context, rural tourism planning has to include principles of sustainable development.
Deep space propagation experiments at Ka-band
Butman, Stanley A.
1990-01-01
Propagation experiments as essential components of the general plan to develop an operational deep space telecommunications and navigation capability at Ka-band (32 to 35 GHz) by the end of the 20th century are discussed. Significant benefits of Ka-band over the current deep space standard X-band (8.4 GHz) are an improvement of 4 to 10 dB in telemetry capacity and a similar increase in radio navigation accuracy. Propagation experiments are planned on the Mars Observer Mission in 1992 in preparation for the Cassini Mission to Saturn in 1996, which will use Ka-band in the search for gravity waves as well as to enhance telemetry and navigation at Saturn in 2002. Subsequent uses of Ka-band are planned for the Solar Probe Mission and the Mars Program.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
John, Alin; Weir, Matthew R.; Smith, Stephen R.; Hunsicker, Lawrence; Kasiske, Bertram L.; Kusek, John W.; Bostom, Andrew; Ivanova, Anastasia; Levey, Andrew S.; Solomon, Scott; Pesavento, Todd; Weiner, Daniel E.
2014-01-01
The optimal BP level in kidney transplant recipients remains uncertain. This post hoc analysis of the Folic Acid for Vascular Outcome Reduction in Transplantation (FAVORIT) trial cohort assessed associations of BP with a pooled cardiovascular disease (CVD) outcome and with all-cause mortality. In 3474 prevalent kidney transplant patients, mean age was 52±9 years, 63% were men, 76% were white, 20% had a history of CVD, 40% had a history of diabetes mellitus, and the median time since transplant was 4.1 years (25th to 75th percentiles, 1.7–7.4); mean systolic BP was 136±20 mmHg and mean diastolic BP was 79±12 mmHg. There were 497 CVD events and 406 deaths. After adjustment for demographic and transplant characteristics and CVD risk factors, each 20-mmHg increase in baseline systolic BP associated with a 32% increase in subsequent CVD risk (hazard ratio [HR], 1.32; 95% confidence interval [95% CI], 1.19 to 1.46) and a 13% increase in mortality risk (HR, 1.13; 95% CI, 1.01 to 1.27). Similarly, after adjustment, at diastolic BP levels70 mmHg, there was no significant relationship between diastolic BP and outcomes. Higher systolic BP strongly and independently associated with increased risk of CVD and all-cause mortality, without evidence of a J shape, whereas only lower levels of diastolic BP associated with increased risk of CVD and death in this trial. PMID:24627349
Directory of Open Access Journals (Sweden)
Yang Du
2017-11-01
Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.
Green, Rebecca M.; Bebbington, Mark S.; Cronin, Shane J.; Jones, Geoff
2014-09-01
Detailed tephrochronologies are built to underpin probabilistic volcanic hazard forecasting, and to understand the dynamics and history of diverse geomorphic, climatic, soil-forming and environmental processes. Complicating factors include highly variable tephra distribution over time; difficulty in correlating tephras from site to site based on physical and chemical properties; and uncertain age determinations. Multiple sites permit construction of more accurate composite tephra records, but correctly merging individual site records by recognizing common events and site-specific gaps is complex. We present an automated procedure for matching tephra sequences between multiple deposition sites using stochastic local optimization techniques. If individual tephra age determinations are not significantly different between sites, they are matched and a more precise age is assigned. Known stratigraphy and mineralogical or geochemical compositions are used to constrain tephra matches. We apply this method to match tephra records from five long sediment cores (≤ 75 cal ka BP) in Auckland, New Zealand. Sediments at these sites preserve basaltic tephras from local eruptions of the Auckland Volcanic Field as well as distal rhyolitic and andesitic tephras from Okataina, Taupo, Egmont, Tongariro, and Tuhua (Mayor Island) volcanic centers. The new correlated record compiled is statistically more likely than previously published arrangements from this area.
Karabacak, Volkan; Uysal, I. Tonguç; Ünal-İmer, Ezgi; Mutlu, Halim; Zhao, Jian-xin
2017-12-01
Central Anatolia represents one of the most outstanding examples of intraplate deformation related to both continental collision and back-arc extension generating non-uniformly distributed stress fields. In this study, we provide direct field evidence of various stress directions and investigate carbonate-filled fracture systems in the Central Anatolian Volcanic Province using U/Th geochronology and isotope geochemistry for evaluating the episodes of latest volcanic activity under regional stress. Field data reveal two independent fracture systems in the region. Successive fracture development has been controlled by two different volcanic eruption centers (Hasandağ Composite Volcano and Acıgöl Caldera). Trace element, and stable (C and O) and radiogenic (Sr) isotope compositions of carbonate veins indicate different fluid migration pathways for two different fracture systems. The U/Th age data for carbonate veins of two independent fracture systems indicate that the crustal deformation intensified during 7 episodic periods in the last 150 ka. The NNE-trending first fracture system was formed as a result of strain cycles in a period from 149 ± 2.5, through 91 ± 1.5 to 83 ± 2.5 ka BP. Subsequent deformation events represented by the ENE-trending second fracture zone have been triggered during the period of 53 ± 3.5, 44 ± 0.6 and 34 ± 1 ka BP before the first fracture zone resumed the activity at about 4.7 ± 0.15 ka BP. Although further studies are needed to evaluate statistical significance of age correlations, the periods of carbonate precipitation inferred from U-Th age distributions in this study are comparable with the previous dating results of surrounding volcanic eruption events.
Directory of Open Access Journals (Sweden)
D. Wong
2013-01-01
Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.
Franchisingkäsikirjan tuottaminen käytettyjen valokuvaustarvikkeiden verkkokaupalle
Heikkinen, Antti
2015-01-01
Tämän opinnäytetyön tarkoituksena oli luoda selkeä ja helppokäyttöinen franchisingkäsikirja Kameratori Oy:lle. Kameratori on vuonna 2010 perustettu käytettyyn valokuvauskalustoon keskittyvä verkkokauppa, joka myy Tampereen toimitiloista käsin kuntotarkistettua kuvauskalustoa Suomeen ja maailmalle. Franchisingkäsikirjaan on dokumentoitu Kameratori.fi-verkkosivuston käyttöön tarvittava ohjeistus. Käsikirja on yksi olennaisimmista dokumenteista franchisingantajan ja -ottajien...
Liu, Jiabo; Nowaczyk, Norbert R.; Frank, Ute; Arz, Helge W.
2018-06-01
A comprehensive magnetostratigraphic investigation on sixteen sediment cores from the southeastern Black Sea yielded a very detailed high-quality paleosecular variation (PSV) record spanning from 20 to 15 ka. The age models are based on radiocarbon dating, stratigraphic correlation, and tephrochronology. Further age constraints were obtained by correlating four meltwater events, described from the western Black Sea, ranging in age from about 17 to 15 ka, with maxima in K/Ti ratios, obtained from X-ray fluorescence (XRF) scanning, and minima in S-ratios, reflecting increased hematite content, in the studied cores. Since the sedimentation rates in the investigated time window are up to 50 cm ka-1, the obtained PSVs records enabled a stacking using 50-yr bins. A directional anomaly at 18.5 ka, associated with pronounced swings in inclination and declination, as well as a low in relative paleointensity (rPI), is probably contemporaneous with the Hilina Pali excursion, originally reported from Hawaiian lava flows. However, virtual geomagnetic poles (VGPs) calculated from Black Sea sediments are not located at latitudes lower than 60°N, which denotes normal, though pronounced secular variations. During the postulated Hilina Pali excursion, the VGPs calculated from Black Sea data migrated clockwise only along the coasts of the Arctic Ocean from NE Canada (20.0 ka), via Alaska (18.6 ka) and NE Siberia (18.0 ka) to Svalbard (17.0 ka), then looping clockwise through the Eastern Arctic Ocean.
International Nuclear Information System (INIS)
Longmore, M.E.; McTainsh, G.H.
1997-01-01
Full text: Pleistocene lake sediments from a relic perched freshwater lake on Fraser Island have been found to date back to ca.600 ka using U/Th analysis of the organics. This sequence is one of the three longest terrestrial records of environmental change in Australia and the contained evidence of vegetation, fire and lake level changes (Longmore and Heijnis, 1996) and is an invaluable contribution to palaeoclimatic reconstruction. A younger sequence, dated by conventional radiocarbon analysis, has 6.5 m of continuous organic sedimentation from ca. 30 ka to the present. The last 8.5 ka has been analysed in detail, showing a mid-Holocene 'dry' period (Longmore, 1996). Continental aeolian dust from extreme wind erosional events has been measured in modern atmospheres (McTainsh, 1989; Knight et al., 1995) and deep sea cores (Hesse, 1994), but the terrestrial record of wind erosion during the Pleistocene is sparse. We will report on a pilot project to determine the presence of aeolian dust from extreme wind erosional events in the past in the sediments of Fraser Island lakes. Due to the highly weathered, well-sorted, siliceous nature of the dune sands forming the Island and the highly organic nature of the lake sediments (80-95% LOI), these are some of the few terrestrial sequences that permit separation of aeolian dust from local catchment materials. In the future, oxygen isotope and XRD analysis of the extracted dust will allow the most likely source of the entrained material to be determined and thus provide further evidence as to the wind regime during the last 600ka and 30ka respectively. The separation of dust from these terrestrial sequences is a major achievement and potentially may make a significant contribution to global palaeoclimatic models
The effects of multiple features of alternatively spliced exons on the KA/KS ratio test
Directory of Open Access Journals (Sweden)
Chen Feng-Chi
2006-05-01
Full Text Available Abstract Background The evolution of alternatively spliced exons (ASEs is of primary interest because these exons are suggested to be a major source of functional diversity of proteins. Many exon features have been suggested to affect the evolution of ASEs. However, previous studies have relied on the KA/KS ratio test without taking into consideration information sufficiency (i.e., exon length > 75 bp, cross-species divergence > 5% of the studied exons, leading to potentially biased interpretations. Furthermore, which exon feature dominates the results of the KA/KS ratio test and whether multiple exon features have additive effects have remained unexplored. Results In this study, we collect two different datasets for analysis – the ASE dataset (which includes lineage-specific ASEs and conserved ASEs and the ACE dataset (which includes only conserved ASEs. We first show that information sufficiency can significantly affect the interpretation of relationship between exons features and the KA/KS ratio test results. After discarding exons with insufficient information, we use a Boolean method to analyze the relationship between test results and four exon features (namely length, protein domain overlapping, inclusion level, and exonic splicing enhancer (ESE frequency for the ASE dataset. We demonstrate that length and protein domain overlapping are dominant factors, and they have similar impacts on test results of ASEs. In addition, despite the weak impacts of inclusion level and ESE motif frequency when considered individually, combination of these two factors still have minor additive effects on test results. However, the ACE dataset shows a slightly different result in that inclusion level has a marginally significant effect on test results. Lineage-specific ASEs may have contributed to the difference. Overall, in both ASEs and ACEs, protein domain overlapping is the most dominant exon feature while ESE frequency is the weakest one in affecting
Lifescience Database Archive (English)
Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;
Lifescience Database Archive (English)
Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI
Lifescience Database Archive (English)
Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
Forman, S. L.; Wright, D.
2015-12-01
Relict beaches adjacent to Lake Turkana provide a record of water level variability for the Late Quaternary. This study focused on deciphering the geomorphology, sedimentology, stratigraphy and 14C chronology of strand plain sequences in the Kalokol and Lothagam areas. Nine >30 m oscillations in water level were documented between ca. 15 and 4 ka. The earliest oscillation between ca. 14.5 and 13 ka is not well constrained with water level to at least 70 m above the present surface and subsequently fell to at least 50 m. Lake level increased to ~ 90 m between ca. 11.2 and 10.4 ka, post Younger Dryas cooling. Water level fell by >30 m by 10.2 ka, with another potential rise at ca. 8.5 ka to >70 m above current level. Lake level regressed by > 40 m at 8.2 ka coincident with cooling in the equatorial Eastern Atlantic Ocean. Two major >70 m lake level oscillations centered at 6.6 and 5.2 ka may reflect enhanced convection with warmer sea surface temperatures in the Western Indian Ocean. The end of the African Humid Period occurred from ca. 8.0 to 4.5 ka and was characterized by variable lake level (± > 40 m), rather than one monotonic fall in water level. This lake level variability reflects a complex response to variations in the extent and intensity of the East and West African Monsoons near geographic and topographic limits within the catchment of Lake Turkana. Also, for this closed lake basin excess and deficits in water input are amplified with a cascading lake effect in the East Rift Valley and through the Chew Bahir Basin. The final regression from a high stand of > 90 m began at. 5.2 ka and water level was below 20 m by 4.5 ka; and for the remainder of the Holocene. This sustained low stand is associated with weakening of the West African Monsoon, a shift of the mean position of Congo Air Boundary west of the Lake Turkana catchment and with meter-scale variability in lake level linked to Walker circulation across the Indian Ocean. A surprising observation is
International Nuclear Information System (INIS)
Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia
2012-01-01
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.
Lifescience Database Archive (English)
Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot
Lifescience Database Archive (English)
Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
Assigning the pKa's of Polyprotic Acids.
Bodner, George M.
1986-01-01
Discusses (1) polyproptic acids for which the difference between K-a's is large; (2) the Henderson-Hasselbach equation; (3) polyprotic acids for which the difference between K-a's is small; (4) analysis of microscopic dissociation constants for cysteine; and (5) analysis of pK-a data. (JN)
Ulukiliha sobib ka jõululauale / Raivo Feldmann
Feldmann, Raivo
2009-01-01
Adavere lihakauplusest, mida on külastanud ka president Toomas Hendrik Ilves ja proua Evelin Ilves. OÜ Chef Foodsi kaupa tellib ka presidendi kantselei. Juuresoleval fotol president Toomas Hendrik Ilves ja proua Evelin Ilves koos OÜ Chef Foodsi juhatuse liikme Veiko Villemi ja juhataja Priit Noorhaniga
Alpert, Bruce S
2011-04-01
We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.
Lifescience Database Archive (English)
Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi
Lifescience Database Archive (English)
Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765
Energy Technology Data Exchange (ETDEWEB)
Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others
2012-06-15
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity
Directory of Open Access Journals (Sweden)
Azamat Aslanukov
2006-10-01
Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A
2006-10-01
The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Gorbarenko, Sergey; Velivetskaya, Tatyana; Malakhov, Mikhail; Bosin, Aleksandr
2017-05-01
Paleoclimate data from the Okhotsk Sea (OS) over Terminations II and I (TII, TI), and the Last and Present Interglacial (LIG, PIG) periods were compiled in order to examine Northern Hemisphere climate and sea level changes. Based on records of four AMS 14C-dated OS cores over TI-PIG, it is argued that the OS productivity/climate, IRD (ice-rafted debris), and benthic foraminiferal oxygen isotope (δ18Obf) proxies provide representative and in-phase evidence of the Northern Hemisphere climate and continental ice sheet changes consistent with the LR 04 δ18Obf curve. Chronologies for two central OS cores over TII-LIG-cooling event 23 (C23) were constructed by correlating OS productivity proxies with well-dated δ18O records of Chinese speleothems because OS environment is modulated by East Asian Monsoon; and, as well as correlating measured magnetic paleointensity excursions with those in the dated PISO-1500 paleointensity stack. Results show several OS climatic and environment states, including TII coeval with Asian Weak Monsoon Interval (WMI) II since 136 ka, LIG with a sharp two-step transition (130.2-129 ka) and demise at С25 (116.5 ka), and last glaciation with coolings at C24 (111 ka) and C23. The OS productivity and IRD records demonstrate certain climate amelioration in the middle of WMI-II, and two insignificant cooling events inside the LIG marked by C27 (126 ka) and C26 (120.6 ka). OS δ18Obf records of both cores demonstrate a gradual trend of lighter values since around 131.5 ka BP, continuing from the onset of LIG (129 ka) to minimum values at 126 ka BP (C27), then nearly constant values until 121.5 ka, followed by a slight increase up to 120.6 ka (C26), and a subsequent strong increase up to 116.5 ka (C25). The magnitude of OS δ18Obf oscillations is 1.35‰, which is less than those in the N. Atlantic. It may therefore be suggested that this OS index probably tracks changes in continental ice sheet volume and sea level.
Hydrological and climate changes in southeast Siberia over the last 33 kyr
Katsuta, Nagayoshi; Ikeda, Hisashi; Shibata, Kenji; Saito-Kokubu, Yoko; Murakami, Takuma; Tani, Yukinori; Takano, Masao; Nakamura, Toshio; Tanaka, Atsushi; Naito, Sayuri; Ochiai, Shinya; Shichi, Koji; Kawakami, Shin-ichi; Kawai, Takayoshi
2018-05-01
Paleoenvironmental and paleoclimate changes in intracontinental Siberia were reconstructed by continuous, high-resolution records (biogenic silica, U, total organic carbon and N, total S, and grain size) from a sediment core retrieved from the Buguldeika Saddle, Lake Baikal, dating back to the last 33 cal. ka BP. The Holocene climate was wet relative to the last glacial period. The climate became gradually warm and wet from the early to middle Holocene, followed by a shift at ca. 6.5 cal. ka BP toward warm and dry, possibly because of evapotranspiration. This suggests that the climate system transition from the glacial to interglacial state occurred at that time. In the last glacial, the deposition of carbonate mud from the Primorsky Range was associated with Heinrich events (H3 and H1) and the Selenga River inflow during the Last Glacial Maximum was caused by meltwater of mountain glaciers in the Khamar-Daban Range. The anoxic bottom-water during the Allerød-Younger Dryas was probably a result of weakened ventilation associated with reduced Selenga River inflow and microbial decomposition of organic matters originating from moderate input of nutrients from the Primorsky Range. The rapid decline in precipitation during the early Holocene may have been a response to the 8.2 ka cooling event.
Tripaldi, Alfonsina; Forman, Steven L.
2016-05-01
The Pampean Sand Sea, which occurs from the Argentinian Pampas to the eastern Andean piedmont, hosts presently stabilized dune fields spanning the late Quaternary. This study integrates previous results and presents new geomorphic, stratigraphic, sedimentological, and chronologic data for nineteen >2 m-thick eolian successions for the San Luis paleo-dune field, western Pampas, to better constrain the depositional history. Six eolian depositional phases are identified spanning the past 50 ka, interposed with paleosols and/or bounded by erosive surfaces. Age control was from 61 OSL ages of small aliquots of quartz grains from eolian stratigraphic units. The inferred timing of eolian phases are at ca. 70 ± 10 yr, 190 ± 20 yr, 12 to 1 ka, 22 to 17 ka, 29 to 24 ka, and 40 to 32 ka. A maximum span for periods of pedogenesis at ca. 12 to 17 ka, 22 to 24 ka, and 29 to 32 ka was provided by bounding OSL ages, which broadly overlap with high stands of pluvial lakes and glacier advances in the central Andes. We infer that the added precipitation may reflect expansion of the Southern Hemisphere monsoon, associated with Northern Hemisphere Heinrich events, leading to episodes of significantly wetter conditions (>350 mm MAP) to at least 35° S. Most of the Holocene (12 ka to 0.8 ka) was characterized by sand sheet deposit under drier than present conditions (100-450 mm MAP), associated with Monte-type vegetation (shrub steppe). The latest two eolian depositional phases, occurred at ca. 190 and 70 yr ago, during the historic period with European settlement and are related to anthropogenic landscape disturbance, though the youngest phase was concomitant with 1930s drought. Wet conditions dominated since ca. AD 1970 with new lakes and rivers forming across this eolian terrain; an incongruous environmental response in reference to drier conditions for most of the Holocene.
Climatic forcing before, during, and after the 8.2 Kyr B.P. global ...
Indian Academy of Sciences (India)
This paper attempts at full characterization of the unique global 8.2 Kyr B.P. cooling event. Signifi- ... of its global character and magnitude and occur- rence in the ... in the 1 A.U. interplanetary space, and is inversely correlated with solar activity. It is not influenced by any changes in the geomagnetic field strength or climate.
2009-01-01
Proua Evelin Ilves kinkis Eestis esinenud popstaar Madonnale eesti rahvusmotiividega dressid. Sarnased spordirõivad tulevad müügile ka Tallinnas Viru keskuses Bastioni esinduskaupluses. Proua Evelin Ilvesele valmistatakse ainulaadsed valgest kangast dressid
Digital Repository Service at National Institute of Oceanography (India)
Kessarkar, P; Rao, V.P
, with a zone of green black clayey silts at 200-230 cm interval (~32 14C ka) (Fig. 2). In core 39, silty clays are dominant through out the core. The sediments are moderate brown in colour between the core top and 30 cm (7 ka BP), light olive grey..., with higher proportions of sand around LGM and gradually decreasing proportions in the early Holocene and late Pleistocene sediments can be seen in Fig. 2. Clay content is higher in the early Holocene (11 ka BP - -7 ka BP) than in the late Holocene (up...
Multi-Step Ka/Ka Dichroic Plate with Rounded Corners for NASA's 34m Beam Waveguide Antenna
Veruttipong, Watt; Khayatian, Behrouz; Hoppe, Daniel; Long, Ezra
2013-01-01
A multi-step Ka/Ka dichroic plate Frequency Selective Surface (FSS structure) is designed, manufactured and tested for use in NASA's Deep Space Network (DSN) 34m Beam Waveguide (BWG) antennas. The proposed design allows ease of manufacturing and ability to handle the increased transmit power (reflected off the FSS) of the DSN BWG antennas from 20kW to 100 kW. The dichroic is designed using HFSS and results agree well with measured data considering the manufacturing tolerances that could be achieved on the dichroic.
Ugur, Ilke; Marion, Antoine; Parant, Stéphane; Jensen, Jan H; Monard, Gerald
2014-08-25
In a first step toward the development of an efficient and accurate protocol to estimate amino acids' pKa's in proteins, we present in this work how to reproduce the pKa's of alcohol and thiol based residues (namely tyrosine, serine, and cysteine) in aqueous solution from the knowledge of the experimental pKa's of phenols, alcohols, and thiols. Our protocol is based on the linear relationship between computed atomic charges of the anionic form of the molecules (being either phenolates, alkoxides, or thiolates) and their respective experimental pKa values. It is tested with different environment approaches (gas phase or continuum solvent-based approaches), with five distinct atomic charge models (Mulliken, Löwdin, NPA, Merz-Kollman, and CHelpG), and with nine different DFT functionals combined with 16 different basis sets. Moreover, the capability of semiempirical methods (AM1, RM1, PM3, and PM6) to also predict pKa's of thiols, phenols, and alcohols is analyzed. From our benchmarks, the best combination to reproduce experimental pKa's is to compute NPA atomic charge using the CPCM model at the B3LYP/3-21G and M062X/6-311G levels for alcohols (R(2) = 0.995) and thiols (R(2) = 0.986), respectively. The applicability of the suggested protocol is tested with tyrosine and cysteine amino acids, and precise pKa predictions are obtained. The stability of the amino acid pKa's with respect to geometrical changes is also tested by MM-MD and DFT-MD calculations. Considering its strong accuracy and its high computational efficiency, these pKa prediction calculations using atomic charges indicate a promising method for predicting amino acids' pKa in a protein environment.
Kan Kaşanmak Deyimi Üzerine On The Idiom Kan Kaşanmak
Directory of Open Access Journals (Sweden)
Yaşar ŞİMŞEK
2013-03-01
Full Text Available Mankind chose to tell his own feeling and thoughts with stereotyped words by using the expression facilities of his vernacular. The meaning of stereotyped words form as community's mutual thought's product by switching of the word or phrase's first meaning via simile. Idioms have a crucial place in regard to show the expression facilities in stereotyped words. That's why, the detection of entitiy in a language have an importance. In this essay, it will be dwelled on the idiom "kan kaşanmak"which is forgotten in these days, on the other hand; is mentioned oftenin Old Anatolian Turkish texts. The essay is composed of two parts. Inthe first part; the word kaşanmak's usage which is used in the meaningof "to urinate" in Uighur Turkish, Karakhanid Turkish, ChagataiTurkish, Qipchaq Turkish and Old Anatolian Turkish since Old Turkishperiod and today exists in Anatolian and Azerbaijan dialects, is going tobe tried to be shown with examples now that it forms a basis for "kankaşanmak" idiom.In the second part of the study, it will be dwelled on the idiom kankaşanmak's meaning transformation which is idiomatic form of theword kaşanmak, starting with the first meaning of it. The first meaningof the idiom kan kaşanmak means "to urinate blood, but later itbecomes a idiom by meaning transformation; in the meaning of"frighten to death, be scared as piss oneself, be scared as peeing bloodand this is going to be shown with examples. The study is going to befinished with showing the idiom's first meaning which is used in today'sAnatolian dialects usage " using an animal to carry load and animal'speeing blood because of the heavy burden" in the close meaning it isused for people too. İnsanoğlu, konuştuğu dilin ifade olanaklarını kullanarak, kendisine has duygu ve düşünceleri kalıplaşmış sözlerle anlatma yoluna gitmiştir. Kalıplaşmış sözlerin anlamı, sözcüğün ya da sözcük grubunun ilk anlamından mecaz yolu ile geçiş yaparak halk
Briti korruptsioonivastane seadus kehtib ka Eestis / Tõnis Tamme
Tamme, Tõnis, 1972-
2011-01-01
Suurbritannias jõustub 1. juulil 2011 uus korruptsioonivastane seadus (Bribery Act 2010), mis kehtib ühtmoodi nii Briti ettevõtetele kui ka mujal maailmas asutatud äriühingutele, kelle äritegevus või ka osa sellest omab puutumust Suurbritanniaga
Concentrating Solar Power Projects - KaXu Solar One | Concentrating Solar
Power | NREL KaXu Solar One This page provides information on KaXu Solar One, a concentrating solar power (CSP) project, with data organized by background, parcipants and power plant configuration . Status Date: April 14, 2015 Project Overview Project Name: KaXu Solar One Country: South Africa Location
Camuera, Jon; Jiménez-Moreno, Gonzalo; José Ramos-Román, María; García-Alix, Antonio; Jiménez-Espejo, Francisco; Anderson, R. Scott
2017-04-01
High-resolution X-ray fluorescence (XRF), magnetic susceptibility (MS), color and lithological analyses have been carried out on a 3.6 m-long sediment core from Laguna Seca, a high-elevation dry lake from Sierra Nevada mountain range, southern Spain. This is the longest sedimentary record retrieved from an alpine lake in southern Iberian Peninsula. Besides, alpine lakes are very sensitive environments to climate changes and previous studies showed that Laguna Seca could provide an excellent record to identify millennial-scale climate variations during deglaciation and the whole Holocene. XRF analyses, in particular high calcium and low K/Ca ratios, show aridity phases, very well represented during Last Glacial Maximum (LGM) and the Younger Dryas (YD). Arid events are also shown at ca. 8.1 ka BP, ca. 4.4 ka BP and the latest Holocene. On the other hand, negative values in calcium and positive values in K/Ca appear in the Bølling-Allerød (BA) and during the early Holocene until ca. 6 ka BP, indicating more humidity and higher run-off. A progressive aridification trend is also observed in the Holocene, changing from more humid conditions during the early Holocene to more aridity during the late Holocene.
Reconstruction of past climate variability in SE Spain between 14 and 8 ka
Budsky, Alexander; Scholz, Denis; Mertz-Kraus, Regina; Christoph, Spötl; Gibert, Luis; Jochum, Klaus Peter; Andreae, Meinrat O.
2016-04-01
In comparison to the large climatic oscillations during the Pleistocene, Holocene climate only underwent minor changes. Nevertheless, cyclic climate changes also occurred during the Holocene. The Bond events, represented by the presence of cold, ice-bearing waters from the north of Iceland as far south as the latitude of Britain, occurred at a cyclicity of about 1500 a and were particularly pronounced during the Early Holocene. However, their climatic impact on the terrestrial realm was not consistent over Europe, in particular with respect to changes in precipitation. Here we present a precisely dated high-resolution flowstone record from Cueva Victoria, SE Spain, a site well suited to study the competing influence of the Atlantic and Mediterranean Sea on the southern Iberian Peninsula. We sampled several flowstones with a thickness of up to 60 cm. 230Th/U-dating has shown that these deposits mainly formed during relatively warm climate intervals of the Middle and Late Pleistocene, i.e. interglacials and interstadials (Budsky et al., 2015; Gibert et al., 2016). Here we focus on a short (11 cm) flowstone sequence from the Holocene with a high temporal resolution (centennial for stable isotopes and annual for trace elements). The flowstone grew between 14 and ca. 8 ka b2k. The decreasing trend of the δ18O and δ13C values as well as of several trace elements between 12 and 11 ka b2k reflects an increase in temperature and precipitation at the beginning of the Holocene. In particular, Sr and Mg show a trend towards low and stable values. Subsequently, from 10.5 to 8 ka b2k, the δ13C values show a high variability (-11 to -4), whereas the δ18O values are rather stable (between -6 and -7). Maxima in δ13C are interpreted as drier conditions in response to Bond events. These events possibly led to a change of the atmospheric circulation, affecting the vegetation in SE Spain, which evolved towards an open C3 vegetation at ca. 8 ka b2k concomitant with drier conditions
Tunneling in BP-MoS2 heterostructure
Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong
Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).
Mars Global Surveyor Ka-Band Frequency Data Analysis
Morabito, D.; Butman, S.; Shambayati, S.
2000-01-01
The Mars Global Surveyor (MGS) spacecraft, launched on November 7, 1996, carries an experimental space-to-ground telecommunications link at Ka-band (32 GHz) along with the primary X-band (8.4 GHz) downlink. The signals are simultaneously transmitted from a 1.5-in diameter parabolic high gain antenna (HGA) on MGS and received by a beam-waveguide (BWG) R&D 34-meter antenna located in NASA's Goldstone Deep Space Network (DSN) complex near Barstow, California. The projected 5-dB link advantage of Ka-band relative to X-band was confirmed in previous reports using measurements of MGS signal strength data acquired during the first two years of the link experiment from December 1996 to December 1998. Analysis of X-band and Ka-band frequency data and difference frequency (fx-fka)/3.8 data will be presented here. On board the spacecraft, a low-power sample of the X-band downlink from the transponder is upconverted to 32 GHz, the Ka-band frequency, amplified to I-W using a Solid State Power Amplifier, and radiated from the dual X/Ka HGA. The X-band signal is amplified by one of two 25 W TWTAs. An upconverter first downconverts the 8.42 GHz X-band signal to 8 GHz and then multiplies using a X4 multiplier producing the 32 GHz Ka-band frequency. The frequency source selection is performed by an RF switch which can be commanded to select a VCO (Voltage Controlled Oscillator) or USO (Ultra-Stable Oscillator) reference. The Ka-band frequency can be either coherent with the X-band downlink reference or a hybrid combination of the USO and VCO derived frequencies. The data in this study were chosen such that the Ka-band signal is purely coherent with the X-band signal, that is the downconverter is driven by the same frequency source as the X-band downlink). The ground station used to acquire the data is DSS-13, a 34-meter BWG antenna which incorporates a series of mirrors inside beam waveguide tubes which guide the energy to a subterranean pedestal room, providing a stable environment
Lowe, David J.; Blaauw, Maarten; Hogg, Alan G.; Newnham, Rewi M.
2013-08-01
cal. yr BP; Rotorua 15,635 ± 412 cal. yr BP; Rerewhakaaitu 17,496 ± 462 cal. yr BP; Okareka 21,858 ± 290 cal. yr BP; Te Rere 25,171 ± 964 cal. yr BP; Kawakawa/Oruanui 25,358 ± 162 cal. yr BP; Poihipi 28,446 ± 670 cal. yr BP; and Okaia 28,621 ± 1428 cal. yr BP. Secondly, we have re-dated the start and end of the Lateglacial cool episode (climate event NZce-3 in the NZ-CES), previously referred to as the Lateglacial climate reversal, as defined at Kaipo bog in eastern North Island, New Zealand, using both Bacon and OxCal P_Sequence modelling with the IntCal09 data set. The ca 1200-yr-long cool episode, indicated by a lithostratigraphic change in the Kaipo peat sequence to grey mud with lowered carbon content, and a high-resolution pollen-derived cooling signal, began 13,739 ± 125 cal. yr BP and ended 12,550 ± 140 cal. yr BP (mid-point ages of the 95% highest posterior density regions, Bacon modelling). The OxCal modelling, generating almost identical ages, confirmed these ages. The Lateglacial cool episode (ca 13.8-12.6 cal. ka BP) thus overlaps a large part of the entire Antarctic Cold Reversal chronozone (ca 14.1-12.4 cal. ka BP or ca 14.6-12.8 cal. ka BP), and an early part of the Greenland Stadial-1 (Younger Dryas) chronozone (ca 12.9-11.7 cal. ka BP). The timing of the Lateglacial cool episode at Kaipo is broadly consistent with the latitudinal patterns in the Antarctic Cold Reversal signal suggested for the New Zealand archipelago from marine and terrestrial records, and with records from southern South America.
Directory of Open Access Journals (Sweden)
Marković Jelica
2015-01-01
Full Text Available Customer satisfaction is a guarantee of success in all fields, including those related to the organization of sport events. As a consequence of the event quality appears visitor satisfaction which significantly impacts on the their loyalty and 'word of mouth' promotion, so examination of these categories is especially important to the event organizers in order to control and improve the event. Sports events can be viewed in a broader context, where it is not of primary importance reaching the sports results, but is more emphasized its non-competitive nature. In this case, the sport events include recreation, relaxation, entertainment and leisure, with a significantly different approach and intentions of the organization. Such events lead to intercultural exchange, increase the level of socialization and promote physical activity as a function of improving health. Having in mind that it assumed the characteristics of mass and has become an influential factor in the Vojvodina tourism, this study aims to analyze the quality of the Mountaineering marathon on Fruška gora from the perspective of the participants' satisfaction. For collecting the data, it was used the questionnaire. The sample included 134 participants of the 35th Mountaineering marathon on Fruška gora. For measuring this event quality, it was used modified model SEQSS with 4 dimensions: quality of marathon program, quality of interaction, quality of outcomes and quality of the physical environment. The results have shown that the quality of all measured dimensions is at a high level and that measuring dimension the quality outcome, which includes the socialization and valence, has the greatest impact on the satisfaction of the participants.
Méjean, Pauline; Garduño-Monroy, Victor-Hugo; Pinti, Daniele L.; Ghaleb, Bassam; Bouvier, Laura; Gomez-Vasconcelos, Martha G.; Tremblay, Alain
2015-01-01
Cacahuamilpa cave is one of the largest karst systems in Central Mexico. The cave contains numerous massive speleothems broken and fallen following oriented directions, damaged during cataclysmic geological events. One fallen and two broken speleothems were sampled in the Cacahuamilpa cave for dating the rupture event using measured U-Th disequilibrium ages. A total of eight small carbonate cores were drilled perpendicular and longitudinal to the rupture surface. Results showed three groups of ages (weighted average): 0.95 ± 0.02 ka, 28.8 ± 0.2 ka and 88.0 ± 0.7 ka. This indicates that the construction of the Cacahuamilpa karst system, for which no absolute ages existed before this study, initiated at least since Late Pleistocene. The first two groups of ages might be related to two distinct episodes of intense seismic activity. Calculated minimum horizontal ground acceleration and frequency values of the seismic events needed to create the rupture of the stalagmites dated at 0.95 ± 0.02 ka and 28.8 ± 0.2 ka range between 1.3 and 2.0 m s-2 and between 13.4 and 20.8 Hz, respectively. These parameters are compatible with earthquakes of magnitude equal or higher than 7 M, with an epicentral distance between 50 and 100 km from the Cacahuamilpa cave. The stalagmite rupture dated at 88.0 ± 0.7 ka might result from the invasion of the cave by one of the older lahars deposits of the nearby volcano Nevado del Toluca, and successively fell by gravity instability.
Precision Deployable Mast for the SWOT KaRIn Instrument
National Aeronautics and Space Administration — Design and prototype a lightweight, precision-deployable mast for the Ka-band Radar Interferometer (KaRIn) antennas in the Surface Water and Ocean Topography (SWOT)...
The Potential for a Ka-band (32 GHz) Worldwide VLBI Network
Jacobs, C. S.; Bach, U.; Colomer, F.; Garcia-Miro, C.; Gomez-Gonzalez, J.; Gulyaev, S.; Horiuchi, S.; Ichikawa, R.; Kraus, A.; Kronschnabl, G.;
2012-01-01
Ka-band (32 GHz, 9mm) Very Long Baseline Interferometric (VLBI) networking has now begun and has tremendous potential for expansion over the next few years. Ka-band VLBI astrometry from NASA's Deep Space Network has already developed a catalog of 470 observable sources with highly accurate positions. Now, several antennas worldwide are planning or are considering adding Ka-band VLBI capability. Thus, there is now an opportunity to create a worldwide Ka-band network with potential for high resolution imaging and astrometry. With baselines approaching a Giga-lambda, a Ka-band network would be able to probe source structure at the nano-radian (200 as) level ( 100X better than Hubble) and thus gain insight into the astrophysics of the most compact regions of emission in active galactic nuclei. We discuss the advantages of Ka-band, show the known sources and candidates, simulate projected baseline (uv) coverage, and discuss potential radio frequency feeds. The combination of these elements demonstrates the feasibility of a worldwide Ka network within the next few years!
DEFF Research Database (Denmark)
Pilipenko, Olga; Abrahamsen, N.; Trubikhin, V. M.
2007-01-01
Petro- and paleomagnetic methods are applied to the study of the lower part of the Early Pleistocene Tuzla section on the Black Sea coast of the Taman Peninsula. This part of the section is composed of marine and lagoonal sediments deposited over the time interval 120-70 ka. The measured curves...... of the variation in the geomagnetic field inclination reveal an anomalous direction dated at ~110 ka which coincides with a similar anomalous direction in the Eltigen section (Ukraine) correlating with the Blake paleomagnetic event. The significant correlation between the time series NRM0.015/SIRM0.015 (Tuzla...
Predicting pKa for proteins using COSMO-RS
DEFF Research Database (Denmark)
Andersson, Martin Peter; Jensen, Jan Halborg; Stipp, Susan Louise Svane
2013-01-01
We have used the COSMO-RS implicit solvation method to calculate the equilibrium constants, pKa, for deprotonation of the acidic residues of the ovomucoid inhibitor protein, OMTKY3. The root mean square error for comparison with experimental data is only 0.5 pH units and the maximum error 0.8 p......H units. The results show that the accuracy of pKa prediction using COSMO-RS is as good for large biomolecules as it is for smaller inorganic and organic acids and that the method compares very well to previous pKa predictions of the OMTKY3 protein using Quantum Mechanics/Molecular Mechanics. Our approach...
BP180 dysfunction triggers spontaneous skin inflammation in mice.
Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi
2018-06-04
BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.
de la Sierra, Alejandro; Banegas, José R; Segura, Julián; Gorostidi, Manuel; Ruilope, Luis M
2012-04-01
Ambulatory blood pressure monitoring (ABPM) is superior to conventional BP measurement in predicting outcome, with baseline 24-h, daytime and night-time absolute values, as well as relative nocturnal decline, as powerful determinants of prognosis. We aimed to evaluate ABPM estimates on the appearance of cardiovascular events and mortality in a cohort of high-risk treated hypertensive patients. A total of 2115 treated hypertensive patients with high or very high added risk were evaluated by means of office and 24-h ABPM. Cardiovascular events and mortality were assessed after a median follow-up of 4 years. Two hundred and sixty-eight patients (12.7%) experienced a primary event (nonfatal coronary or cerebrovascular event, heart failure hospitalization or cardiovascular death) and 114 died (45 from cardiovascular causes). In a multiple Cox regression model, and after adjusting for baseline cardiovascular risk and office BP, night-time SBP predicted cardiovascular events [hazard ratio for each SD increase: 1.45; 95% confidence interval (CI) 1.29-1.59]. Values above 130 mmHg increased the risk by 52% in comparison to values less than 115 mmHg. In addition to clinical determinants of cardiovascular risk and conventional BP, ABPM performed during treatment adds prognostic significance on the development of cardiovascular events in high-risk hypertensive patients. Among different ABPM-derived values, night-time SBP is the most potent predictor of outcome.
Snovanje in konstruiranje nadstreška za lahka gospodarska vozila
Čirić, Sebastijan
2015-01-01
Diplomska naloga opisuje primer snovanja in konstruiranja nadstreška za lahka gospodarska vozila. Naloga vsebuje statični preračun nadstreška sprogramom Scia Engineer 2011.1 in izdelavo modela nadstreška ter tehnično dokumentacijo v programu Pro Engineer 5.0. Rezultati statičnega preračuna so analizirane vrednosti povesa in napetosti.
BP - bisnis põhjas? / Erik Aru
Aru, Erik
2010-01-01
Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris
Multivalent display of the antimicrobial peptides BP100 and BP143
Directory of Open Access Journals (Sweden)
Imma Güell
2012-12-01
Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.
Late Pleistocene - Holocene surface processes and landscape evolution in the central Swiss Alps
Boxleitner, Max; Musso, Alessandra; Waroszewski, Jarosław; Malkiewicz, Małgorzata; Maisch, Max; Dahms, Dennis; Brandová, Dagmar; Christl, Marcus; de Castro Portes, Raquel; Egli, Markus
2017-10-01
The European Alps are a geomorphologically active region and experience a number of gravity-driven hillslope processes. Soil and landscape formation in the Alps has consequently undergone several minor and major traceable changes of developmental trajectories during the Holocene. Soil development is hypothesised to be often non-linear with time and characterised by stages of progressive and regressive evolution caused by upbuilding (formation, profile deepening) and erosion (profile shallowing). Several cold and warm climate phases are identified during the Holocene but it is largely unknown which effects these might have had on slope processes. By using datable moraines (10Be) and mires (14C), we have constructed a temporal framework for these processes. Using the geochemical imprint of mires in the Alpine setting of the Göschener-valley of the Central Swiss Alps, we reconstructed general (mostly erosional) landscape processes for the last ca. 10 ka. As this is the type locality for the Göschener cold phase, we assumed that this phase (Göschener cold phase I and II 1.5 and 2.5 ka BP) should have left easily recognizable traits. After deglaciation (11-12 ka BP), soil evolution was progressive. Beginning around 8 ka BP, we detect a distinct increase in erosion here, together with a vegetation change (towards tundra vegetation) and the highest measured rates of carbon sequestration. Other phases of high geomorphic activity were recognised ca. 5-6 ka BP, 4 ka BP and, to a lesser extent, 1-3 ka ago. The cold phase at 5-6 ka BP corresponds to a less distinct change in vegetation and lessened erosion. Human impact is increasingly obvious since about 2.4 ka BP which overlaps with the Göschener cold phase. Nonetheless, erosion processes were not extraordinarily high during this period and a climate effect cannot be distinguished. We detect evidence of increasing human disturbance (regressive soil evolution) for about the last 1 ka. We also detect an increase in dust
Palaeocirculation across New Zealand during the last glacial maximum at ˜21 ka
Lorrey, Andrew M.; Vandergoes, Marcus; Almond, Peter; Renwick, James; Stephens, Tom; Bostock, Helen; Mackintosh, Andrew; Newnham, Rewi; Williams, Paul W.; Ackerley, Duncan; Neil, Helen; Fowler, Anthony M.
2012-03-01
What circulation pattern drove Southern Alps glacial advances at ˜21 ka? Late 20th century glacial advances in New Zealand are commonly attributed to a dual precipitation increase and cooler than normal temperatures associated with enhanced westerly flow that occur under synoptic pressure patterns termed 'zonal' regimes (Kidson, 2000). But was the circulation pattern that supported major Southern Alps glacial advances during the global LGM similar to the modern analog? Here, a Regional Climate Regime Classification (RCRC) time slice was used to infer past circulation for New Zealand during the LGM at ˜21 ka. Palaeoclimate information that supported the construction of the ˜21 ka time slice was derived from the NZ-INTIMATE Climate Event Stratigraphy (CES), one new Auckland maar proxy record, and additional low-resolution data sourced from the literature. The terrestrial evidence at ˜21 ka implicates several possibilities for past circulation, depending on how interpretations for some proxies are made. The interpretation considered most tenable for the LGM, based on the agreement between terrestrial evidence, marine reconstructions and palaeoclimate model results is an 'anticyclonic/zonal' circulation regime characterized by increased influences from blocking 'highs' over the South Island during winter and an increase in zonal and trough synoptic types (with southerly to westerly quarter wind flow) during summer. These seasonal circulation traits would have generated lower mean annual temperatures, cooler than normal summer temperatures, and overall lower mean annual precipitation for New Zealand (particularly in the western South Island) at ˜21 ka. The anticyclonic/zonal time slice reconstruction presented in this study has different spatial traits than the late 20th Century and the early Little Ice Age signatures, suggesting more than one type of regional circulation pattern can drive Southern Alps glacial activity. This finding lends support to the hypothesis
Heinrich event 1: an example of dynamical ice-sheet reaction to oceanic changes
Directory of Open Access Journals (Sweden)
J. Álvarez-Solas
2011-11-01
Full Text Available Heinrich events, identified as enhanced ice-rafted detritus (IRD in North Atlantic deep sea sediments (Heinrich, 1988; Hemming, 2004 have classically been attributed to Laurentide ice-sheet (LIS instabilities (MacAyeal, 1993; Calov et al., 2002; Hulbe et al., 2004 and assumed to lead to important disruptions of the Atlantic meridional overturning circulation (AMOC and North Atlantic deep water (NADW formation. However, recent paleoclimate data have revealed that most of these events probably occurred after the AMOC had already slowed down or/and NADW largely collapsed, within about a thousand years (Hall et al., 2006; Hemming, 2004; Jonkers et al., 2010; Roche et al., 2004, implying that the initial AMOC reduction could not have been caused by the Heinrich events themselves.
Here we propose an alternative driving mechanism, specifically for Heinrich event 1 (H1; 18 to 15 ka BP, by which North Atlantic ocean circulation changes are found to have strong impacts on LIS dynamics. By combining simulations with a coupled climate model and a three-dimensional ice sheet model, our study illustrates how reduced NADW and AMOC weakening lead to a subsurface warming in the Nordic and Labrador Seas resulting in rapid melting of the Hudson Strait and Labrador ice shelves. Lack of buttressing by the ice shelves implies a substantial ice-stream acceleration, enhanced ice-discharge and sea level rise, with peak values 500–1500 yr after the initial AMOC reduction. Our scenario modifies the previous paradigm of H1 by solving the paradox of its occurrence during a cold surface period, and highlights the importance of taking into account the effects of oceanic circulation on ice-sheets dynamics in order to elucidate the triggering mechanism of Heinrich events.
2003-01-01
This document concerns the award of a contract for the supply of 13 kA and 20.5 kA, 18 V switched-mode power converters using sub-converters of 3.25 kA. Following a market survey (MS-2866/SL/LHC) carried out among 81 firms in seventeen Member States and a call for tenders for prototypes (IT-2919/SL/LHC) sent on 11 June 2001, a call for tenders for the supply of the pre-series and series of 13 kA and 20.5 kA, 18 V switched-mode power converters both using sub-converters of 3.25 kA was sent to two firms on 17 September 2002. The Finance Committee is invited to agree to the negotiation of a contract with TRANSTECHNIK (DE), the only firm that has delivered a successfully qualifying prototype, for the supply of eighteen 13 kA and one 20.5 kA, 18 V switched-mode power converters and spares for a total amount of 4 607 731 euros (6 747 300 Swiss francs), not subject to revision. The rate of exchange used is that stipulated in the tender. The firm has indicated the following distribution by country of the contract val...
Kario, Kazuomi
There are notable differences between Asians and Westerners regarding hypertension (HTN) and the relationship between HTN and cardiovascular disease (CVD). Asians show greater morning surges in blood pressure (BP) and a steeper slope illustrating the link between higher BP and the risk of CVD events. It is thus particularly important for Asian hypertensives to achieve 24-h BP control, including morning and night-time control. There are three components of 'perfect 24-h BP control:' the 24-h BP level, nocturnal BP dipping, and BP variability (BPV), such as the morning BP surge that can be assessed by ambulatory BP monitoring. The morning BP-guided approach using home BP monitoring (HBPM) is the first step toward perfect 24-h BP control, followed by the control of nocturnal HTN. We have been developing new HBPM devices that can measure nocturnal BP. BPV includes different time-phase variability from the shortest beat-by-beat, positional, diurnal, day-by-day, visit-to-visit, seasonal, and yearly changes. The synergistic resonance of each type of BPV would produce a great dynamic BP surge (resonance hypothesis), which triggers a CVD event, especially in the high-risk patients with systemic hemodynamic atherothrombotic syndrome (SHATS). In the future, the innovative management of HTN based on the simultaneous assessment of the resonance of all of the BPV phenotypes using a beat by beat wearable 'surge' BP monitoring device (WSP) and an information and communication technology (ICT)-based data analysis system will produce a paradigm shift from 'dots' BP management to 'seamless' ultimate individualized 'anticipation medication' for reaching a zero CVD event rate. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
BP report of the business year 1979
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.
Face recognition based on improved BP neural network
Directory of Open Access Journals (Sweden)
Yue Gaili
2017-01-01
Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.
Paleointensities on 8 ka obsidian from Mayor Island, New Zealand
Directory of Open Access Journals (Sweden)
A. Ferk
2011-11-01
Full Text Available The 8 ka BP (6050 BCE pantelleritic obsidian flow on Mayor Island, Bay of Plenty, New Zealand, has been investigated using 30 samples from two sites. Due to a very high paramagnetic/ferromagnetic ratio, it was not possible to determine the remanence carriers. This is despite the fact that the samples were studied intensively at low, room, and high temperatures. We infer that a stable remanence within the samples is carried by single- or close to single-domain particles. Experiments to determine the anisotropy of thermoremanence tensor and the dependency on cooling rate were hampered due to alteration resulting from the repeated heating of the samples to temperatures just below the glass transition. Nonetheless, a well-defined mean paleointensity of 57.0 ± 1.0 μT, based on individual high quality paleointensity determinations, was obtained. This field value compares very well to a paleointensity of 58.1 ± 2.9 μT, which Tanaka et al. (2009 obtained for 5500 BCE at a site 100 km distant. Agreement with geomagnetic field models, however, is poor. Thus, gathering more high-quality paleointensity data for the Pacific region and for the southern hemisphere in general to better constrain global field models is very important.
Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G
2011-10-01
The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.
Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.
Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R
2012-10-01
The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Nimick, David A.; Mcgrath, Daniel; Mahan, Shannon; Friesen, Beverly A.; Leidich, Jonathan
2016-01-01
The Northern Patagonia Icefield (NPI) is the primary glaciated terrain worldwide at its latitude (46.5–47.5°S), and constraining its glacial history provides unique information for reconstructing Southern Hemisphere paleoclimate. The Colonia Glacier is the largest outlet glacier draining the eastern NPI. Ages were determined using dendrochronology, lichenometry, radiocarbon, cosmogenic 10Be and optically stimulated luminescence. Dated moraines in the Colonia valley defined advances at 13.2 ± 0.95, 11.0 ± 0.47 and 4.96 ± 0.21 ka, with the last being the first constraint on the onset of Neoglaciation for the eastern NPI from a directly dated landform. Dating in the tributary Cachet valley, which contains an ice-dammed lake during periods of Colonia Glacier expansion, defined an advance at ca. 2.95 ± 0.21 ka, periods of advancement at 810 ± 49 cal a BP and 245 ± 13 cal a BP, and retreat during the intervening periods. Recent Colonia Glacier thinning, which began in the late 1800s, opened a lower-elevation outlet channel for Lago Cachet Dos in ca. 1960. Our data provide the most comprehensive set of Latest Pleistocene and Holocene ages for a single NPI outlet glacier and expand previously developed NPI glacial chronologies.
Acevedo, Julyana; Yan, Shan; Michael, W. Matthew
2016-01-01
A critical event for the ability of cells to tolerate DNA damage and replication stress is activation of the ATR kinase. ATR activation is dependent on the BRCT (BRCA1 C terminus) repeat-containing protein TopBP1. Previous work has shown that recruitment of TopBP1 to sites of DNA damage and stalled replication forks is necessary for downstream events in ATR activation; however, the mechanism for this recruitment was not known. Here, we use protein binding assays and functional studies in Xenopus egg extracts to show that TopBP1 makes a direct interaction, via its BRCT2 domain, with RPA-coated single-stranded DNA. We identify a point mutant that abrogates this interaction and show that this mutant fails to accumulate at sites of DNA damage and that the mutant cannot activate ATR. These data thus supply a mechanism for how the critical ATR activator, TopBP1, senses DNA damage and stalled replication forks to initiate assembly of checkpoint signaling complexes. PMID:27129245
Genetic stratigraphy of key demographic events in Arabia.
Fernandes, Verónica; Triska, Petr; Pereira, Joana B; Alshamali, Farida; Rito, Teresa; Machado, Alison; Fajkošová, Zuzana; Cavadas, Bruno; Černý, Viktor; Soares, Pedro; Richards, Martin B; Pereira, Luísa
2015-01-01
At the crossroads between Africa and Eurasia, Arabia is necessarily a melting pot, its peoples enriched by successive gene flow over the generations. Estimating the timing and impact of these multiple migrations are important steps in reconstructing the key demographic events in the human history. However, current methods based on genome-wide information identify admixture events inefficiently, tending to estimate only the more recent ages, as here in the case of admixture events across the Red Sea (~8-37 generations for African input into Arabia, and 30-90 generations for "back-to-Africa" migrations). An mtDNA-based founder analysis, corroborated by detailed analysis of the whole-mtDNA genome, affords an alternative means by which to identify, date and quantify multiple migration events at greater time depths, across the full range of modern human history, albeit for the maternal line of descent only. In Arabia, this approach enables us to infer several major pulses of dispersal between the Near East and Arabia, most likely via the Gulf corridor. Although some relict lineages survive in Arabia from the time of the out-of-Africa dispersal, 60 ka, the major episodes in the peopling of the Peninsula took place from north to south in the Late Glacial and, to a lesser extent, the immediate post-glacial/Neolithic. Exchanges across the Red Sea were mainly due to the Arab slave trade and maritime dominance (from ~2.5 ka to very recent times), but had already begun by the early Holocene, fuelled by the establishment of maritime networks since ~8 ka. The main "back-to-Africa" migrations, again undetected by genome-wide dating analyses, occurred in the Late Glacial period for introductions into eastern Africa, whilst the Neolithic was more significant for migrations towards North Africa.
Digital Repository Service at National Institute of Oceanography (India)
Rao, V.P.
sands (pelletal/oolitic sediments) and aragonite-cemented limestones, oyster shells, corals, coralline-algal and foraminiferal-dominated nodules. The petrology and mineralogy of the deposits indicate that except for aragonite sands and foraminiferal... pellets while others are ooilte- dominated. The age of the sands ranges between 14.3 ka to 7.6 cal kaBP. The limestones associated with the platform exhibit acicular aragonite cements and their ages lie between 11 ka and 13.3 kaBP. Large oyster shells...
Origin of the pKa shift of the catalytic lysine in acetoacetate decarboxylase.
Ishikita, Hiroshi
2010-01-01
The pKa value of Lys115, the catalytic residue in acetoacetate decarboxylate, was calculated using atomic coordinates of the X-ray crystal structure with consideration of the protonation states of all titratable sites in the protein. The calculated pKa value of Lys115 (pKa(Lys115)) was unusually low (approximately 6) in agreement with the experimentally measured value. Although charged residues impact pKa(Lys115) considerably in the native protein, the significant pKa(Lys115) downshift in the...
Computing pKa Values in Different Solvents by Electrostatic Transformation.
Rossini, Emanuele; Netz, Roland R; Knapp, Ernst-Walter
2016-07-12
We introduce a method that requires only moderate computational effort to compute pKa values of small molecules in different solvents with an average accuracy of better than 0.7 pH units. With a known pKa value in one solvent, the electrostatic transform method computes the pKa value in any other solvent if the proton solvation energy is known in both considered solvents. To apply the electrostatic transform method to a molecule, the electrostatic solvation energies of the protonated and deprotonated molecular species are computed in the two considered solvents using a dielectric continuum to describe the solvent. This is demonstrated for 30 molecules belonging to 10 different molecular families by considering 77 measured pKa values in 4 different solvents: water, acetonitrile, dimethyl sulfoxide, and methanol. The electrostatic transform method can be applied to any other solvent if the proton solvation energy is known. It is exclusively based on physicochemical principles, not using any empirical fetch factors or explicit solvent molecules, to obtain agreement with measured pKa values and is therefore ready to be generalized to other solute molecules and solvents. From the computed pKa values, we obtained relative proton solvation energies, which agree very well with the proton solvation energies computed recently by ab initio methods, and used these energies in the present study.
The interglacial-glacial record at the mouth of Scoresby Sund, East Greenland
DEFF Research Database (Denmark)
Mangerud, Jan; Funder, Svend Visby
1994-01-01
Brewster (facing the open ocean) and till on top of the interglacial beds at Kikiakajik show that both an outlet from the Greenland Ice Sheet, and more local glaciers reached the continental shelf during the Weichselian. This glacial event is poorly dated, but tentatively correlated with the Flakkerhuk...... interglaciation ( "" isotope substage Se) on the basis of mollusc assemblages and luminescence dates. Abundant Balal/lls Crel/atlls, and several bivalves, show that the advection of warm Atlantic water to the East Greenland coast was higher during that interglacial than during the Holocene. Glacial striae at Kap...... stade ( "" 19-15 ka BP) when, from marine geological data, it is suggested that the Scoresby Sund glacier terminated c. 30 km east of Kap Brewster. During the Milne Land stade (c. 10 ka BP) there was a resurgence of local ice caps in the mountains both north and south of the fjord mouth, but Scoresby...
Ka-band microwave generation using the Smith-Purcell effect
International Nuclear Information System (INIS)
Ekdahl, C.A.; Davis, H.A.
1983-01-01
The CERETRON microwave generator concept relies on the conversion of intense relativistic electron beam (REB) energy into highpower microwave emission through the Smith-Purcell effect. We report initial results from experiments with the production of Ka-band Smith-Purcell radiation generated by a 50-kA, 2.8-MeV beam propagated through a cylindrical transmission grating with lambda 0 = 1 cm. These experiments were performed without a quasi-optical resonator, and the output was limited by breakdown of the grating and by limited access through the 90-kG magnet coil. Nevertheless, the measured power output from these initial experiments was about 7 kW in the Ka band
Rapid climate variability during warm and cold periods in polar regions and Europe
DEFF Research Database (Denmark)
Masson-Delmotte, V.; Landais, A.; Combourieu-Nebout, N.
2005-01-01
Typical rapid climate events punctuating the last glacial period in Greenland, Europe and Antarctica are compared to two rapid events occurring under warmer conditions: (i) Dansgaard-Oeschger event 25, the first abrupt warming occurring during last glacial inception; (ii) 8.2 ka BP event, the only...... rapid cooling recorded during the Holocene in Greenland ice cores and in Ammersee, Germany. The rate of warming during previous warmer interglacial periods is estimated from polar ice cores to 1.5 °C per millennium, without abrupt changes. Climate change expected for the 21st century should however...
Studying NASA's Transition to Ka-Band Communications for Low Earth Orbit
Chelmins, David T.; Reinhart, Richard C.; Mortensen, Dale; Welch, Bryan; Downey, Joseph; Evans, Michael
2014-01-01
As the S-band spectrum becomes crowded, future space missions will need to consider moving command and telemetry services to Ka-band. NASA's Space Communications and Navigation (SCaN) Testbed provides a software-defined radio (SDR) platform that is capable of supporting investigation of this service transition. The testbed contains two S-band SDRs and one Ka-band SDR. Over the past year, SCaN Testbed has demonstrated Ka-band communications capabilities with NASAs Tracking and Data Relay Satellite System (TDRSS) using both open- and closed-loop antenna tracking profiles. A number of technical areas need to be addressed for successful transition to Ka-band. The smaller antenna beamwidth at Ka-band increases the criticality of antenna pointing, necessitating closed loop tracking algorithms and new techniques for received power estimation. Additionally, the antenna pointing routines require enhanced knowledge of spacecraft position and attitude for initial acquisition, versus an S-band antenna. Ka-band provides a number of technical advantages for bulk data transfer. Unlike at S-band, a larger bandwidth may be available for space missions, allowing increased data rates. The potential for high rate data transfer can also be extended for direct-to-ground links through use of variable or adaptive coding and modulation. Specific examples of Ka-band research from SCaN Testbeds first year of operation will be cited, such as communications link performance with TDRSS, and the effects of truss flexure on antenna pointing.
Kanegelo ya Nimirode: Re lebelela diphihlelelo t�a gagwe ka lefsa
Directory of Open Access Journals (Sweden)
Elelwani B. Farisani
2011-03-01
Full Text Available Kanegelo ya Hama/Nimirode e �omi�it�we go gatelela Bathobaso ba Afrika-Borwa le ba Amerika. Taodi�wana ye e lekola Nimirode ka lefsa le go t�ea magato a go bu�et�a seriti sa gagwe le sa Bathobaso sekeng.Seo se tlo dirwa ka dikgato t�e tlhano ka mo tlase. Sa mathomo, re tlo lekola dimelo t�a bana ba Noage, go kwe�i�a Nimirode, yo e lego yena �edi ye kgolo ya taodi�wana ye. Sa bobedi re tlo lebelela ka fao bangwadi ba bangwe ba t�welet�ago seswant�ho sa go befa sa Nimirode. Sa boraro, re tlo sekaseka tiri�o ya kanegelo ya Hama/Nimirode go gatelela le go dira Bathobaso makgoba. Sa bone, re tlo sekaseka diphihlelelo le dikatlego t�a Nimirode. Mo re tlo tsepelela diphihlelelo t�a gagwe t�e tharo t�e kgolo bjalo ka go ba mmu�i wa maemo, motsomi yo maatla le moagi. Nepo ya karolo ye ke go ganet�ana le tshekatsheko ya go se be botse ye e nepilwego Nimirode nakong ya go feta. Re tlo tlalelet�a ka go fa tshekatsheko ye e tebilego ya thogako godimo ga Hama/Ku�e/Nimirode. Sa bohlano, ebile e le sa mafelelo, re tlo t�welet�a nyanyeng bohlokwa bja kanegelo ya Nimirode go bao ba bego ba gatelet�we le go ba makgoba ka baka la temana ye. Re tlo nepi�a Afrika-Borwa.
Tan, Liangcheng; Cai, Yanjun; Cheng, Hai; Edwards, Lawrence R.; Gao, Yongli; Xu, Hai; Zhang, Haiwei; An, Zhisheng
2018-01-01
The upper Hanjiang River region is the recharge area of the middle route of South-to-North Water Transfer Project. The region is under construction of the Hanjiang-Weihe River Water Transfer Project in China. Monsoon precipitation variations in this region are critical to water resource and security of China. In this study, high-resolution monsoon precipitation variations were reconstructed in the upper Hanjiang River region over the past 6650 years from δ18O and δ13C records of four stalagmites in Xianglong cave. The long term increasing trend of stalagmite δ18O record since the middle Holocene is consistent with other speleothem records from monsoonal China. This trend follows the gradually decreasing Northern Hemisphere summer insolation, which indicates that solar insolation may control the orbital-scale East Asian summer monsoon (EASM) variations. Despite the declined EASM intensity since the middle Holocene, local precipitation may not have decreased remarkably, as revealed by the δ13C records. A series of centennial- to decadal-scale cyclicity was observed, with quasi-millennium-, quasi-century-, 57-, 36- and 22-year cycles by removing the long-term trend of stalagmite δ18O record. Increased monsoon precipitation during periods of 4390-3800 a BP, 3590-2960 a BP, 2050-1670 a BP and 1110-790 a BP had caused four super-floods in the upper reach of Hanjiang River. Dramatically dry climate existed in this region during the 5.0 ka and 2.8 ka events, coinciding with notable droughts in other regions of monsoonal China. Remarkably intensified and southward Westerly jet, together with weakened summer monsoon, may delay the onset of rainy seasons, resulting in synchronous decreasing of monsoon precipitation in China during the two events. During the 4.2 ka event and the Little Ice Age, the upper Hanjiang River region was wet, which was similar to the climate conditions in central and southern China, but was the opposite of drought observed in northern China. We
Feature extraction and sensor selection for NPP initiating event identification
International Nuclear Information System (INIS)
Lin, Ting-Han; Wu, Shun-Chi; Chen, Kuang-You; Chou, Hwai-Pwu
2017-01-01
Highlights: • A two-stage feature extraction scheme for NPP initiating event identification. • With stBP, interrelations among the sensors can be retained for identification. • With dSFS, sensors that are crucial for identification can be efficiently selected. • Efficacy of the scheme is illustrated with data from the Maanshan NPP simulator. - Abstract: Initiating event identification is essential in managing nuclear power plant (NPP) severe accidents. In this paper, a novel two-stage feature extraction scheme that incorporates the proposed sensor type-wise block projection (stBP) and deflatable sequential forward selection (dSFS) is used to elicit the discriminant information in the data obtained from various NPP sensors to facilitate event identification. With the stBP, the primal features can be extracted without eliminating the interrelations among the sensors of the same type. The extracted features are then subjected to a further dimensionality reduction by selecting the sensors that are most relevant to the events under consideration. This selection is not easy, and a combinatorial optimization technique is normally required. With the dSFS, an optimal sensor set can be found with less computational load. Moreover, its sensor deflation stage allows sensors in the preselected set to be iteratively refined to avoid being trapped into a local optimum. Results from detailed experiments containing data of 12 event categories and a total of 112 events generated with a Taiwan’s Maanshan NPP simulator are presented to illustrate the efficacy of the proposed scheme.
Sea-Level Change in the Russian Arctic Since the Last Glacial Maximum
Horton, B.; Baranskaya, A.; Khan, N.; Romanenko, F. A.
2017-12-01
Relative sea-level (RSL) databases that span the Last Glacial Maximum (LGM) to present have been used to infer changes in climate, regional ice sheet variations, the rate and geographic source of meltwater influx, and the rheological structure of the solid Earth. Here, we have produced a quality-controlled RSL database for the Russian Arctic since the LGM. The database contains 394 index points, which locate the position of RSL in time and space, and 244 limiting points, which constrain the minimum or maximum limit of former sea level. In the western part of the Russian Arctic (Barents and White seas,) RSL was driven by glacial isostatic adjustment (GIA) due to deglaciation of the Scandinavian ice sheet, which covered the Baltic crystalline shield at the LGM. RSL data from isolation basins show rapid RSL from 80-100 m at 11-12 ka BP to 15-25 m at 4-5 ka BP. In the Arctic Islands of Franz-Joseph Land and Novaya Zemlya, RSL data from dated driftwood in raised beaches show a gradual fall from 25-35 m at 9-10 ka BP to 5-10 m at 3 ka BP. In the Russian plain, situated at the margins of the formerly glaciated Baltic crystalline shield, RSL data from raised beaches and isolation basins show an early Holocene rise from less than -20 m at 9-11 ka BP before falling in the late Holocene, illustrating the complex interplay between ice-equivalent meltwater input and GIA. The Western Siberian Arctic (Yamal and Gydan Peninsulas, Beliy Island and islands of the Kara Sea) was not glaciated at the LGM. Sea-level data from marine and salt-marsh deposits show RSL rise at the beginning of the Holocene to a mid-Holocene highstand of 1-5 m at 5-1 ka BP. A similar, but more complex RSL pattern is shown for Eastern Siberia. RSL data from the Laptev Sea shelf show RSL at -40- -45 m and 11-14 ka BP. RSL data from the Lena Delta and Tiksi region have a highstand from 5 to 1 ka BP. The research is supported by RSF project 17-77-10130
Assembly of human C-terminal binding protein (CtBP) into tetramers.
Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E
2018-06-08
C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.
Directory of Open Access Journals (Sweden)
Greenfield Sheila
2010-08-01
Full Text Available Abstract Background Blood pressure (BP lowering in people who have had a stroke or transient ischaemic attack (TIA leads to reduced risk of further stroke. However, it is not clear what the target BP should be, since intensification of therapy may lead to additional adverse effects. PAST BP will determine whether more intensive BP targets can be achieved in a primary care setting, and whether more intensive therapy is associated with adverse effects on quality of life. Methods/Design This is a randomised controlled trial (RCT in patients with a past history of stroke or TIA. Patients will be randomised to two groups and will either have their blood pressure (BP lowered intensively to a target of 130 mmHg systolic, (or by 10 mmHg if the baseline systolic pressure is between 125 and 140 mmHg compared to a standard group where the BP will be reduced to a target of 140 mmHg systolic. Patients will be managed by their practice at 1-3 month intervals depending on level of BP and followed-up by the research team at six monthly intervals for 12 months. 610 patients will be recruited from approximately 50 general practices. The following exclusion criteria will be applied: systolic BP The primary outcome will be change in systolic BP over twelve months. Secondary outcomes include quality of life, adverse events and cardiovascular events. In-depth interviews with 30 patients and 20 health care practitioners will be undertaken to investigate patient and healthcare professionals understanding and views of BP management. Discussion The results of this trial will inform whether intensive blood pressure targets can be achieved in people who have had a stroke or TIA in primary care, and help determine whether or not further research is required before recommending such targets for this population. Trial Registration ISRCTN29062286
Schultz, Martin G; Otahal, Petr; Cleland, Verity J; Blizzard, Leigh; Marwick, Thomas H; Sharman, James E
2013-03-01
The prognostic relevance of a hypertensive response to exercise (HRE) is ill-defined in individuals undergoing exercise stress testing. The study described here was intended to provide a systematic review and meta-analysis of published literature to determine the value of exercise-related blood pressure (BP) (independent of office BP) for predicting cardiovascular (CV) events and mortality. Online databases were searched for published longitudinal studies reporting exercise-related BP and CV events and mortality rates. We identified for review 12 longitudinal studies with a total of 46,314 individuals without significant coronary artery disease, with total CV event and mortality rates recorded over a mean follow-up of 15.2±4.0 years. After adjustment for age, office BP, and CV risk factors, an HRE at moderate exercise intensity carried a 36% greater rate of CV events and mortality (95% CI, 1.02-1.83, P = 0.039) than that of subjects without an HRE. Additionally, each 10mm Hg increase in systolic BP during exercise at moderate intensity was accompanied by a 4% increase in CV events and mortality, independent of office BP, age, or CV risk factors (95% CI, 1.01-1.07, P = 0.02). Systolic BP at maximal workload was not significantly associated with the outcome of an increased rate of CV, whether analyzed as a categorical (HR=1.49, 95% CI, 0.90-2.46, P = 0.12) or a continuous (HR=1.01, 95% CI, 0.98-1.04, P = 0.53) variable. An HRE at moderate exercise intensity during exercise stress testing is an independent risk factor for CV events and mortality. This highlights the need to determine underlying pathophysiological mechanisms of exercise-induced hypertension.
Updating and test on 12 kA HTSCL for Russia JINR
International Nuclear Information System (INIS)
Zhou, Tingzhi; Ding, K; Liu, C; Xu, C; Feng, H; Wu, H; Liu, X; Song, Y
2014-01-01
The Joint Institute for Nuclear Research (JINR) started manufacture and test of superconducting magnets for the new accelerator complex Nuclotron-based Ion Collider fAcility (NICA). A pair of current leads rated 12 kA was developed for cold testing of the magnets in 2012. The operation of the facility needs ∼350 leads rated from 100 A to 12 kA to convey current for the magnets. After the test of the pair of 12 kA leads in JINR a contract of supplying 3 pairs of 12 kA high temperature superconducting current leads (HTSCLs) were signed to ASIPP this year. In this paper the design updating and test of the current leads are introduced.
Around and beyond 53BP1 Nuclear Bodies.
Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys
2017-12-05
Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Around and beyond 53BP1 Nuclear Bodies
Directory of Open Access Journals (Sweden)
Anne Fernandez-Vidal
2017-12-01
Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.
Challenges in pKa Predictions for Proteins: The case of Asp213 in Human Proteinase 3
Hajjar, Eric; Dejaegere, Annick; Reuter, Nathalie
2009-09-01
Knowledge of the protonation states of the ionizable residues in an enzyme is a prerequisite to an accurate description of its structure and mechanism. In practice, the use of the inappropriate protonation state for an amino acid in a molecular modeling computation (e.g., molecular dynamics simulation) is likely to lead to unrealistic results. Although methods using solvers of the linearized Poisson-Boltzmann equation have proven to yield accurate pKa predictions, they bear a number of limitations. They are quite demanding in terms of computational power and are sensitive to representation of the charges and their position (force field and protein conformation). Moreover they depend on the choice of a dielectric constant for the protein interior. In this manuscript, we describe the difficulties met when trying to predict the protonation state of a buried amino acid, located in a protein for which very little biochemical data is available. Such a case is highly representative of the challenges faced in theoretical biology studies. Proteinase 3 (PR3) is an enzyme involved in proteolytic events associated with inflammation. It is a potential target in the development of new anti-inflammatory therapeutic strategies. We report the results of pKa predictions of the aspartic acid 213 of PR3 with a FDPB solver. We probed the influence of the choice of the dielectric constant for the protein interior ɛp and the benefits of conformational sampling by molecular dynamics (MD) on the pKa prediction of this carboxylate group. Using only the FDPB calculations, we could not conclude on the protonation state of Asp213. MD simulations confronted to knowledge of the ligand-binding and reaction mechanism led us to decide on a protonated form of this aspartic acid. We also demonstrate that the use of the wrong protonation state leads to an unreliable structural model for PR3. pKa prediction with a fast empirical method yielded a pKa of 8.4 for Asp213, which is in agreement with our
Hou, G.; Li, F.; Zhu, Y.
2017-12-01
XDW2 is an important microlithic cultural relics with continuous stratum that is located in the the Tibetan plateau at above 4,000 masl, wich is a window of revealing the evolution of early human activities and the response and adaptation to extreme environmental in the principal part of Tibetan plateau. So it has important research significance. The analysis on human activity indicator(stoneware, potsherds) and environmental indicators(magnetic susceptibility, color, granularity and pollen) showed: the winter wind and dust storm intensity is weak in this area during 7.0-6 cal. Ka BP, pedogenesis is strong, the climate is humid, environment is suitable relatively, when is Holocene Megathermal; the active phase of microlithic human activities occurred during 7.2-6 cal. ka BP, and quickly weakened after 6 cal. ka BP. The number of stone tools reveal that human activities are concentrated before and after 7-6.2 cal. ka BP, charcoal fragmental concentration indicates that microlithic human activity reached the peak at around 6.7 cal. ka BP. Thus relatively suitable environment during Holocene Megathermal is the important motivating factor of active hunter-gatherer activities in the principal part of Tibetan plateau. After 6 cal. ka BP, summer monsoon weakened rapidly, agricultural growers in the Loess Plateau began to expand towards the plateau, under the effect of environmental degradation and new technologies, microlithic hunter-gatherers in the principal part of plateau moved towards the river valley at low altitude, and learnt settlement and plantation, microlithic activity in the main plateau began to decline.
Directory of Open Access Journals (Sweden)
I. Dormoy
2009-10-01
Full Text Available Pollen-based climate reconstructions were performed on two high-resolution pollen marines cores from the Alboran and Aegean Seas in order to unravel the climatic variability in the coastal settings of the Mediterranean region between 15 000 and 4000 years BP (the Lateglacial, and early to mid-Holocene. The quantitative climate reconstructions for the Alboran and Aegean Sea records focus mainly on the reconstruction of the seasonality changes (temperatures and precipitation, a crucial parameter in the Mediterranean region. This study is based on a multi-method approach comprising 3 methods: the Modern Analogues Technique (MAT, the recent Non-Metric Multidimensional Scaling/Generalized Additive Model method (NMDS/GAM and Partial Least Squares regression (PLS. The climate signal inferred from this comparative approach confirms that cold and dry conditions prevailed in the Mediterranean region during the Oldest and Younger Dryas periods, while temperate conditions prevailed during the Bølling/Allerød and the Holocene. Our records suggest a West/East gradient of decreasing precipitation across the Mediterranean region during the cooler Late-glacial and early Holocene periods, similar to present-day conditions. Winter precipitation was highest during warm intervals and lowest during cooling phases. Several short-lived cool intervals (i.e. Older Dryas, another oscillation after this one (GI-1c2, Gerzensee/Preboreal Oscillations, 8.2 ka event, Bond events connected to the North Atlantic climate system are documented in the Alboran and Aegean Sea records indicating that the climate oscillations associated with the successive steps of the deglaciation in the North Atlantic area occurred in both the western and eastern Mediterranean regions. This observation confirms the presence of strong climatic linkages between the North Atlantic and Mediterranean regions.
On the development of protein pKa calculation algorithms
Carstensen, Tommy; Farrell, Damien; Huang, Yong; Baker, Nathan A.; Nielsen, Jens Erik
2011-01-01
Protein pKa calculation methods are developed partly to provide fast non-experimental estimates of the ionization constants of protein side chains. However, the most significant reason for developing such methods is that a good pKa calculation method is presumed to provide an accurate physical model of protein electrostatics, which can be applied in methods for drug design, protein design and other structure-based energy calculation methods. We explore the validity of this presumption by simulating the development of a pKa calculation method using artificial experimental data derived from a human-defined physical reality. We examine the ability of an RMSD-guided development protocol to retrieve the correct (artificial) physical reality and find that a rugged optimization landscape and a huge parameter space prevent the identification of the correct physical reality. We examine the importance of the training set in developing pKa calculation methods and investigate the effect of experimental noise on our ability to identify the correct physical reality, and find that both effects have a significant and detrimental impact on the physical reality of the optimal model identified. Our findings are of relevance to all structure-based methods for protein energy calculations and simulation, and have large implications for all types of current pKa calculation methods. Our analysis furthermore suggests that careful and extensive validation on many types of experimental data can go some way in making current models more realistic. PMID:21744393
Historical review of bryological research in Fruška Gora Mt. (Serbia
Directory of Open Access Journals (Sweden)
Ilić Miloš M.
2016-01-01
Full Text Available Fruška Gora is a mountain located in the southern part of Pannonian plane and it is poorly bryologicaly investigated as well as most parts of Serbia. First data on bryophytes, for this region, were published in 1949 by Teodor Soška in his paper Pregled mahovina i lišajeva u okolini Beograda (Review of mosses and lichens in the vicinity of Belgrade. Soška listed 34 species of mosses and 8 liverworts species for this region. Later, in 1955, Zlatko Pavletić in his capital work Prodromus flore briofita Jugoslavije (Prodromus of Yugoslavian bryophyte flora, stated 26 moss species and 3 liverwort species, without indicating specific localities, but all of them were Soška’s original results. In 1966, the second botanist with original findings of bryophytes on Fruška Gora was Popović, who recorded 2 liverwort and 19 moss species, for this mountain, also without specific localities. By far, the most comprehensive data were given by Cvetić and Sabovljević in 2004. Their study A contribution to the bryophyte flora of Fruška Gora (Vojvodina, Serbia counted total number of 118 mosses and 14 liverworts, on 16 localities within National park Fruška Gora. The latest study on bryophytes of Fruška Gora was in 2013, and it is the first and so far, the last study of bryophyte assemblages on grasslands. Authors of this paper recorded 18 species of mosses from 29 releveé. Complete bryophyte flora of Fruška Gora is still unknown. Considering the fact that this is the region with high biodiversity, dense hydrological network and a rather complex geology, Fruška Gora certainly deserves further bryological researches.
Ka-band waveguide rotary joint
Yevdokymov, Anatoliy; Sirenko, Kostyantyn; Kryzhanovskiy, Volodymyr; Pazynin, Vadim
2013-01-01
The authors present a design of a waveguide rotary joint operating in Ka-band with central frequency of 33 GHz, which also acts as an antenna mount. The main unit consists of two flanges with a clearance between them; one of the flanges has three
Amobilisasi Sel Bacillus licheniformis KA-08 dalam Menghasilkan Keratinase Termostabil
Directory of Open Access Journals (Sweden)
Anthoni Agustien
2012-10-01
Full Text Available Isolate local Bacillus licheniformis KA-08 known extracellular thermostable keratinase producers. Scale up of thermostable keratinase production can be with cells immobilized. The objective of the research is to thermostable keratinase production of B. licheniformis KA-08 cells immobilization. Thermostable keratinase activities were determined with modification of Brandelli and Riffel method. Protein concentration of enzyme determined with Lowry method. Immobilization of cells by Ca-alginate matrix with Adinarayana method, alginate concentration and amount of alginate bead effects with Beshay method. The result extracellular thermostable keratinase of B. licheniformis KA-08 cells immobilized was maximum produced at 12 times incubation with activity as 9.25 U/mg. Three percent alginate has optimum activity. Three hundred alginate beads has optimum activity. Cells immobilized ofB. licheniformis KA-08 has scale up of thermostable keratinase activity at 2 times than free cells. Thermostable keratinase produced by cell immobilized was nine cycles.
International Nuclear Information System (INIS)
Hayward, B.W.; Sabaa, A.T.; Grenfell, H.R.; Cochran, U.A.; Clark, K.J.; Litchfield, N.J.; Wallace, L.M.; Marden, M.; Palmer, A.S.
2015-01-01
Foraminiferal faunas in 29 short cores (maximum depth 7 m) of estuarine and coastal wetland sediment were used to reconstruct the middle-late Holocene (last 7 ka) elevational history on the southern shores of Poverty Bay, North Island, New Zealand. This coast is on the southwest side of a rapidly subsiding area beneath western Poverty Bay. Modern Analogue Technique paleo-elevation estimates based on fossil foraminiferal faunas indicate that the four study areas have gradual late Holocene (<3.5 ka) subsidence rates that increase from the southwest (mean c. 0.5 m ka - - 1 ) to northeast (mean c. 1.0 m ka -1 ). Only two rapid, possibly co-seismic, vertical displacement events are recognised: (1) c. 1.2 m of subsidence at 5.7 ± 0.4 ka (cal yr BP), which may have been generated by a subduction interface earthquake centred offshore and recorded in other published studies in northern Hawkes Bay, c. 35 km to the south; and (2) c. 1 m of uplift (relative sea-level fall) at c. 4.5 ± 0.3 ka, which might have been generated by rupture on an offshore upper plate fault that also uplifted coastal terraces at Pakarae and Mahia, 40 km to the north and south of the study area, or by rupture on the subduction interface penetrating beneath Poverty Bay. No sudden displacement events are recognised during the last 4 ka although subsidence, possibly aseismic, has continued. (author).
Determination of radiocarbon reservoir age of Lake Van by mineral magnetic and geochemical analysis
Makaroglu, Ozlem; Namik Cagatay, M.; Pesonen, Lauri J.; Orbay, Naci
2017-04-01
Lake Van is the largest soda lake in the world, located on the east Anatolian Plateau in Turkey. Its varved sediments provide an excellent archive of high-resolution paleoclimate record for the Near East. Varve counting and radiocarbon methods are therefore important dating techniques for investigating the Lake Van sedimentary paleoclimate record. In here we present detailed magnetic and geochemical record of Lake Van. We have studied 4.56 m (core VP0801) and 4.70 m (core VP0807) long cores recovered from 80 m and 65 m water depths located in SE and SW of Lake Van, respectively. Here, we have benefited from magnetic properties with associated remanent magnetization of the sediments from Lake Van to correlate the cores which contain of tephra layers. The cores cover the last 8.4 ka and lithologically include three laminated sedimentary units. From top to the bottom, the units were dated 4.2 ka BP-present, 5.4-4.2 ka BP and older than 5.4 ka BP. We identified tephra layers previously dated by varve counting, and used the varve ages to obtain age models for the cores. We also obtained a total of eight Accelerator Mass Spectrometry (AMS) 14C dates from total organic carbon (TOC) in the two cores, close to the tephra layers. Comparison of the varve ages of the AMS 14C dated samples with their corresponding AMS 14C dates indicates large differences, suggesting significant reservoir ages that range from 2.8 to 2.5 ka for 3.0-2.4 varve ka BP and from 2.8 to 3.3 ka for 8.0-5.9 varve ka BP. The results suggest that the reservoir age of the organic matter increases with the varve age of the sediments. This increase is mainly related to the rate of supply of "dead" carbon from the old carbonate rocks in the watershed of Lake Van, which was relatively higher during 8.4-5.9 ka than during 3.0-2.4 ka BP because of the higher atmospheric precipitation and higher rate of biochemical weathering during the former period.
Martinez, Philippe; Lamy, Frank; Robinson, Rebecca R.; Pichevin, Laetitia; Billy, Isabelle
2006-11-01
We report a nitrogen isotope record (ODP Site 1233) from the southern Chile margin at 41°S. The site is located slightly south of the southern boundary of the Peru-Chile upwelling system and the associated oxygen minimum zone off Peru and northern Chile. We show that our nitrogen isotope record, from the time interval 0-50 calendar kiloyears before present (ka B.P.), bears an atypical pattern both in shape and timing when compared with records obtained from either the continental margin of the eastern Pacific or the Subantarctic Zone (SAZ) of the Southern Ocean. The δ15N values at Site 1233 are relatively high throughout the record, varying between 9‰ and 13‰. The major features are a pronounced δ15N increase at the beginning of the deglaciation, a maximum from 19 to 10 ka B.P.; thereafter a large decrease during the early Holocene, and millenial scale oscillations showing an Antarctic timing. We propose that the record results from an amalgam of low-latitude and high-latitude processes. Low-latitude processes, including a stronger advection signal of heavy nitrates from the denitrifying zones off Peru and northern Chile, would explain the timing of the deglaciation rise and the heaviest values found over this interval, excluding the Antarctic Cold Reversal period. The overall differences between site 1233 and records from Peru and northwest American margins suggest however that the origin of the δ15N signal off Chile is largely controlled by hydrologic and climatic changes in the Southern Ocean. We propose that the interplay between nutrient demand in the SAZ and latitudinal shifts of hydrologic fronts controlled both the concentrations and the isotopic signature of the remaining nitrate delivered to the Chile margin. Then, the glacial surface waters of the southern Chile margin were likely lower in nitrate concentration and bear a higher δ15N than during interglacial periods.
Digital Repository Service at National Institute of Oceanography (India)
Rao, V.P; Kessarkar, P; Patil, S.K.; Ahmad, S.M.
. The sediments are dominated by fine-grained magnetite, but intervals of 1.2-3.8 kaBP and 10-13.5 kaBP were subjected to diagenetic changes, resulting in the dissolution of fine-grained magnetites and enrichment of redox-sensitive trace elements (Cu, Ni, Zn, V...
Qiang, Zhimin; Adams, Craig
2004-07-01
This work determined the acid dissociation constants (pKa) of 26 common human and veterinary antibiotics by potentiometric titration. Selected antibiotics consisted of sulfonamides, macrolides, tetracyclines, fluoroquinolones, and other miscellaneous antibiotics. After validation of analysis methods using phosphoric acid as a model compound, a second-derivative (delta2pH/deltaV2) method was primarily applied to determining pKa's from titration curves for most antibiotics due to its convenience and accuracy. For tetracyclines, however, a least-square non-linear regression method was developed to determine their pKa's because the second-derivative method cannot well distinguish the pKa,2 and pKa,3 of tetracyclines. Results indicate that the pKa values are approximately 2 and 5-7.5 for sulfonamides; 7.5-9 for macrolides; 3-4, 7-8 and 9-10 for tetracyclines; 3-4, 6, 7.5-9 and 10-11 for fluoroquinolones; while compound-specific for other miscellaneous antibiotics. The moieties corresponding to specific pKa's were identified based on chemical structures of antibiotics. In addition, the pKa's available in literature determined by various techniques are compiled in comparison with the values of this work. These results are expected to essentially facilitate the research on occurrence, fate and effects, analysis methods development, and control of antibiotics in various treatment operations.
AltiKa: a Ka-band Altimetry Payload and System for Operational Altimetry during the GMES Period
Directory of Open Access Journals (Sweden)
Jacques Verron
2006-03-01
Full Text Available This paper describes the Ka-band altimetry payload and system that has beenstudied for several years by CNES, ALCATEL SPACE and some science laboratories.Altimetry is one of the major elements of the ocean observing system to be madesustainable through the GEOSS (Global Earth Observation System of Systems and GMES(Global Monitoring of the Environment and Security programs. A short review of somemission objectives to be fulfilled in terms of mesoscale oceanography in the frame of theGEOSS and GMES programs is performed. To answer the corresponding requirements, theapproach consisting in a constellation of nadir altimeter is discussed. A coupled Ka-bandaltimeter-radiometer payload is then described; technical items are detailed to explain howthis payload shall meet the science and operational requirements, and expectedperformances are displayed. The current status of the payload development and flightperspectives are given.
Deployable Ka-Band Reflectarray, Phase I
National Aeronautics and Space Administration — Tyvak, in collaboration with UCLA, proposes a novel approach to the challenge of creating a large reflector for Ka-band high data rate links. We propose to attach...
Huang, Enqing; Tian, Jun; Qiao, Peijun; Wan, Sui; Xie, Xin; Yang, Wenguang
2015-10-01
A compilation of many late Quaternary marine sediment records from the northern South China Sea (SCS) continental slope confirms 15-50% reductions in sedimentary calcium carbonate concentrations between 11.0 and 8.5 ka BP in the early Holocene. This low carbonate% event occurred at a time when the regional sea level rose from -50 m to -10 m, which drowned large areas of continental shelves especially those near and within the Taiwan Strait. This event is associated with a significant increase in bulk sedimentation rates on the upper continental slope and the relative abundance of fine-grained detritus. Sediment provenance analyses suggest a dominant terrigenous input from Taiwan and a minor contribution from Luzon during the low carbonate% event, similar to the background terrigenous deposition in other periods of the Holocene. Two comparable low carbonate% events, respectively from the beginning of marine isotope stages 5.5 and 7.3, have also been recognized, pointing to similar causal factors. While carbonate dissolution and carbonate accumulation rate should not have been responsible, increased terrigenous input and dilution is considered as the main cause for the recurrent low carbonate% events in early interglacials. We further hypothesize that, during early interglacials, fluvial sediment discharge from Taiwan and Luzon intensified due to stronger typhoon activities, and massive fine-grained sediments from these two end members may have been transported to the northern SCS continental slope via surface and deep ocean currents. The conjecture of strengthened typhoon activities over East Asia during the early Holocene is supported by high ocean heat contents in the West Pacific Warm Pool area with the prevailing La Niña-like conditions.
Pena, L. D.; Francés, G.; Diz, P.; Nombela, M. A.; Alejo, I.
2003-04-01
Carbon and oxygen stable isotopes and ICP-OES elemental ratio concentrations (Mg/Ca, Sr/Ca, Ba/Ca) from core EUGC-3B (42 45.10'N; 9 02.23'W, at 38 m.b.s.l. and 410 cm length) were measured over monospecific benthic foraminiferal samples (Nonion fabum) ranging over the last 4500 yr BP. From the oldest analysed sample (289 cm) to the core top, stable isotopes signal shows that the whole record can be separated into 4 intervals lasting each of them about 1000 yr. The lowermost interval (4300-3000 yr BP) is characterized by relatively stable delta 18O values (mean 1.77 per mil). Delta 13C is relatively low except for a maximum around 3300 cal BP (-1.50 per mil). An abrupt decrease down to the minimum value in delta 13C (-4.41 per mil) is accomplished in approximately 200 yr. Mg/Ca and Ba/Ca match perfectly this event, both of them showing the respective maxima values. Sr/Ca has a very similar behaviour to that of delta 13C but with smoother fluctuations. We attribute high values of delta 13C, Sr/Ca and Ba/Ca to periods of enhanced coastal productivity, probably due to reinforced upwelling events in the region. According to Mg/Ca signal this reinforcement took place during a relatively warmer period. The most remarkable feature during the two next periods (3000-1900 yr BP and 1900-1000 yr BP) consists of a stepwise increase of delta 13C values punctuated by a sharp decrease at the end of each interval. All the remaining proxies exhibit a nearly constant trend over these intervals. Each period can be interpreted as a weak enhance of marine productivity that the system does not hold up and finally aborts. The most recent interval represents the establishment of current conditions in the coastal system. The most conspicuous event from this interval consists of an abrupt decrease of the delta 18O that lasted for 300 yr. This event could be correlated with the well recognized warm climatic event known as the Medieval Warm Period. However the Mg/Ca ratio does not show high
Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum
2007-02-01
The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.
Wintucky, Edwin G.; Simons, Rainee N.
2015-01-01
This paper presents the design, fabrication and test results for a novel waveguide multimode directional coupler (MDC). The coupler, fabricated from two dissimilar frequency band waveguides, is capable of isolating power at the second harmonic frequency from the fundamental power at the output port of a traveling-wave tube (TWT) amplifier. Test results from proof-of-concept demonstrations are presented for a Ku-band/Ka-band MDC and a Ka-band/E-band MDC. In addition to power measurements at harmonic frequencies, a potential application of the MDC is in the design of a satellite borne beacon source for atmospheric propagation studies at millimeter-wave (mm-wave) frequencies (Ka-band and E-band).
Air Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Waste Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Air Monitoring Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Sediment Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Shirataki obsidian exploitation and circulation in prehistoric northern Japan
Directory of Open Access Journals (Sweden)
Miyuki Yakushige
2014-03-01
Full Text Available Presently, the total number of archaeological obsidian sources in Japan is more than 80, and among them, 21 are in Hokkaido, northern part of the Japanese archipelago (Izuho and Sato 2007. Obsidian was the dominant of lithic raw material in the Upper Paleolithic Hokkaido (35-10 ka cal BP. Out of 21 archaeological obsidian sources in Hokkaido, 4 sources: Shirataki, Oketo, Tokachi, and Akaigawa are the major obsidian sources and the others are minor sources. Shirataki is one of the largest obsidian sources in Northeast Asia and it is well known that Shirataki obsidian was transported outside Hokkaido to Sakhalin and the Paleo-Honshu Island from the Late Upper Paleolithic period.We compiled data of obsidian source analyses conducted to artefacts from Paleolithic sites in Hokkaido, and it became clear that the ratio of Shirataki obsidian in all analyzed materials is more than half (Sato and Yakushige in press.We examined how far Shirataki obsidian was transported in each period: the Early Upper Paleolithic (35-25 ka cal BP and the Late Upper Paleolithic (25-10 ka cal BP. The Late Upper Paleolithic is divided into three stage, the early Early Microblade Industry (Stage 1: 25-21 ka cal BP, the late Early Microblade Industry (Stage 2: 19-16 ka cal BP, and the Late Microblade Industry (Stage 3: 16-10 ka cal BP. As a result, it is revealed that the distribution areas of Shirataki obsidian did not expand gradually over time, but are different in different lithic industries. In the background of this situation lay the difference of ecological adaptation strategies adopted by the prehistoric people of the time and their movement behavioral strategies.
International Nuclear Information System (INIS)
Kattel, G.R.; Augustinus, P.C.
2010-01-01
Subfossil cladocerans have rarely been used for paleoenvironmental reconstruction from New Zealand lake sediments, and here we detail the first examination of the response of cladocerans to past environments from an Auckland maar paleolake. Cladoceran remains were examined in the upper 230 cm of the lacustrine sediments spanning c. 9-31 cal. ka BP from Onepoto maar during which time the lake underwent significant changes. Lake level was relatively high during the Last Glacial Coldest Period (c. 28-18 cal. ka BP), with limited forest in the catchment, shoreline vegetation and low water temperature indicated by the presence of a planktonic taxon, Bosmina meridionalis, and a cold tolerant chydorid cladoceran Alona sp. (affinis type). However, the climate during the last glacial termination after c. 17.9 cal. ka BP changed abruptly, perhaps becoming extremely dry and windy, resulting in increased production of cladoceran resting eggs. Between c. 17.6 and 14.1 cal. ka BP, a gradually ameliorating climate with sustained windiness and dryness might have been unfavourable for hatching of chydorid cladoceran eggs and their recolonisation. After c. 14.1 cal. ka BP, continued climatic amelioration was accompanied by reduced lake levels inferred from high cladoceran littoral: planktonic ratios as well as increased cladoceran diversity and abundance of less cold tolerant chydorid taxa: Alona guttata, Alona sp. (intermedia type) and Alonella excisa. At c. 9 cal. ka BP, the maar crater rim was breached by the marine waters commensurate with postglacial sea-level rise, resulting in degraded water quality and production of a large number of cladoceran ephippia in the sediments. (author). 67 refs., 3 figs., 2 tabs.
CacyBP/SIP promotes the proliferation of colon cancer cells.
Directory of Open Access Journals (Sweden)
Huihong Zhai
Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.
Ravimiturg peaks ka sel aastal jõudsalt kasvama / Violetta Riidas
Riidas, Violetta
2008-01-01
Ilmunud ka: Äripäev 30. apr. lk. 16. Eelmise aasta ravimituru kasv jätkub tõenäoliselt ka sel aastal, kuna negatiivne riigieelarve ravimihüvitisi ei kärbi. Vt. samas: Võrdlus: Ravimituru jaotus haiglaapteekide ning teiste asutuste vahel peamiste ATC rühmade lõikes, 2007
Development of a 20kA current feedthrough using YBCO bulk conductors
International Nuclear Information System (INIS)
Maehata, Keisuke; Ishibashi, Kenji; Shintomi, Takakazu; Iwamoto, Akifumi; Maekawa, Ryuji; Mito, Toshiyuki
2004-01-01
In the phase II experiment of the Large Helical Device (LHD) of the National Institute for Fusion Science (NIFS), it is planned to operate the helical coils at 1.8 K by employing pressurized superfluid cooling to raise the magnetic field to 4 T with 17.3 kA. It is important to develop a 20kA-class current feedthrough into the 1.8 K region, but it must have a high current capacity and low heat leakage in the maximum magnetic leakage field of 1 T. Rectangle-shaped YBCO bulk conductors measuring 20 mm wide, 140 mm long and 10 mm thick were manufactured from square-pillar-shaped YBCO bulk materials for a 20 kA current. To check the quality of the bulk conductors, internal defects or cracks were detected by carrying out a precise survey of trapped magnetic flux. An assembled 20 kA current feedthrough was mounted in the λ-plate of a pressurized superfluid cooling cryostat. Experiments of current feeding into the 1.8 K region were carried out by operating the 20 kA current feedthrough. In the experiments, the transport current was kept at 20 kA for longer than 1,200 s. During the 20 kA operation, the current transport section of the YBCO bulk conductors remained in the superconducting state and the voltage drop between the YBCO bulk conductors and the copper electrode was observed to be constant. A contact resistance and the Joule heat generation in the joint region between the YBCO bulk conductors and the copper electrode were obtained as 1.45 nΩ and 0.72 W, respectively in the 20 kA operation. We have demonstrated the feasibility of using a 20 kA current feedthrough for the phase II experiment of the LHD. (author)
Ramos, Noelynna T.; Maxwell, Kathrine V.; Tsutsumi, Hiroyuki; Chou, Yu-Chen; Duan, Fucai; Shen, Chuan-Chou; Satake, Kenji
2017-12-01
Recent 230Th dating of fossil corals in west Luzon has provided new insights on the emergence of late Quaternary marine terraces that fringe west Luzon Island facing the Manila Trench. Apart from regional sea level changes, accumulated uplift from aseismic and seismic processes may have influenced the emergence of sea level indicators such as coral terraces and notches. Varied elevations of middle-to-late Holocene coral terraces along the west Luzon coasts reveal the differential uplift that is probably associated with the movement of local onland faults or upper-plate structures across the Manila Trench forearc basin. In Badoc Island, offshore west of Luzon mainland, we found notably young fossil corals, dated at 945.1 ± 4.6 years BP and 903.1 ± 3.9 years BP, on top of a 5-m-high reef platform. To constrain the mechanism of emergence or emplacement of these fossil corals, we use field geomorphic data and wave inundation models to constrain an extreme wave event that affected west Luzon about 1000 years ago. Our preliminary tectonic and tsunami models show that a megathrust rupture will likely lead to subsidence of a large part of the west Luzon coast, while permanent coastal uplift is attributed to an offshore upper-plate rupture in the northern Manila Trench forearc region. The modeled source fault ruptures and tsunami lead to a maximum wave height of more than 3 m and inundation distance as far as 2 km along the coasts of western and northern Luzon. While emplacement of coral boulders by an unusually strong typhoon is also likely, modeled storm surge heights along west Luzon do not exceed 2 m even with Typhoon Haiyan characteristics. Whether tsunami or unusually strong typhoon, the occurrence of a prehistoric extreme wave event in west Luzon remains an important issue in future studies of coastal hazards in the South China Sea region.
van der Bilt, Willem; Bakke, Jostein; Vasskog, Kristian; D`Andrea, William; Bradley, Raymond; Olafsdottir, Sædis
2016-04-01
The Arctic is responding sensitively to ongoing global climate change, warming and moistening faster than any other region on the planet. Holocene proxy paleoclimate time series are increasingly used to put this amplified response in perspective by understanding Arctic climate processes beyond the instrumental period. Glaciers rapidly respond to climate shifts as demonstrated by their current demise around the world. This response has a composite climate signature, marked by shifts in hydroclimate (winter precipitation) as well as (summer) temperature. Attendant changes in glacier size are recorded by variations in glacigenic rock flour that may be deposited in downstream lakes. Here, we present a Holocene reconstruction of glacier activity, based on sediments from Hajeren, a glacier-fed lake on northwest Spitsbergen in the High Arctic Svalbard archipelago. Owing to undisturbed sediments and robust age control, we could resolve variability on a sub-centennial scale. To ensure the accurate detection of glacier activity, we applied a toolbox of physical, magnetic and geochemical proxies in conjunction with multivariate statistics. Our findings indicate a three-stage Holocene climate history for Svalbard, driving by melt water pulses, episodic Atlantic cooling and a decline in orbitally driven summer insolation. Correspondence between inferred advances, including a Holocene glacier maximum around 9.5 ka BP, suggests forcing by the melting LIS during the Early Holocene. Following a late Holocene Thermal Maximum around 7.4 ka BP, glaciers disappeared from the catchment. Glaciers reformed around 4.2 ka BP during the regional onset of the Neoglacial, supporting previous findings. This transition did, however, not mark the onset of persistent glacier activity in the catchment, but a series of centennial-scale cycles of growth and decay, including events around 3.3 and 1.1 ka BP. As orbitally driven insolation declined towards the present, the glaciation threshold
A Ka-Band Celestial Reference Frame with Applications to Deep Space Navigation
Jacobs, Christopher S.; Clark, J. Eric; Garcia-Miro, Cristina; Horiuchi, Shinji; Sotuela, Ioana
2011-01-01
The Ka-band radio spectrum is now being used for a wide variety of applications. This paper highlights the use of Ka-band as a frequency for precise deep space navigation based on a set of reference beacons provided by extragalactic quasars which emit broadband noise at Ka-band. This quasar-based celestial reference frame is constructed using X/Ka-band (8.4/32 GHz) from fifty-five 24-hour sessions with the Deep Space Network antennas in California, Australia, and Spain. We report on observations which have detected 464 sources covering the full 24 hours of Right Ascension and declinations down to -45 deg. Comparison of this X/Ka-band frame to the international standard S/X-band (2.3/8.4 GHz) ICRF2 shows wRMS agreement of approximately 200 micro-arcsec in alpha cos(delta) and approximately 300 micro-arcsec in delta. There is evidence for systematic errors at the 100 micro-arcsec level. Known errors include limited SNR, lack of instrumental phase calibration, tropospheric refraction mis-modeling, and limited southern geometry. The motivation for extending the celestial reference frame to frequencies above 8 GHz is to access more compact source morphology for improved frame stability and to support spacecraft navigation for Ka-band based NASA missions.
Morgan, J. D.; Bereiter, B.; Baggenstos, D.; Kawamura, K.; Shackleton, S. A.; Severinghaus, J. P.
2017-12-01
Antarctic temperature variations during Heinrich events, as recorded by δ18Oice, generally show more gradual changes than the abrupt warmings seen in Greenland ice. However, quantitative temperature interpretation of the water isotope temperature proxy is difficult as the relationship between δ18Oice and temperature is not constant through time. Fortunately, ice cores offer a second temperature proxy based on trapped gases. During times of surface warming, thermal fractionation of gases in the column of unconsolidated snow (firn) on top of the ice sheet results in isotopically heavier nitrogen (N2) and argon (Ar) being trapped in the ice core bubbles. During times of surface cooling, isotopically lighter gases are trapped. Measurements of δ15N and δ40Ar can therefore be used, in combination with a model for the height of the column of firn, to quantitatively reconstruct surface temperatures. In the WAIS Divide Ice Core, the two temperature proxies show a brief disagreement during Heinrich Stadial 1. Despite δ18Oice recording relatively constant temperature, the nitrogen and argon isotopes imply an abrupt warming between 16 and 15.8 kyr BP, manifest as an abrupt 1.25oC increase in the firn temperature gradient. To our knowledge, this would be the first evidence that such abrupt climate change has been recorded in an Antarctic climate proxy. If confirmed by more detailed studies, this event may represent warming due to an extreme southward shift of the Earth's thermal equator (and the southern hemisphere westerly wind belt), caused by the 16.1 ka Heinrich Event.
Sedimentary Evidence for a Rapid Sea Level Rise at 7,600 cal yr BP from North-Central Cuba
Peros, M. C.; Agosta G'meiner, A. M.; Collins, S.
2016-12-01
A lack of high-resolution relative sea level (RSL) proxy data has meant that the pattern of early Holocene RSL change in the Caribbean is poorly understood. A RSL curve published by Toscano and Macintyre (2003) using inter-tidal mangrove peats and submerged corals suggests RSL underwent a relatively fast and `smooth' curvilinear increase during the Holocene. However, others, such as Blanchon and Shaw (1995), suggest that RSL increased rapidly at around 7600 cal yr BP, in response to the final stages of the melting of the Laurentide Ice Sheet (melt water pulse 1C or catastrophic rise event 3). We investigated this question using multi-proxy data from a flooded sinkhole (Cenote Jennifer) on the north coast of central Cuba. Cenote Jennifer is located 7 m above mean sea level and 2 km from the Bahamas Channel and appears to have a high degree of connectivity with the ocean through a network of underground caverns. The water depth is 13 m and the bottommost 5 m is anoxic. A sediment core collected from Cenote Jennifer was studied using loss-on-ignition, pollen analysis, high-resolution XRF core-scanning, and grain size analysis. An age-depth model was generated for the core by AMS dating. The results show that the bottommost stratigraphic unit ( 9000 to 7600 cal yr BP) is a fine-grained carbonate-rich mud (i.e., marl). This unit abruptly transitions into finely laminated organic-rich sediment from 7600 cal yr BP to the present. The pollen analysis shows that the sinkhole supported a cattail (Typha) community until 7600 cal yr BP, indicating low water levels ( 1 m). At 7600 cal yr BP, the cattail community disappeared and the vegetation of the surrounding bedrock became dominated by a thorny coastal scrubland. In addition, a 3 cm thick fining-upward siliciclastic unit is present immediately above the marl-organic contact, suggesting: 1) a marine sediment source given the limestone-dominated nature of the region, and 2) the presence of a short-duration, high
Vesnička tesařů Ostrovec (Johannesdörfl)
Czech Academy of Sciences Publication Activity Database
Vlček, Pavel
6/7, 2016/2017 (2017), s. 39-46 ISSN 1805-8906 R&D Projects: GA MK DG16P02H023 Keywords : Ostrovec (Johannesdörfl) * carpenters * church od St. John the Baptist * František Maxmilián Kaňka * Johann Mathes Spiess * Anton Haffenecker Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Architectural design
Determination of lactic acid bacteria in Kaºar cheese and ...
African Journals Online (AJOL)
Lactic acid bacteria (LAB) arise in Kaşar cheese, an artisanal pasta filata cheese produced in Turkey from raw milk without starter addition or pasteurized milk with starter culture. In this study, 13 samples of Kaşar cheese that were produced from raw milk were used as reference materials. LAB were characterized by using ...
76 FR 69712 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...
Directory of Open Access Journals (Sweden)
Quanming Yang
2018-04-01
Full Text Available The waveform retracking algorithm is a key factor that affects the accuracy of elevation change from satellite altimetry over an ice sheet. The elevation change results from four waveform retracker algorithms (ICE1/ICE2/Sea Ice/OCEAN provided by the Satellite with ARgos and ALtiKa (SARAL/ALtiKa data were compared using repeated SARAL data between March 2013 and April 2016 to determine the optimal retracker in the crossovers of descending and ascending orbits over a Greenland ice sheet (GrIS. The ICE1 provided slightly better results than the three other algorithms with the lowest standard deviation (SD of 0.30 m year−1. Further comparison was also conducted between the Satellite with ARgos and ALtiKa (SARAL and Operation ICEBridge laser data, thereby indicating that ICE1 was the best retracker with an Root Mean Square Error (RMSE of 0.43 m year−1. The distribution of elevation change rate and uncertainties over Greenland from SARAL were presented using the selected ICE1 retracker with a volume loss of 40 ± 12 km3 year−1. This volume loss did not include the fast-changing coastal areas of the GrIS. A large thinning was observed in Jakobshavn Isbræ, and a trend that extended far inland was also found from 2013–2016. Furthermore, a melting ice sheet was observed in the large areas northwest over the GrIS.
Lambert, W. J.; Aharon, P.; Hellstrom, J.
2007-12-01
Whereas the rapid climate swings that occurred during the last deglaciation have been well documented in the Greenland ice cores, their cause/s continue to be a subject of heated debate. Clearly, more geographically dispersed records are required in order to provide better insight into the history of deglaciation, and by extension into the cause/s of the abrupt climate shifts. Particularly scarce are continental deglaciation records from the southeast North America whose atmospheric conditions were controlled by the retreating Laurentide Ice Sheet to the north and the Gulf of Mexico warm waters to the south. In order to remedy the absence of deglaciation records in the Southeast USA in general, and the Gulf Coast in particular, we have initiated a study of a 55-cm long stalagmite (DSSG-2) from the DeSoto Caverns in Childersburg, Alabama (33° 18'N, 86° 17'W). Seven radiocarbon AMS and eighteen U/Th TIMS dates reveal that the continuously layered stalagmite covers the time interval 31 to 11.4 cal-Ka at growth rates varying from 61 μm/decade at the start of deglaciation and up to 2700 μm/decade close to its termination. The combination of unusually high growth rates, pristine aragonite mineralogy and tight sampling (n=602) afforded generation of high fidelity δ13C and δ18O records from about 16.1 to 11.4 cal-Ka whose high resolution is comparable with the contemporaneous Greenland ice core records. The stalagmite δ18O record shows excellent agreement in relative amplitude shifts and timing of abrupt and brief cold reversals (Oldest Dryas, Older Dryas, Inter-Allerød Cold Period) that punctuated the overall trend of deglaciation warming (Bølling/Allerød period). The succeeding Younger Dryas is depicted in the stalagmite by rapid positive shifts in δ18O and δ13C of 1.3‰ and 2.3‰ (V-PDB) relative to the baseline mean value and its start and termination (12.7-11.8 Ka) are concordant within error with the dates reported from GISP2 ice core (12.82-11.60 Ka
X/Ka Celestial Frame Improvements: Vision to Reality
Jacobs, C. S.; Bagri, D. S.; Britcliffe, M. J.; Clark, J. E.; Franco, M. M.; Garcia-Miro, C.; Goodhart, C. E.; Horiuchi, S.; Lowe, S. T.; Moll, V. E.;
2010-01-01
In order to extend the International Celestial Reference Frame from its S/X-band (2.3/8.4 GHz) basis to a complementary frame at X/Ka-band (8.4/32 GHz), we began in mid-2005 an ongoing series of X/Ka observations using NASA s Deep Space Network (DSN) radio telescopes. Over the course of 47 sessions, we have detected 351 extra-galactic radio sources covering the full 24 hours of right ascension and declinations down to -45 degrees. Angular source position accuracy is at the part-per-billion level. We developed an error budget which shows that the main errors arise from limited sensitivity, mismodeling of the troposphere, uncalibrated instrumental effects, and the lack of a southern baseline. Recent work has improved sensitivity by improving pointing calibrations and by increasing the data rate four-fold. Troposphere calibration has been demonstrated at the mm-level. Construction of instrumental phase calibrators and new digital baseband filtering electronics began in recent months. We will discuss the expected effect of these improvements on the X/Ka frame.
Armario, Pedro; Oliveras, Anna; Hernández Del Rey, Raquel; Poch, Esteban; Larrouse, María; Roca-Cusachs, Alex; de la Sierra, Alejandro
2009-06-27
To asses the prevalence of target organ damage (TOD) and factors associated with cardiovascular events in subjects with refractory hypertension. Cross-sectional study of 146 patients with clinical diagnosis of refractory hypertension. TOD was defined as the presence of microalbuminuria (MA), renal failure (RF), left ventricular hypertrophy (LVH) or left atrial enlargement (LAE). Cardiovascular events were defined as the antecedent of stroke, coronary heart disease, heart failure or peripheral arterial disease. 24-h ambulatory blood pressure monitoring was (ABPM) performed with a validated Spacelabs 90207. The prevalence of LVH was 62.3%, and LAE was observed in 27.7% of the subjects. The prevalence of RF was 28.1% and MA was found in 41,4%. An association between MA and LVH was observed. After adjusting by age, the urinary albumin excretion (UAE) correlated with clinical blood pressure (BP) and BP during 24-h ABPM, whereas LVMI correlated with ambulatory BP but not with clinical BP. The prevalence of previous cardiovascular events was 22% and in the multivariate regression analysis, UAE was the only independent factor associated with the antecedent of cardiovascular events. In subjects with refractory hypertension, the prevalence of TOD was high, and an association between heart and renal organ damage was observed. UAE was independently associated with the antecedent of cardiovascular disease.
Relative timing of last glacial maximum and late-glacial events in the central tropical Andes
Bromley, Gordon R. M.; Schaefer, Joerg M.; Winckler, Gisela; Hall, Brenda L.; Todd, Claire E.; Rademaker, Kurt M.
2009-11-01
Whether or not tropical climate fluctuated in synchrony with global events during the Late Pleistocene is a key problem in climate research. However, the timing of past climate changes in the tropics remains controversial, with a number of recent studies reporting that tropical ice age climate is out of phase with global events. Here, we present geomorphic evidence and an in-situ cosmogenic 3He surface-exposure chronology from Nevado Coropuna, southern Peru, showing that glaciers underwent at least two significant advances during the Late Pleistocene prior to Holocene warming. Comparison of our glacial-geomorphic map at Nevado Coropuna to mid-latitude reconstructions yields a striking similarity between Last Glacial Maximum (LGM) and Late-Glacial sequences in tropical and temperate regions. Exposure ages constraining the maximum and end of the older advance at Nevado Coropuna range between 24.5 and 25.3 ka, and between 16.7 and 21.1 ka, respectively, depending on the cosmogenic production rate scaling model used. Similarly, the mean age of the younger event ranges from 10 to 13 ka. This implies that (1) the LGM and the onset of deglaciation in southern Peru occurred no earlier than at higher latitudes and (2) that a significant Late-Glacial event occurred, most likely prior to the Holocene, coherent with the glacial record from mid and high latitudes. The time elapsed between the end of the LGM and the Late-Glacial event at Nevado Coropuna is independent of scaling model and matches the period between the LGM termination and Late-Glacial reversal in classic mid-latitude records, suggesting that these events in both tropical and temperate regions were in phase.
Kirillova, Irina V.; Argant, J.; Lapteva, E. G.; Korona, O. M.; van der Plicht, J.; Zinovyev, E. V.; Kotov, A. A.; Chernova, O. F.; Fadeeva, E. O.; Baturina, O. A.; Kabilov, M. R.; Shidlovskiy, F. K.; Zanina, O. G.
2016-01-01
Mammoth feces from northern Yakutia and western Chukotka were investigated in a multidisciplinary study. Radiocarbon dating of the Yakutian mammoth dung yielded ca 42 ka BP and the age of the feces from Chukotka is older than 45 ka BP. The two sites are located about 15,000 km from each other and
BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer
Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.
2010-01-01
Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225
4E-BP1 regulates the differentiation of white adipose tissue.
Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori
2013-07-01
4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.
KaBOB: ontology-based semantic integration of biomedical databases.
Livingston, Kevin M; Bada, Michael; Baumgartner, William A; Hunter, Lawrence E
2015-04-23
The ability to query many independent biological databases using a common ontology-based semantic model would facilitate deeper integration and more effective utilization of these diverse and rapidly growing resources. Despite ongoing work moving toward shared data formats and linked identifiers, significant problems persist in semantic data integration in order to establish shared identity and shared meaning across heterogeneous biomedical data sources. We present five processes for semantic data integration that, when applied collectively, solve seven key problems. These processes include making explicit the differences between biomedical concepts and database records, aggregating sets of identifiers denoting the same biomedical concepts across data sources, and using declaratively represented forward-chaining rules to take information that is variably represented in source databases and integrating it into a consistent biomedical representation. We demonstrate these processes and solutions by presenting KaBOB (the Knowledge Base Of Biomedicine), a knowledge base of semantically integrated data from 18 prominent biomedical databases using common representations grounded in Open Biomedical Ontologies. An instance of KaBOB with data about humans and seven major model organisms can be built using on the order of 500 million RDF triples. All source code for building KaBOB is available under an open-source license. KaBOB is an integrated knowledge base of biomedical data representationally based in prominent, actively maintained Open Biomedical Ontologies, thus enabling queries of the underlying data in terms of biomedical concepts (e.g., genes and gene products, interactions and processes) rather than features of source-specific data schemas or file formats. KaBOB resolves many of the issues that routinely plague biomedical researchers intending to work with data from multiple data sources and provides a platform for ongoing data integration and development and for
Directory of Open Access Journals (Sweden)
Pedro J. Fernández Iriarte
2011-07-01
Full Text Available The genetic structure of populations/species was established during the Quaternary glaciations. Over the last 250 ka (Pleistocene, the South American marine biogeographic history recorded three main glaciations: the most extensive one between 140 and 180 ka, a minor one between 60 and 70 ka, and the last glaciation approximately between 15 and 35 ka. With the aim of assessing the pattern of molecular diversity and historical demography of weakfish (Cynoscion guatucupa, a 365 bp sequence of the mitochondrial control region was amplified at four coastal sites located in the southwestern Atlantic. Haplotype diversity was high, whereas nucleotide diversity was low and similar at each sample site. AMOVA failed to detect population structure. This lack of differentiation was subsequently observed in the distribution of samples sites in the haplotype network. Fu’s Fs was negative and highly significant while the mismatch analysis yielded a unimodal distribution, indicating a global population expansion. The Bayesian skyline plot revealed a coalescence time of weakfish population at approximately 210 ka, and a very rapid expansion from 180-190 ka, probably caused by a habitat expansion, as these two events coincide in time.
A ˜50 ka record of monsoonal variability in the Darjeeling foothill region, eastern Himalayas
Ghosh, Ruby; Bera, Subir; Sarkar, Anindya; Paruya, Dipak Kumar; Yao, Yi-Feng; Li, Cheng-Sen
2015-04-01
Pollen, phytoliths and δ 13C signatures of soil organic matter from two fluvial sedimentary sequences of the Darjeeling foothill region, eastern Himalayas are used to portray palaeoclimatic oscillations and their impact on regional plant communities over the last ˜50 ka. Quantitative palaeoclimate estimation using coexistence approach on pollen data and other proxies indicate significant oscillations in precipitation during the late part of MIS 3 (46.4-25.9 ka), early and middle part of MIS 2 (25.9-15.6 ka), and 5.4 to 3.5 ka. Middle to late MIS 3 (ca 46.4-31 ka.) was characterized by a comparatively low monsoonal activity and slightly higher temperature than that during ca 31 ka onwards. Simultaneous expansion of deciduous trees and chloridoid grasses also imply a drier and warmer phase. Between 31 and 22.3 ka (late MIS 3 to mid-MIS 2), higher precipitation and a slightly cooler temperature led to an increase in evergreen elements over deciduous taxa and wet-loving panicoid grasses over dry-loving chloridoid grasses than earlier. After ca 22.3 ka, shrinking of forest cover, expansion of C4 chloridoid grasses, Asteraceae and Cheno-ams in the vegetation with lowering of temperature and precipitation characterized the onset of the LGM which continued till 18.3 ka. End of the LGM is manifested by a restoration in the forest cover and in the temperature and precipitation regime. Later, during 5.4 to 4.3 ka, a strong monsoonal activity supported a dense moist evergreen forest cover that subsequently declined during 4.3 to 3.5 ka. A further increase in deciduous elements and non-arboreals might be a consequence of reduced precipitation and higher temperature during this phase. A comparison between monsoonal rainfall, MAT and palaeoatmospheric CO2 with floral dynamics since last ˜50 ka indicates that these fluctuations in plant succession were mainly driven by monsoonal variations.
Liu, J.; Milliman, J. D.
2002-12-01
Both post-glacial sea-level and climatic changes are preserved in the the shallow, low gradient, sediment-dominated Yellow Sea. As a result of rapid flooding during melt-water pulse (MWP) 1A, 14.3-14.1 ka BP, sea level reached the southern edge of the North Yellow Sea (NYS), and after MWP-1B (11.6-11.4 ka BP) sea level entered the Bohai Sea. The first major Yellow River-derived deltaic deposit formed in the NYS during decelerated transgression following MWP-1B and increased river discharge in response to re-intensification of the summer monsoon about 11 ka cal BP. A second subaqueous delta formed in the South Yellow Sea about 9-7 ka BP during decelerated transgression after MWP-1C flooding and in response to the southern shift of the Yellow River mouth. The modern subaqueous and subaerial deltas in the west Bahai Gulf and (to a lesser extent) along the Jiangus coast have formed during the modern sea-level highstand. These changing Holocene patterns are most clearly illustrated by a short film clip.
Jaapani edumetoodika ka Eestis / Merike Lees
Lees, Merike, 1976-
2004-01-01
Ilmunud ka: Delovõje Vedomosti 17. nov. lk. 28. Tootmissfääris kasutatavast Jaapani 20 võtme metoodikast loodab ettevõttele kasu saada lehtmetalli töötleva AS-i Favor Metaform nõukogu esimees Almar Proosi. Lisa: Mis on 20 võtit?
BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer
Directory of Open Access Journals (Sweden)
Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu
2010-01-01
Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.
Underestimated risks of recurrent long-range ash dispersal from northern Pacific Arc volcanoes.
Bourne, A J; Abbott, P M; Albert, P G; Cook, E; Pearce, N J G; Ponomareva, V; Svensson, A; Davies, S M
2016-07-21
Widespread ash dispersal poses a significant natural hazard to society, particularly in relation to disruption to aviation. Assessing the extent of the threat of far-travelled ash clouds on flight paths is substantially hindered by an incomplete volcanic history and an underestimation of the potential reach of distant eruptive centres. The risk of extensive ash clouds to aviation is thus poorly quantified. New evidence is presented of explosive Late Pleistocene eruptions in the Pacific Arc, currently undocumented in the proximal geological record, which dispersed ash up to 8000 km from source. Twelve microscopic ash deposits or cryptotephra, invisible to the naked eye, discovered within Greenland ice-cores, and ranging in age between 11.1 and 83.7 ka b2k, are compositionally matched to northern Pacific Arc sources including Japan, Kamchatka, Cascades and Alaska. Only two cryptotephra deposits are correlated to known high-magnitude eruptions (Towada-H, Japan, ca 15 ka BP and Mount St Helens Set M, ca 28 ka BP). For the remaining 10 deposits, there is no evidence of age- and compositionally-equivalent eruptive events in regional volcanic stratigraphies. This highlights the inherent problem of under-reporting eruptions and the dangers of underestimating the long-term risk of widespread ash dispersal for trans-Pacific and trans-Atlantic flight routes.
BP/Mobil. Joint-venture directions for use
International Nuclear Information System (INIS)
Anon.
1997-01-01
This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)
Bakke, Jostein; Balascio, Nicholas; van der Bilt, Willem G. M.; Bradley, Raymond; D'Andrea, William J.; Gjerde, Marthe; Ólafsdóttir, Sædís; Røthe, Torgeir; De Wet, Greg
2018-03-01
This paper introduces a series of articles assembled in a special issue that explore Holocene climate evolution, as recorded in lakes on the Island of Amsterdamøya on the westernmost fringe of the Arctic Svalbard archipelago. Due to its location near the interface of oceanic and atmospheric systems sourced from Arctic and Atlantic regions, Amsterdamøya is a key site for recording the terrestrial response to marine and atmospheric changes. We employed multi-proxy approaches on lake sediments, integrating physical, biogeochemical, and isotopic analyses to infer past changes in temperature, precipitation, and glacier activity. The results comprise a series of quantitative Holocene-length paleoclimate reconstructions that reveal different aspects of past climate change. Each of the four papers addresses various facets of the Holocene climate history of north-western Svalbard, including a reconstruction of the Annabreen glacier based on the sedimentology of the distal glacier-fed lake Gjøavatnet, a reconstruction of changing hydrologic conditions based on sedimentology and stratigraphy in Lake Hakluytvatnet, reconstruction of summer temperature based on alkenone paleothermometry from lakes Hakluytvatnet and Hajeren, and a hydrogen isotope-based hydrological reconstruction from lake Hakluytvatnet. We also present high-resolution paleomagnetic secular variation data from the same lake, which document important regional magnetic field variations and demonstrate the potential for use in synchronizing Holocene sedimentary records in the Arctic. The paleoclimate picture that emerges is one of early Holocene warmth from ca. 10.5 ka BP interrupted by transient cooling ca. 10-8ka BP, and followed by cooling that mostly manifested as two stepwise events ca. 7 and 4 ka BP. The past 4ka were characterized by dynamic glaciers and summer temperature fluctuations decoupled from the declining summer insolation.
Highly Perturbed pKa Values in the Unfolded State of Hen Egg White Lysozyme
Bradley, John; O'Meara, Fergal; Farrell, Damien; Nielsen, Jens Erik
2012-01-01
The majority of pKa values in protein unfolded states are close to the amino acid model pKa values, thus reflecting the weak intramolecular interactions present in the unfolded ensemble of most proteins. We have carried out thermal denaturation measurements on the WT and eight mutants of HEWL from pH 1.5 to pH 11.0 to examine the unfolded state pKa values and the pH dependence of protein stability for this enzyme. The availability of accurate pKa values for the folded state of HEWL and separa...
Abulfaraj, Aala A.
2018-04-01
Mitogen-activated protein kinases (MAPKs) belong to the most conserved signaling pathways and are found in all eukaryotes, including humans where they play important roles in various diseases and cancer. Stimulation of this signal transduction pathway by microbe-associated molecular patterns (MAMP) results in a multitude of events to regulate innate immune responses in Arabidopsis thaliana stimulating large-scale changes in gene expression. Starting from a phosphoproteomic screen in Arabidopsis thaliana wild type and mpk3, mpk4 and mpk6 mutants following microbe-associated molecular pattern (MAMP) treatment, several novel chromatin-associated proteins were identified that are differentially phosphorylated by stress-induced protein kinases. Arabidopsis Ras GTPase-activating protein SH3-domain-binding protein (AtG3BP-1) is a downstream putative substrate of the MAMP-stimulated MAPK pathway that is phosphorylated by MPK3, 4 and 6 in in vitro kinase assays. AtG3BP1 belongs to a highly conserved family of RNA-binding proteins in eukaryotes that link kinase receptormediated signaling to RNA metabolism. Here, we report the characterization of the Arabidopsis homolog of human G3BP1 in plant innate immunity. AtG3BP1 negatively regulates plant immunity and defense immune responses. Atg3bp1 mutant lines show constitutive stomata closure, expression of a number of key defense marker genes, and accumulate salicylic acid but not jasmonic acid. Furthermore, Atg3bp1 plants exhibit enhanced resistance to the biotrophic pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated by stomatal and apoplastic immunity in Atg3bp1. More generally, our data reinforce that AtG3BP1 is a key mediator of plant defense responses and transient expression of AtG3BP1 delivered striking disease resistance in the absence of yield penalty, highlighting a potential application of this gene in crop protection.
International Nuclear Information System (INIS)
Ferronsky, V.I.; Brezgunov, V.S.; Vlasova, L.S.; Karpychev, Y.A.; Polyakov, V.A.; Bobkov, A.F.; Romanovsky, V.V.; Johnson, T.; Ricketts, D.; Rasmussen, K.
2002-01-01
A 5-m long core of bottom sediments from the Kara Bogaz Gol Bay of the Caspian Sea, 4- m and 2-m cores from the Issyk Kul Lake of the Thian Shan Mountains, and a 4-m core from the Aral Sea were examined for evidence of climatic and environmental changes in the catchment basin of the Central Asia Region. The distribution of 18 O and 13 C in the bulk carbonates, 2 H in the pore water, radiocarbon age, oxygen and hydrogen isotopes in the lake water, abundance of CaCO 3 , MgCO 3 , and the basic salt ions of Na + , K + , Cl - , SO 4 2- in the cores were measured. The isotope and hydrogeochemical data of the Kara Bogaz Gol Bay sediments prove a historical scenario for the basin which suggests that fresh water has been discharged to the Caspian Sea during the Bay's humid episode across the Central Asia Region (∼ 9 Ka BP). Isotope and geochemical evidence indicate that the sedimentation of the upper core segment has taken place during the last ∼2.2 Ka BP in the environment of sea water recharged from the Central Caspian Basin. The period of between 4.3 and 6 Ka BP, which relates to the core depth interval of between 170 cm and 260 cm, demonstrates the most dramatic change in the sedimentation rate in the Issyk Kul Lake. It means that active melting of the mountain glaciers and warming of climate has happened just in this period. The swamp plant peat layers at depths of 230 cm and 130 cm indicate that during 3.5-3.7 Ka BP and 1.6-1.8 Ka BP the Aral Sea dried and broke up into a number of lakes and swamps. Sediment cores taken from the bottom of the Kara Bogaz Gol Bay, Lake Issyk Kul and Aral Sea show periodic rise and fall in water levels during the last ∼10 000 years. Two peat layers within the sediment core of the Aral Sea and dated at 1.6-1.8 Ka BP and 3.5-3.7 Ka BP demonstrate that this reservoir also periodically dried. (author)
A 13,500 Year Record of Holocene Climate, Fire and Vegetation from Swan Lake, Idaho, USA
Wahl, D.; Anderson, L.; Miller, D. M.; Rosario, J. J.; Starratt, S.; McGeehin, J. P.; Bright, J. E.
2015-12-01
Modern climate dynamics in the western US are largely determined by a combination of two factors: 1) the strength and position of midlatitude pressure systems, which, in turn, are responsible for the generation and trajectory of winter storms, and 2) the strength of the North America Monsoon (NAM) which brings summer precipitation northward in response to northern hemisphere warming. Paleoclimate records from the Great Basin of the western US suggest some coherence in the timing of major climatic shifts during the Holocene. However, knowledge of the timing and magnitude of these changes at local scales, which can help explain the relative contribution of midlatitude winter storms vs. NAM, is lacking in many places. Here we present new data that constrain the timing and magnitude of late glacial and Holocene climate variability in the northeastern Great Basin, provide insight into past spatial variability of precipitation patterns in the western US, and improve our understanding of regional scale influences on Great Basin climate. In 2011, a 7.65 m sediment core was raised from Swan Lake, a small wetland located in southeastern Idaho that was formed in the spillway channel created by the catastrophic flooding of Lake Bonneville ~18 ka BP. Pollen, charcoal, clumped isotope, diatom, ostracod, and sedimentological data are used to reconstruct vegetation, fire history, and lake level/groundwater flux over the last 13,500 years. Age control is provided by 19 AMS radiocarbon determinations, which are reported as thousands of calibrated years before present (ka BP). This effort builds on earlier work by Bright (1966) who reported on pollen, macrofossils, and sediment type from Swan Lake. Our data suggest cool and wet conditions prevailed until around 12.3 ka BP, after which a drying trend begins. The early Holocene was marked by a warmer, drier climate, which persisted until around 6.2 ka BP. Moister conditions after 6.2 ka BP likely resulted from a combination of enhanced
Kario, Kazuomi
2016-07-01
Blood pressure (BP) exhibits different variabilities and surges with different time phases, from the shortest beat-by-beat to longest yearly changes. We hypothesized that the synergistic resonance of these BP variabilites generates an extraordinarily large dynamic surge in BP and triggers cardiovascular events (the resonance hypothesis). The power of pulses is transmitted to the peripheral sites without attenuation by the large arteries, in individuals with stiffened arteries. Thus, the effect of a BP surge on cardiovascular risk would be especially exaggerated in high-risk patients with vascular disease. Based on this concept, our group recently proposed a new theory of systemic hemodynamic atherothromboltic syndrome (SHATS), a vicious cycle of hemodynamic stress and vascular disease that advances organ damage and triggers cardiovascular disease. Clinical phenotypes of SHATS are large-artery atherothombotic diseases such as stroke, coronary artery disease, and aortic and pheripheral artery disease; small-artery diseases, and microcirculation-related disease such as vascular cognitive dysfunction, heart failure, and chronic kidney disease. The careful consideration of BP variability and vascular diseases such as SHATS, and the early detection and management of SHATS, will achieve more effective individualized cardiovascular protection. In the near future, information and communication technology-based 'anticipation medicine' predicted by the changes of individual BP values could be a promising approach to achieving zero cardiovascular events.
Potential for Paragliding Tourism Development in Niška Banja (South Serbia
Directory of Open Access Journals (Sweden)
Lazar Pavić
2013-07-01
Full Text Available People today pay attention more on their health and because of that sports tourism becomes more popular. Especially popular segment of sports tourism is adventure sports including paragliding which has a special place. Tourist product of Niška Banja, as one of more visited tourism destination in Serbia, is mostly based on its health function. In the first part of this paper it is presented touristic valorisation of Niška Banja using criteria recommended form World Tourism Organization. In the second part of this paper it is used marketing mix as a tool for creating potential tourism product Paragliding weekend in Niška Banja. The aim of this paper is to show how the tourism offers of Niška Banja can be diversified using a new integrated product and how the touristic value can be increased.
AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)
2013-02-01
Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.
Surface Water Sampling Data for BP Spill/Deepwater Horizon
U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...
Lifescience Database Archive (English)
Full Text Available inase OS=Thermotoga petrophila... 40 0.12 tr|B7RFK1|B7RFK1_9THEM Guanylate kinase OS=Marinitoga piezophila.....7RFK1|B7RFK1_9THEM Guanylate kinase OS=Marinitoga piezophila KA3 GN=gmk PE=4 SV=1 Length = 207 Score = 39.7
Meyer-Dombard, D. R.; Loiacono, S. T.; Shock, E.
2012-12-01
Coordinated analysis of the "Bison Pool" (BP) Environmental Genome and a complementary contextual geochemical dataset of ~75 parameters revealed biogeochemical cycling and metabolic and microbial community shifts in a Yellowstone National Park hot spring ecosystem (1). The >22m outflow of BP is a gradient of decreasing temperature, increasing dissolved oxygen, and changing availability of nutrients. Microbial life at BP transitions from a 92°C chemosynthetic community in the BP source pool to a 56°C photosynthetic mat community. Metagenomic data at BP showed the potential for both heterotrophic and autotrophic carbon metabolism (rTCA and acetyl-CoA cycles) in the highest temperature, chemosynthetic regions (1). This region of the outflow is dominated by Aquificales and Pyrococcus relatives, with smaller contributions of heterotrophic Bacteria. Following a 2h heavy precipitation event we observed an influx of exogenous organic material into the source pool supplied from the meadow surrounding the BP area. We sampled biomass and fluid at several locations within the outflow immediately following the event, and on several occasions for the next eight days. Elemental analysis and carbon and nitrogen isotopic analyses were conducted on biomass and sediment, and dissolved organic and inorganic carbon content and δ13C of fluids were analyzed. DNA and RNA were extracted, and following RT-PCR, nitrogen cycle functional gene expression was evaluated. Previous work at BP has shown that chemosynthetic biomass may carry isotopic signatures of fractionation during carbon fixation, via the acetyl-CoA and rTCA cycles (2). However, the addition of exogenous organic carbon during the rain event had an immediate and dramatic effect on the sediments and biofilms in the chemosynthetic zone of the outflow. Dissolved organic carbon was the highest measured in six years. Chemosynthetic biomass responded by incorporating the organic carbon. Carbon isotopic signatures in chemosynthetic
Use of natural diamonds to monitor 14C AMS instrument backgrounds
International Nuclear Information System (INIS)
Taylor, R.E.; Southon, John
2007-01-01
To examine one component of the instrument-based background in University of California Keck Carbon Cycle AMS spectrometer, we have obtained measurements on a set of natural diamonds pressed into sample holders. Natural diamond samples (N = 14) from different sources within rock formations with geological ages greatly in excess of 100 Ma yielded a range of currents (∼110-250 μA 12 C - where filamentous graphite typically yields ∼150 μA 12 C - ) and apparent 14 C ages (64.9 ± 0.4 ka BP [0.00031 ± 0.00002 fm] to 80.0 ± 1.1 ka BP [0.00005 ± 0.00001 fm]). Six fragments cut from a single diamond exhibited essentially identical 14 C values - 69.3 ± 0.5 ka-70.6 ± 0.5 ka BP. The oldest 14 C age equivalents were measured on natural diamonds which exhibited the highest current yields
Energy Technology Data Exchange (ETDEWEB)
Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)
2006-07-01
This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.
InterProScan Result: BP184018 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP184018 BP184018_2_ORF2 4FEA411FDBEADEDD PANTHER PTHR21347 CLEFT LIP AND PALATE ASSOCIATED TRANSME...MBRANE PROTEIN-RELATED 6.1e-73 T IPR008429 Cleft lip and palate transmembrane 1 ...
Advances in Ka-Band Communication System for CubeSats and SmallSats
Kegege, Obadiah; Wong, Yen F.; Altunc, Serhat
2016-01-01
A study was performed that evaluated the feasibility of Ka-band communication system to provide CubeSat/SmallSat high rate science data downlink with ground antennas ranging from the small portable 1.2m/2.4m to apertures 5.4M, 7.3M, 11M, and 18M, for Low Earth Orbit (LEO) to Lunar CubeSat missions. This study included link analysis to determine the data rate requirement, based on the current TRL of Ka-band flight hardware and ground support infrastructure. Recent advances in Ka-band transceivers and antennas, options of portable ground stations, and various coverage distances were included in the analysis. The link/coverage analysis results show that Cubesat/Smallsat missions communication requirements including frequencies and data rates can be met by utilizing Near Earth Network (NEN) Ka-band support with 2 W and high gain (>6 dBi) antennas.
Development of a thermally switched superconducting rectifier for 100 kA
Mulder, G.B.J.; Mulder, G.B.J.; ten Kate, Herman H.J.; Krooshoop, Hendrikus J.G.; van de Klundert, L.J.M.; van de Klundert, L.J.M.
1991-01-01
A full-wave superconducting rectifier for 100 kA has been developed. Typical design values of this device are: a secondary current of 100 kA, a primary amplitude of 20 A, an operating frequency of 0.5 Hz, and an average power on the order of 100 W. The rectification is achieved by means of thermally
Potentiometric pKa Determination of Piroxicam and Tenoxicam in Acetonitrile-Water Binary Mixtures
Çubuk Demiralay, Ebru; Yılmaz, Hülya
2012-01-01
Abstract: Ionization constant (pKa) is one among the parameter to be estimated with accuracy, irrespective of solubility constraints. In the present study, acid-base behaviour of the piroxicam and tenoxicam was studied. By using the potentiometric method, pKa values of piroxicam and tenoxicam have been determined in different percentage of acetonitrile-water binary mixtures (acetonitrile content between 30 and 45% in volume). Aqueous pKa values of these compounds were calculated by mole fract...
PÖFF-i filmiturul Baltic Event sünnivad tuleviku kinomagnetid / Kristiina Davidjants
Davidjants, Kristiina, 1974-
2008-01-01
12. PÖFFiga kaasnes ka Tallinnas 30. novembrist 3. detsembrini toimunud filmiturg Baltic Event, millel stsenaariumi staadiumis olevad filmiprojektid otsivad maailma filmitööstuse esindajatest koostööpartnereid. Eestist osales Jaak Kilmi ja Artur Talviku projekt "Rahad ette"
Effect of methylation on the side-chain pKa value of arginine.
Evich, Marina; Stroeva, Ekaterina; Zheng, Yujun George; Germann, Markus W
2016-02-01
Arginine methylation is important in biological systems. Recent studies link the deregulation of protein arginine methyltransferases with certain cancers. To assess the impact of methylation on interaction with other biomolecules, the pKa values of methylated arginine variants were determined using NMR data. The pKa values of monomethylated, symmetrically dimethylated, and asymmetrically dimethylated arginine are similar to the unmodified arginine (14.2 ± 0.4). Although the pKa value has not been significantly affected by methylation, consequences of methylation include changes in charge distribution and steric effects, suggesting alternative mechanisms for recognition. © 2015 The Protein Society.
Rios, J. K.; McHugh, C. M.; Hornbach, M. J.; Mann, P.; Wright, V. D.; Gurung, D.
2013-12-01
The Enriquillo-Plantain-Garden fault zone (EPGF) crosses Lake Enriquillo (LE) in the Dominican Republic and extends E-W across the southern peninsula of Haiti, south of the Baie de Port au Prince (BPP). Seismic stratigraphic studies of CHIRP high-resolution subbottom profiles calibrated to ages obtained from sediment cores and previous coral reef studies provide a Holocene record of relative sea level rise into the BPB and LE and a time frame for understanding tectonics of the EPGF. The BPP is 20 km wide, 20 km long, 150 m deep, and surrounded by coral reefs at water depths of 30 m. Three seismic units were identified: Unit 1: stepped terraces 5-10 m high. Laminated strata onlaps the terraces. This unit possibly represents Marine Isotope Stages 6 and 5, but has not been dated. Unit 2: laminated strata, thicker than 10 m and dated near its top at 22 ka BP. The microfossil assemblages reveal that during the latest Pleistocene sea level lowstand the BPP had a restricted connection with the global ocean. Few well-preserved marine microfossils are present and mostly are reworked. Geochemical analyses reveal that the laminated sediments were deposited during wet periods (>Si, Al wt %, Cu ppm) and dry periods (>Ca wt %). Unit 3: acoustically transparent, ~10 m thick, dated near its base and top at 14 ka BP and 2 ka BP, respectively. This unit represents the Holocene initiation of sea level rise and high stand containing well-preserved marine fossils. At ~9.5 ka BP planktonic foraminifers become abundant implying deepening of marine waters. Lake Enriquillo is 127 km east of the BPP. It is 15 km wide, 40 km long and 45 m deep. CHIRP subbottom profiles penetrated ~30 m below the lake floor. Four main acoustic units were identified: Unit 1: deformed basement with steeply dipping and folded beds. Based on land studies this unit is likely Plio-Pleistocene in age. Unit 2: laminated strata. Ages from coral reefs and deformed strata on land indicate this unit is likely pre-20 ka
4977-bp mitochondrial DNA deletion in infertile patients with varicocele.
Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T
2014-04-01
Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.
ATLAS computing operations within the GridKa Cloud
International Nuclear Information System (INIS)
Kennedy, J; Walker, R; Olszewski, A; Nderitu, S; Serfon, C; Duckeck, G
2010-01-01
The organisation and operations model of the ATLAS T1-T2 federation/Cloud associated to the GridKa T1 in Karlsruhe is described. Attention is paid to Cloud level services and the experience gained during the last years of operation. The ATLAS GridKa Cloud is large and divers spanning 5 countries, 2 ROC's and is currently comprised of 13 core sites. A well defined and tested operations model in such a Cloud is of the utmost importance. We have defined the core Cloud services required by the ATLAS experiment and ensured that they are performed in a managed and sustainable manner. Services such as Distributed Data Management involving data replication,deletion and consistency checks, Monte Carlo Production, software installation and data reprocessing are described in greater detail. In addition to providing these central services we have undertaken several Cloud level stress tests and developed monitoring tools to aid with Cloud diagnostics. Furthermore we have defined good channels of communication between ATLAS, the T1 and the T2's and have pro-active contributions from the T2 manpower. A brief introduction to the GridKa Cloud is provided followed by a more detailed discussion of the operations model and ATLAS services within the Cloud.
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
InterProScan Result: BP116799 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biological... Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...
Energy Technology Data Exchange (ETDEWEB)
Navarro Hervas, F.; Rodriguez Estrella, T.; Carrion Garcia, J. S.; Ros Sala, M. M.; Fernandez Jimenez, S.; Garcia Martinez, M. S.; Mancheno Jimenez, M. A.; Alvarez Rogel, Y.
2009-07-01
Here we describe a formerly unrecognized dry spell dated at between c. 4330 and 3950 radiocarbon years BP, and located in the Puerto de Mazarron (Murcia, southeastern Spain). The palaeoclimatical inference is provided by halite levels within a long sequence of a multiple core study carried in a palaeo-lagoon. The lithological inference is corroborated by palynological records involving a forest depletion. The event is also linked to a population decline in the study region. (Author) 6 refs.
Development of Methods for the Determination of pKa Values
Reijenga, Jetse; van Hoof, Arno; van Loon, Antonie; Teunissen, Bram
2013-01-01
The acid dissociation constant (pKa) is among the most frequently used physicochemical parameters, and its determination is of interest to a wide range of research fields. We present a brief introduction on the conceptual development of pKa as a physical parameter and its relationship to the concept of the pH of a solution. This is followed by a general summary of the historical development and current state of the techniques of pKa determination and an attempt to develop insight into future developments. Fourteen methods of determining the acid dissociation constant are placed in context and are critically evaluated to make a fair comparison and to determine their applications in modern chemistry. Additionally, we have studied these techniques in light of present trends in science and technology and attempt to determine how these trends might affect future developments in the field. PMID:23997574
Validation of SARAL/AltiKa data in the Amazon basin
Santos da Silva, Joecila; Calmant, Stephane; Medeiros Moreira, Daniel; Oliveira, Robson; Conchy, Taina; Gennero, Marie-Claude; Seyler, Frederique
2015-04-01
SARAL/AltiKa is a link between past missions (since it flies on the ERS-ENVISAT orbit with Ku band nadir altimeters in LRM) and future missions such as SWOT's Ka band interferometry swaths. In the present study, we compare the capability of its altimeter AltiKa to that of previous missions working in the Ku band such as ENVISAT and Jason-2 in retrieving water levels over the Amazon basin. Same as for the aforementioned preceding missions, the best results were obtained with the ICE-1 retracking algorithm. We qualitatively analyze the impact of rainfalls in the loss of measurements. Since making long -multi mission- time series is of major importance either for hydro-climatic studies or for basin management, we also present an estimate of the altimeter bias in order that the SARAL series of water level can be appended to those of these previous missions.
Risk Assessment of Mineral Groundwater Near Rogaška Slatina
Trcek, Branka; Leis, Albrecht
2017-10-01
Groundwater resources of mineral and thermo-mineral water are invaluable for planning a sustainable spatial and economic development of the Rogaška Slatina area, which requires a protection of this natural heritage. Numerous previous investigations of Rogaška groundwaters were subjects to balneology and to demands for larger exploitation quantities, that is why information are missing that are essential for definition of the Rogaška fractured aquifer system with mineral and thermo-mineral water and for its protection. The isotopic investigations of groundwaters stored in the Rogaška Slatina fractured aquifer system were performed aiming at answering open questions on the groundwater recharge and dynamics, on connections between different types of aquifers and on solute transport. Environmental isotopes 2H, 18O, 3H, 13C of dissolved inorganic carbon and 14C were analysed in mineral, thermo-mineral and spring waters. Results indicated the source and mechanism of groundwater recharge, its renewability, a transit time distribution, hydraulic interrelationships, the groundwater origin and its evolution due to effects of water-rock interaction. The mean residence time estimates of mineral and thermo- mineral water in the aquifer are between 3400 and 14000 years. On the other hand, the mixing processes between younger and older waters or mineral and spring waters are reflected as well as waters that infiltrated predominantly after the 1960s. These suggest the vulnerability of the research systems to man-made impacts. The presented results coupled with available information on a physical hydrogeology and water chemistry asses the optimal balance between the environmental protection and economic use of mineral water resources in the study area. They are essential for the protection strategy development of mineral and thermo-mineral water in the Rogaška Slatina area bringing together the state administration and local authorities and stakeholders.
Zhao, Wenwei; Zhao, Yan; Qin, Feng
2017-10-01
Understanding fire history and its driving mechanisms can provide valuable insights into present fire regime (intensity, severity and frequency), the interplay between vegetation and fire, and trigger of fire activities. Here we reconstruct the Holocene fire history in the Zoige Basin on the eastern Tibetan Plateau, on the basis of sedimentary micro-charcoal record over the last 10.0 ka (1 ka = 1000 cal yr BP) and discuss the influences of vegetation and climate on fire dynamics. Our results show that regional fire was active at 10.0-3.3 ka and a significant decrease in fire activity characterized the period after 3.3 ka. The high regional fire frequency at 10.0-3.3 ka is consistent with the forested landscape suggested by high affinity scores of cool mixed forest biome (mainly consisted of spruce), implying that fire dynamics during this period was generally controlled by the variations of arboreal biomass and summer temperature. During 6.3-4.6 ka the prevailing Asian summer monsoon provided increased moisture to this region and thus suppressed fire activities to an extent, despite the availability of abundant biomass. Declined tree biomass after 3.3 ka probably accounted for the decreased fire activities. In addition, two successive fire events at ca. 3.5-3.3 ka were likely responsible for the subsequent abrupt decline of forest components in the landscape.
International Nuclear Information System (INIS)
Evelpidou, N.; Karkani, A.; Pirazzoli, P.
2017-01-01
In this paper the tectonic behavior of Leukas and Meganisi islands (Ionian Sea) is examined through underwater research carried out in both islands. A possible Late Holocene correlation between coseismic subsidences is attempted and evidenced by submerged tidal notches in both islands. These subsidence events probably occurred after the uplift that affected the northernmost part of Leukas around 4 to 5ka BP. In conclusion, although the whole area was affected by a similar tectonic strain, certain coseismic events were only recorded in one of the two islands and in some cases they affected only part of the study area.
Energy Technology Data Exchange (ETDEWEB)
Evelpidou, N.; Karkani, A.; Pirazzoli, P.
2017-11-01
In this paper the tectonic behavior of Leukas and Meganisi islands (Ionian Sea) is examined through underwater research carried out in both islands. A possible Late Holocene correlation between coseismic subsidences is attempted and evidenced by submerged tidal notches in both islands. These subsidence events probably occurred after the uplift that affected the northernmost part of Leukas around 4 to 5ka BP. In conclusion, although the whole area was affected by a similar tectonic strain, certain coseismic events were only recorded in one of the two islands and in some cases they affected only part of the study area.
The MCM-associated protein MCM-BP is important for human nuclear morphology.
Jagannathan, Madhav; Sakwe, Amos M; Nguyen, Tin; Frappier, Lori
2012-01-01
Mini-chromosome maintenance complex-binding protein (MCM-BP) was discovered as a protein that is strongly associated with human MCM proteins, known to be crucial for DNA replication in providing DNA helicase activity. The Xenopus MCM-BP homologue appears to play a role in unloading MCM complexes from chromatin after DNA synthesis; however, the importance of MCM-BP and its functional contribution to human cells has been unclear. Here we show that depletion of MCM-BP by sustained expression of short hairpin RNA (shRNA) results in highly abnormal nuclear morphology and centrosome amplification. The abnormal nuclear morphology was not seen with depletion of other MCM proteins and was rescued with shRNA-resistant MCM-BP. MCM-BP depletion was also found to result in transient activation of the G2 checkpoint, slowed progression through G2 and increased replication protein A foci, indicative of replication stress. In addition, MCM-BP depletion led to increased cellular levels of MCM proteins throughout the cell cycle including soluble MCM pools. The results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex.
76 FR 69713 - Application To Export Electric Energy; BP Energy Company
2011-11-09
... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...
Cremer, Antoine; Boulestreau, Romain; Gaillard, Prune; Lainé, Marion; Papaioannou, Georgios; Gosse, Philippe
2018-02-23
Central blood pressure (BP) is a promising marker to identify subjects with higher cardiovascular risk than expected by traditional risk factors. Significant results have been obtained in populations with high cardiovascular risk, but little is known about low-cardiovascular-risk patients, although the differences between central and peripheral BP (amplification) are usually greater in this population. The study aim was to evaluate central BP over 24 hours for cardiovascular event prediction in hypertensive subjects with low cardiovascular risk. Peripheral and central BPs were recorded during clinical visits and over 24 hours in hypertensive patients with low cardiovascular risk (Systematic Coronary Risk Evaluation ≤5%). Our primary end point is the occurrence of a cardiovascular event during follow-up. To assess the potential interest in central pulse pressure over 24 hours, we performed Cox proportional hazard models analysis and comparison of area under the curves using the contrast test for peripheral and central BP. A cohort of 703 hypertensive subjects from Bordeaux were included. After the first 24 hours of BP measurement, the subjects were then followed up for an average of 112.5±70 months. We recorded 65 cardiovascular events during follow-up. Amplification was found to be significantly associated with cardiovascular events when added to peripheral 24-hour pulse pressure ( P =0.0259). The area under the curve of 24-hour central pulse pressure is significantly more important than area under the curve of office BP ( P =0.0296), and there is a trend of superiority with the area under the curve of peripheral 24-hour pulse pressure. Central pulse pressure over 24 hours improves the prediction of cardiovascular events for hypertensive patients with low cardiovascular risk compared to peripheral pulse pressure. © 2018 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.
Expression of the Transcription Factor E4BP4 in Human Basophils
DEFF Research Database (Denmark)
Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard
2014-01-01
Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....
Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9
International Nuclear Information System (INIS)
Burgess, P.H.; Iles, W.J.
1979-08-01
The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)
pKa values in proteins determined by electrostatics applied to molecular dynamics trajectories.
Meyer, Tim; Knapp, Ernst-Walter
2015-06-09
For a benchmark set of 194 measured pKa values in 13 proteins, electrostatic energy computations are performed in which pKa values are computed by solving the Poisson-Boltzmann equation. In contrast to the previous approach of Karlsberg(+) (KB(+)) that essentially used protein crystal structures with variations in their side chain conformations, the present approach (KB2(+)MD) uses protein conformations from four molecular dynamics (MD) simulations of 10 ns each. These MD simulations are performed with different specific but fixed protonation patterns, selected to sample the conformational space for the different protonation patterns faithfully. The root-mean-square deviation between computed and measured pKa values (pKa RMSD) is shown to be reduced from 1.17 pH units using KB(+) to 0.96 pH units using KB2(+)MD. The pKa RMSD can be further reduced to 0.79 pH units, if each conformation is energy-minimized with a dielectric constant of εmin = 4 prior to calculating the electrostatic energy. The electrostatic energy expressions upon which the computations are based have been reformulated such that they do not involve terms that mix protein and solvent environment contributions and no thermodynamic cycle is needed. As a consequence, conformations of the titratable residues can be treated independently in the protein and solvent environments. In addition, the energy terms used here avoid the so-called intrinsic pKa and can therefore be interpreted without reference to arbitrary protonation states and conformations.
Wu, Li; Zhu, Cheng; Ma, Chunmei; Li, Feng; Meng, Huaping; Liu, Hui; Li, Linying; Wang, Xiaocui; Sun, Wei; Song, Yougui
2017-10-01
Palaeo-hydrological and archaeological investigations were carried out in the Jianghan Plain in the middle reaches of the Yangtze River. Based on a comparative analysis of modern flood sediments and multidisciplinary approaches such as AMS14C and archaeological dating, zircon micromorphology, grain size, magnetic susceptibility, and geochemistry, we identified palaeoflood sediments preserved at the Zhongqiao archaeological site. The results indicate that three palaeoflood events (i.e. 4800-4597, 4479-4367, and 4168-3850 cal. yr BP) occurred at the Zhongqiao Site. Comparisons of palaeoflood deposit layers at a number of Neolithic cultural sites show that two extraordinary palaeoflood events occurred in the Jianghan Plain during approximately 4900-4600 cal. yr BP (i.e.mid-late Qujialing cultural period) and 4100-3800 cal. yr BP (i.e. from late Shijiahe cultural period to the Xia Dynasty). Further analysis of the environmental context suggests that these flooding events might have been connected with great climate variability during approximately 5000-4500 cal. yr BP and at ca. 4000 cal. yr BP. These two palaeoflood events were closely related to the expansion of the Jianghan lakes driven by the climatic change, which in turn influenced the rise and fall of the Neolithic cultures in the middle reaches of the Yangtze River. Other evidence also suggests that the intensified discrepancy between social development and environmental change processes (especially the hydrological process) during the late Shijiahe cultural period might be the key factor causing the collapse of the Shijiahe Culture. The extraordinary floods related to the climatic anomaly at ca. 4000 cal. yr BP and political conflicts from internal or other cultural areas all accelerated the collapse of the Shijiahe Culture.
Diatom species composition in the Raška river (Southwestern Serbia
Directory of Open Access Journals (Sweden)
Vidaković Danijela P.
2015-01-01
Full Text Available The paper presents data on the composition of epilithic diatoms in the Raška River. Samples were collected by scraping stone surfaces with a brush from 5 localities along the Raška River in April, June, August and November 2011 and March and May 2012. Diatom frustules were cleaned using cold acid method, and mounted on permanent slides. An investigation of the Raška River resulted in description of 106 diatom taxa. The most species rich genera are Navicula (10, Gomphonema (10 and Nitzschia (9, while other genera are presented with one or more species. Detailed floristic analysis of the benthic diatom flora in this river has not been conducted before. Therefore, this paper provides a groundwork for future researches. [Projekat Ministarstva nauke Republike Srbije, br. TR 037009
Directory of Open Access Journals (Sweden)
Jusuf Topoljak
2015-12-01
Full Text Available Utvrda Kaštel (Fenarlik, locirana između Novog Travnika i Bugojna, vjerovatno je podignuta u razdoblju srednjeg vijeka, a u kartografskim izvorima se prvi put javlja tek 1883. godine. Geodetski planovi i karte 19. i 20. vijeka vjerodostojno dokumentuju propadanje ostataka tog utvrđenja, isprva ga jasno prikazujući kao ruševinu, dok se naposljetku sačuvao samo toponim Kaštel. Ovim radom autori su pokušali identifikovati i objediniti sve relevantne kartografske izvore na kojima je predočen lokalitet Kaštela, uz analizu načina topografisanja ostataka srednjevjekovne utvrde. : The fortress Kaštel (Fenarlik, located between Novi Travnik and Bugojno, probably was built in the period of middle ages. Concerning cartographic sources, it first appeared in 1883. Geodetic plans and maps from the 19th and 20th century credibly documented deterioration of the fortress remains. At first, it clearly displayed a ruin, while ultimately toponym Kaštel was the only preserved. Authors of this paper tried to identify and consolidate all relevant cartographic sources that represent the place Kaštel, together with the analysis of topographing the medieval fortresses.
Dong, Shaopeng; Zhang, Peizhen; Zheng, Wenjun; Yu, Zhongyuan; Lei, Qiyun; Yang, Huili; Liu, Jinfeng; Gong, Huilin
2018-04-01
The Langshan range-front fault (LRF) is an active Holocene normal fault that borders Langshan Mountain and the Hetao Basin, northwest of the Ordos Plateau, China. In this study, paleoseismic trenching was undertaken at three sites (North-South): Dongshen village (TC1), Qingshan (TC2), and Wulanhashao (TC3). The paleoevents ED1, ED2, ED3 from TC1 were constrained to 6.0 ± 1.3, 9.6 ± 2.0, and 19.7 ± 4.2 ka, respectively. The single paleoevent (EQ1) from TC2 was constrained to about 6.7 ± 0.1 ka, and the paleoevents EW1, EW2, and EW3 from TC3 were constrained to 2.3 ± 0.4, 6.0 ± 1.0, and before 7.0 ka, respectively. With reference to previous research, the Holocene earthquake sequence of the LRF can be established as 2.30-2.43 (E1), 3.06-4.41 (E2), 6.71-6.80 (E3), 7.60-9.81 (E4), and 19.70 ± 4.20 (E5) ka BP. Events E1, E3, and E4 might have been caused by events with magnitudes of Mw 7.6-7.8 that ruptured the entire LRF. Event E2 might have been smaller magnitude, about M7.0, and ruptured only a portion of the fault. The vertical slip rate of the LRF at the Qingshan site is inferred as 0.9 or 1.4-1.6 mm/year in the last 6.8 ka. The slip rate at Wulanhashao is considered to have been close to, but not recurrence interval of 2500 years.
Andean glacial lakes and climate variability since the last glacial maximum
Directory of Open Access Journals (Sweden)
1995-01-01
Full Text Available LES LACS GLACIAIRES ET LA VARIABILITÉ CLIMATIQUE DANS LES ANDES DEPUIS LE DERNIER MAXIMUM GLACIAIRE. Des carottages réalisés dans des lacs glaciaires des Andes tropicales et subtropicales ont fourni des registres paléoclimatiques continus couvrant le Dernier Maximum Glaciaire et lHolocène. Des datations 14C sur sédiments lacustres et sur tourbes indiquent que le maximum de la dernière glaciation sest produit antérieurement au Dernier Maximum Glaciaire Global (18 ka BP. La plupart des lacs ont un âge inférieur à 13 ka BP, ce qui signifie que lavancée des glaciers correspondant au Pleistocène terminal aurait culminé aux alentours de 14 ka BP. Des avancées durant le Tardi-glaciaire sont enregistrées dans plusieurs sites lacustres. À partir de 10 ka BP, les glaciers ont reculé au-delà de leurs limites actuelles. La sécheresse de lHolocène moyen est repérée dans la stratigraphie de nombre de lacs, y compris le lac Titicaca. Cette phase daridité est suivie par une remontée des niveaux lacustres et une réavancée des glaciers à la fin de lHolocène. LAGOS GLACIARES ANDINOS Y VARIABILIDAD CLIMÁTICA DESDE EL ÚLTIMO MÁXIMO GLACIAL. Testigos de sedimentos de los lagos glaciares en los Andes tropicales/subtropicales proporcionan registros continuos de los paleoclimas del último glacial superior y del Holoceno. Dataciones del radiocarbón de los sedimentos profundos en los lagos y de las turberas indican que el máximo del último glacial fue antes del máximo glacial global con una fecha de 18 14C ka BP. La mayoría de los lagos tienen una antigüedad menor de 13 14C ka BP, lo que significa que hubo una fase de glaciación del Pleistoceno superior culminada alrededor de 14 14C ka BP. Los avances durante el glacial superior son indicados en varios testigos de sedimentos de los lagos y, después de 10 14C ka BP, los glaciares quedaron dentro de sus límites actuales. Una sequía durante el Holoceno medio est
A geochronological approach for cave evolution in the Cantabrian Coast (Pindal Cave, NW Spain)
Jimenez-Sanchez, M.; Bischoff, J.L.; Stoll, H.; Aranburu, A.
2006-01-01
Some of the oldest speleothems in the North Cantabrian Coast (Spain) are reported for the first time in this work. Pindal Cave is developed at 24 m above sea level, in a karstic massif reaching its highest surface in a marine terrace (rasa) located at 50-64 m above the present sea level. Several phases of evolution were previously recognized into the cave, including block collapse of the roof, episodic flooding and detrital sedimentation, and chemical precipitation of at least four speleothem generations over both alluvial and collapse deposits. Three of these speleothem generations have been dated by U/Th. The first generation yielded ages from 124,2 ?? 1, 5 ka BP to 73,1 ?? 0,9 ka BP, giving a minimum age for the main detritic sediments in the cave. The second one is not dated. The third generation gives an age of 3,71 ?? 0,4 ka BP (mathematically corrected to 2.7 ?? 0.5 ka BP), while for the youngest generation, with actively growing stalagmites in the cave, basal ages of 200 years BP are estimated by counting annual laminae. The data suggest a tentative maximum elevation rate close to 0, 2 mm/yr for the Cantabrian Margin in this area, although further chronological studies will be needed to check this hypothesis. ?? 2006 Gebru??der Borntraeger.
Gear Fault Diagnosis Based on BP Neural Network
Huang, Yongsheng; Huang, Ruoshi
2018-03-01
Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.
Reverberation Mapping of the Kepler target KA1858+48
Pei, Liuyi; Barth, A. J.; Malkan, M. A.; Cenko, S. B.; Clubb, K. I.; Filippenko, A. V.; Gates, E. L.; Horst, J.; Joner, M. D.; Leonard, D. C.; Sand, D. J.
2013-01-01
KA1858+48 is a Seyfert 1 galaxy at redshift 0.078 and is among the brightest active galaxies being monitored by the Kepler mission. We have carried out a reverberation mapping program designed to measure the broad-line region size and estimate the mass of the black hole in KA1858+48. We obtained spectroscopic data using the Kast Spectrograph at the Lick 3 m telescope during dark runs from late winter through fall of 2012, by requesting an observation on each night that the Kast Spectrograph was mounted on the telescope. We also obtained V-band images from the Nickel 1 m telescope at Lick Observatory, the 0.9 m telescope at Brigham Young University West Mountain Observatory, the Faulkes Telescope North at the Las Cumbres Observatory Global Telescope, the KAIT telescope at Lick Observatory, and the 1 m telescope at Mt. Laguna Observatory. The H-beta light curve shows a lag time of approximately 12 days with respect to the V-band continuum flux variations. We will present the continuum and emission-line light curves, cross-correlation lag measurements, and a preliminary estimate of the black hole mass in KA1858+48.
[Clinical significance of NS1-BP expression in esophageal squamous cell carcinoma].
Ren, K; Qian, D; Wang, Y W; Pang, Q S; Zhang, W C; Yuan, Z Y; Wang, P
2018-01-23
Objective: To investigate the clinical significance of NS1-BP expression in patients with esophageal squamous cell carcinoma (ESCC), and to study the roles of NS1-BP in proliferation and apoptosis of ESCC cells. Methods: A total of 98 tumor tissues and 30 adjacent normal tissues from 98 ESCC patients were used as study group and control group, and these samples were collected in Sun Yat-Sen University Cancer Center between 2002 and 2008. In addition, 46 ESCC tissues which were collected in Cancer Institute and Hospital of Tianjin Medical University were used as validation group. Expression of mucosal NS1-BP was detected by immunohistochemistry. Kaplan-Meier curve and log-rank test were used to analyze the survival rate. Multivariate Cox proportional hazard model was used to analyze the prognostic factors. Furthermore, NS1-BP was over expressed or knocked down in ESCC cells by transient transfection. Protein levels of c-Myc were detected by western blot. Cell viability and apoptosis was analyzed by MTT assay and flow cytometry. Results: Among all of tested samples, NS1-BP were down-regulated in 9 out of 30 non-tumorous normal esophageal tissues (30.0%) and 85 out of 144 ESCC tissues (59.0%), respectively, showing a statistically significant difference ( P =0.012). In the study group, three-year disease-free survival rate of NS1-BP high expression group (53.2%) was significantly higher than that of NS1-BP low expression group (27.6%; P =0.009). In the validation group, the three-year disease-free survival rates were 57.8% and 25.5% in NS1-BP high and low levels groups, respectively, showing a similar results ( P =0.016). Importantly, multivariate analyses showed that low expression of NS1-BP was an independent predictor for chemoradiotherapy sensitivity and shorter disease-free survival time in ESCC patients( P <0.05 for all). Furthermore, overexpressed NS1-BP in TE-1 cells repressed c-Myc expression, inhibited cell proliferation and promoted apoptosis. In contrast
Bischoff, James L.; Ludwig, Kenneth R.; Garcia, Jose Francisco; Carbonell, E.; Vaquero, Manola; Stafford, Thomas W.; Jull, A.J.T.
1994-01-01
Abric Romani{dotless}??, a rock shelter located near Barcelona, Spain, contains a charcoal-bearing basal Aurignacian occupation level sandwiched between beds of moss-generated carbonate. The Aurignacian culture is the oldest artefact industry in Europe with which anatomically modern human remains have been associated. Radiocarbon analysis of charcoal fragments by accelerator mass spectrometry (AMS) dates the basal Aurignacian to about 37 ?? 2 ka bp. U-series analyses by alpha spectrometry (AS) and mass spectrometry (MS) date the enclosing carbonate to 43 ?? 1 ka bp. These results confirm the great antiquity of the Aurignacian in northern Spain and support the similar AMS dates from El Castillo and l'Arbreda caves. They also show that radiocarbon dates are significantly younger than U-series at 40 ka bp, as predicted by theory. ?? 1994 Academic Press. All rights reserved.
A new BP Fourier algorithm and its application in English teaching evaluation
Pei, Xuehui; Pei, Guixin
2017-08-01
BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.
InterProScan Result: BP117067 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
Glover, K. C.; MacDonald, G. M.; Kirby, M.
2016-12-01
Hydroclimatic variability is especially important in California, a water-stressed and increasingly populous region. We assess the range of past hydroclimatic sensitivity and variability in the San Bernardino Mountains of Southern California based on 125 ka of lacustrine sediment records. Geochemistry, charcoal and pollen highlight periods of sustained moisture, aridity and sudden variability driven by orbital and oceanic variations. Marine Isotope Stage 3 (MIS 3) is one such period of greater moisture availability that lasted c. 30 kyr, with smaller-scale perturbations likely reflect North Atlantic Dansgaard-Oeschgar events. Past glacial periods, MIS 4 and MIS 2, display high-amplitude changes. These include periods of reduced forest cover that span millennia, indicating long-lasting aridity. Rapid forest expansion also occurs, marking sudden shifts towards wet conditions. Fire regimes have also changed in tandem with hydroclimate and vegetation. Higher-resolution analysis of the past 10 ka shows that Southern California hydroclimate was broadly similar to other regions of the Southwest and Great Basin, including an orbital and oceanic-driven wet Early Holocene, dry Mid-Holocene, and highly variable Late Holocene. Shorter-term pluvial conditions occur throughout the Holocene, with episodic moisture likely derived from a Pacific source.
Tagging b and c quark events in e+e- collisions with neural networks
International Nuclear Information System (INIS)
Proriol, J.; Falvard, A.; Henrard, P.; Jousset, J.; Brandl, B.
1992-01-01
High purity samples of b quark events and, if possible, of c quark events are attempted to produce, and the width of Γ(Z 0 → bb-bar) is measured. The different variables and the method to select the most discriminating variables are given. The physical results obtained with these methods are recalled, and new results are presented with variables connected with the impact parameter. Some neural networks used throughout this work and some results on c quark events selection are also presented. (K.A.) 9 refs.; 6 figs
InterProScan Result: BP124291 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
InterProScan Result: BP123442 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
TopBP1 associates with NBS1 and is involved in homologous recombination repair
International Nuclear Information System (INIS)
Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya
2007-01-01
TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair
The human element of right-sizing. BP experiences
International Nuclear Information System (INIS)
Hollis, J.W.
1994-01-01
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
The human element of right-sizing. BP experiences
Energy Technology Data Exchange (ETDEWEB)
Hollis, J W [BP Norge (Norway)
1994-12-31
BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning
International Nuclear Information System (INIS)
Switsur, Roy
1986-01-01
A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)
Directory of Open Access Journals (Sweden)
Jiang Tinglei
2010-07-01
Full Text Available Abstract Background Global climatic oscillations, glaciation cycles and the unique geographic topology of China have profoundly influenced species population distributions. In most species, contemporary distributions of populations cannot be fully understood, except in a historical context. Complex patterns of Pleistocene glaciations, as well as other physiographic changes have influenced the distribution of bat species in China. Until this study, there had been no phylogeographical research on Myotis davidii, an endemic Chinese bat. We used a combination of nuclear and mitochondrial DNA markers to investigate genetic diversity, population structure, and the demographic history of M. davidii. In particular, we compared patterns of genetic variation to glacial oscillations, topography, and environmental variation during the Pleistocene in an effort to explain current distributions in light of these historical processes. Results M. davidii comprises three lineages (MEP, SWP and SH based on the results of molecular variance analysis (AMOVA and phylogenetic analyses. The results of a STRUCTURE analysis reveal multi-hierarchical population structure in M. davidii. Nuclear and mitochondrial genetic markers reveal different levels of gene flow among populations. In the case of mtDNA, populations adhere to an isolation-by-distance model, whereas the individual assignment test reveals considerable gene flow between populations. MDIV analysis indicate that the split of the MEP and SWP/SH lineages, and from the SWP and SH lineages were at 201 ka BP and 158 ka BP, respectively. The results of a mismatch distribution analysis and neutrality tests indicate a population expansion event at 79.17 ka BP and 69.12 ka BP in MEP and SWP, respectively. Conclusions The complex demographic history, discontinuous extant distribution of haplotypes, and multiple-hierarchy population structure of M. davidii appear associated with climatic oscillations, topography and eco
Muukeelne elanikkond vajab ka ETVd / Ela Tomson
Tomson, Ela, 1945-
2006-01-01
Ilmunud ka: Postimees : na russkom jazõke 4. juuli lk. 7, Pjarnuskii Ekspress 7. juuli lk. 7. Autori arvates on riik jätnud Eestis elava muukeelse elanikkonna Venemaa telekanalite mõju alla. Ometi poleks see, kui varustada ETV tähtsamad saated venekeelsete subtiitritega, midagi rahamahukat ja kaelamurdvat
BP teatas harvast edusammust / Hendrik Vosman
Vosman, Hendrik
2010-01-01
Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud
Spontaneous 8bp Deletion in Nbeal2 Recapitulates the Gray Platelet Syndrome in Mice
Tomberg, Kärt; Khoriaty, Rami; Westrick, Randal J.; Fairfield, Heather E.; Reinholdt, Laura G.; Brodsky, Gary L.; Davizon-Castillo, Pavel; Ginsburg, David; Di Paola, Jorge
2016-01-01
During the analysis of a whole genome ENU mutagenesis screen for thrombosis modifiers, a spontaneous 8 base pair (bp) deletion causing a frameshift in exon 27 of the Nbeal2 gene was identified. Though initially considered as a plausible thrombosis modifier, this Nbeal2 mutation failed to suppress the synthetic lethal thrombosis on which the original ENU screen was based. Mutations in NBEAL2 cause Gray Platelet Syndrome (GPS), an autosomal recessive bleeding disorder characterized by macrothrombocytopenia and gray-appearing platelets due to lack of platelet alpha granules. Mice homozygous for the Nbeal2 8 bp deletion (Nbeal2gps/gps) exhibit a phenotype similar to human GPS, with significantly reduced platelet counts compared to littermate controls (p = 1.63 x 10−7). Nbeal2gps/gps mice also have markedly reduced numbers of platelet alpha granules and an increased level of emperipolesis, consistent with previously characterized mice carrying targeted Nbeal2 null alleles. These findings confirm previous reports, provide an additional mouse model for GPS, and highlight the potentially confounding effect of background spontaneous mutation events in well-characterized mouse strains. PMID:26950939
Spontaneous 8bp Deletion in Nbeal2 Recapitulates the Gray Platelet Syndrome in Mice.
Directory of Open Access Journals (Sweden)
Kärt Tomberg
Full Text Available During the analysis of a whole genome ENU mutagenesis screen for thrombosis modifiers, a spontaneous 8 base pair (bp deletion causing a frameshift in exon 27 of the Nbeal2 gene was identified. Though initially considered as a plausible thrombosis modifier, this Nbeal2 mutation failed to suppress the synthetic lethal thrombosis on which the original ENU screen was based. Mutations in NBEAL2 cause Gray Platelet Syndrome (GPS, an autosomal recessive bleeding disorder characterized by macrothrombocytopenia and gray-appearing platelets due to lack of platelet alpha granules. Mice homozygous for the Nbeal2 8 bp deletion (Nbeal2gps/gps exhibit a phenotype similar to human GPS, with significantly reduced platelet counts compared to littermate controls (p = 1.63 x 10-7. Nbeal2gps/gps mice also have markedly reduced numbers of platelet alpha granules and an increased level of emperipolesis, consistent with previously characterized mice carrying targeted Nbeal2 null alleles. These findings confirm previous reports, provide an additional mouse model for GPS, and highlight the potentially confounding effect of background spontaneous mutation events in well-characterized mouse strains.
International Nuclear Information System (INIS)
Iwabuchi, Kuniyoshi; Matsui, Tadashi; Hashimoto, Mitsumasa; Matsumoto, Yoshihisa; Kurihara, Takayuki; Date, Takayasu
2008-01-01
53BP1 plays important roles in checkpoint signaling and repair for DNA double-strand breaks. We found that a colon cancer cell line, SW48, expressed a splicing variant form of 53BP1, which lacks the residues corresponding to exons 10 and 11. Activation of ATM and phosphorylation of ATM and ATR targets occurred in SW48 cells in response to X-irradiation, and these X-ray-induced responses were not enhanced by expression of full-length 53BP1 in SW48 cells, indicating that this splicing variant fully activates the major checkpoint signaling in SW48 cells. In contrast, the expression of full-length 53BP1 in SW48 cells promoted the repair of X-ray-induced DNA damage, evidenced by faster disappearance of X-ray-induced γ-H2AX foci, a marker for DNA damage, and less residual chromosomal aberrations after X-irradiation. We conclude that the two major roles of 53BP1, the checkpoint signaling and repair for DNA damage, can be functionally separated
Badino, Federica; Ravazzi, Cesare; Vallè, Francesca; Pini, Roberta; Aceti, Amelia; Brunetti, Michele; Champvillair, Elena; Maggi, Valter; Maspero, Francesco; Perego, Renata; Orombelli, Giuseppe
2018-04-01
Sedimentary archives at or near the timberline ecotone in Alpine glaciated areas contain records to study Holocene climate change and the interplay between climate, ecosystems, and humans. We focused on records of timberline and glacier oscillations in the Rutor Glacier forefield (Western Italian Alps) in the last 8800 years. Human activity in this area was negligible for most of the Holocene. We adopted an integrative stratigraphic approach including proxies for glacier advance and timberline estimation, sedimentary events, and reconstructed temperatures. Changes in timberline ecotone correlate to climate until the Middle Ages. Pollen-stratigraphic evidence of a primary plant succession highlights a lag beween local deglaciation and the first reliable 14C age. The radiocarbon chronology points to a prolonged phase of glacier contraction between 8.8 and 3.7 ka cal BP. Even later the glacier remained within its LIA limits. Between 8.4 and 4 ka cal BP MAT-inferred TJuly fluctuated near 12.4 °C, ca. 3.1 °C higher than today. During this period, a Pinus cembra forest belt grew at 2600 m asl with an upper limit of tree groves placed 434 ± 310 m above the current open forest limit. This Holocene phase of thermal maximum ended between 3.98 and 3.51 ± 70 ka cal BP and with a substantial rearrangement of forest composition; temperature reconstruction shows a decrease of 1.8 °C. This climate deterioration concluded the Subboreal thermal optimum, mirroring glacial advances widely documented in the Alps. The Rutor Glacier advanced at ca. AD 1093 ± 65, and remained inside the LIA maximum extent. The LIA started since AD 1594, and culminated between AD 1751 and 1864.
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC
Directory of Open Access Journals (Sweden)
Hanane Ennajdaoui
2016-05-01
Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.
IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC.
Ennajdaoui, Hanane; Howard, Jonathan M; Sterne-Weiler, Timothy; Jahanbani, Fereshteh; Coyne, Doyle J; Uren, Philip J; Dargyte, Marija; Katzman, Sol; Draper, Jolene M; Wallace, Andrew; Cazarez, Oscar; Burns, Suzanne C; Qiao, Mei; Hinck, Lindsay; Smith, Andrew D; Toloue, Masoud M; Blencowe, Benjamin J; Penalva, Luiz O F; Sanford, Jeremy R
2016-05-31
Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3) expression correlates with malignancy, but its role(s) in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC) cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP) revealed significant overlap of IGF2BP3 and microRNA (miRNA) binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC) with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.
Predicting the pKa and stability of organic acids and bases at an oil-water interface.
Andersson, M P; Olsson, M H M; Stipp, S L S
2014-06-10
We have used density functional theory and the implicit solvent model, COSMO-RS, to investigate how the acidity constant, pKa, of organic acids and bases adsorbed at the organic compound-aqueous solution interface changes, compared to its value in the aqueous phase. The pKa determine the surface charge density of the molecules that accumulate at the fluid-fluid interface. We have estimated the pKa by comparing the stability of the protonated and unprotonated forms of a series of molecules in the bulk aqueous solution and at an interface where parts of each molecule reside in the hydrophobic phase and the rest remains in the hydrophilic phase. We found that the pKa for acids is shifted by ∼1 pH unit to higher values compared to the bulk water pKa, whereas they are shifted to lower values by a similar amount for bases. Because this pKa shift is similar in magnitude for each of the molecules studied, we propose that the pKa for molecules at a water-organic compound interface can easily be predicted by adding a small shift to the aqueous pKa. This shift is general and correlates with the functional group. We also found that the relative composition of molecules at the fluid-fluid interface is not the same as in the bulk. For example, species such as carboxylic acids are enriched at the interface, where they can dominate surface properties, even when they are a modest component in the bulk fluid. For high surface concentrations of carboxylic acid groups at an interface, such as a self-assembled monolayer, we have demonstrated that the pKa depends on the degree of deprotonation through direct hydrogen bonding between protonated and deprotonated acidic headgroups.
BP Canada Energy Company : climate change action plan update 1999-2000
International Nuclear Information System (INIS)
2001-10-01
An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs
AHP 44: BILINGUAL EDUCATION IN AMDO - A CASE STUDY OF KHRI KA NATIONALITIES BOARDING SCHOOL
Directory of Open Access Journals (Sweden)
Tshe dpal rdo rje ཚེ་དཔལ་རྡོ་རྗེ། (Caihuan Duojie 才还多杰
2017-02-01
Full Text Available The state sponsored education of Tibetan children in Khri ka (Guide County, Mtsho lho (Hainan Tibetan Autonomous Prefecture, Mtsho sngon (Qinghai Province, China, using Khri ka Nationalities Boarding School as a case study, is described. School history, the government rationale for closing village-based Tibetan primary schools, and the nationalities boarding schools operating in Khri ka in 2015 are introduced. Detailed descriptions of teachers; students; instructional materials; classes; language use; rules; punishments; home visiting; communication between students, parents, and teachers; school reports to the local authorities; and official local supervision and evaluation of Khri ka Nationalities Boarding School are also provided. An overall evaluation of this school concludes the paper.
Preliminary Geological Findings on the BP-1 Simulant
Stoeser, D. B.; Rickman, D. L.; Wilson, S.
2010-01-01
A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.
Kõik, mis valesti sai minna, see on ka valesti läinud / George Soros
Soros, George, 1930-
2008-01-01
Ilmunud ka: Molodjozh Estonii : Biznes Sreda, Delovõje Vedomosti 6. veebr. lk. 10. Praegune finantskriis, mille käivitas kinnisvaramulli lõhkemine USA-s, tähistab ka dollari kui rahvusvahelisel reservvaluutal baseeruva laenuandmise laienemise ajastu lõppu
Lenz, Josefine; Grosse, Guido; Jones, Benjamin M.; Anthony, Katey M. Walter; Bobrov, Anatoly; Wulf, Sabine; Wetterich, Sebastian
2016-01-01
Permafrost-related processes drive regional landscape dynamics in the Arctic terrestrial system. A better understanding of past periods indicative of permafrost degradation and aggradation is important for predicting the future response of Arctic landscapes to climate change. Here, we used a multi-proxy approach to analyse a ~ 4 m long sediment core from a drained thermokarst lake basin on the northern Seward Peninsula in western Arctic Alaska (USA). Sedimentological, biogeochemical, geochronological, micropalaeontological (ostracoda, testate amoebae) and tephra analyses were used to determine the long-term environmental Early-Wisconsin to Holocene history preserved in our core for central Beringia. Yedoma accumulation dominated throughout the Early to Late-Wisconsin but was interrupted by wetland formation from 44.5 to 41.5 ka BP. The latter was terminated by the deposition of 1 m of volcanic tephra, most likely originating from the South Killeak Maar eruption at about 42 ka BP. Yedoma deposition continued until 22.5 ka BP and was followed by a depositional hiatus in the sediment core between 22.5 and 0.23 ka BP. We interpret this hiatus as due to intense thermokarst activity in the areas surrounding the site, which served as a sediment source during the Late-Wisconsin to Holocene climate transition. The lake forming the modern basin on the upland initiated around 0.23 ka BP and drained catastrophically in spring 2005. The present study emphasises that Arctic lake systems and periglacial landscapes are highly dynamic and that permafrost formation as well as degradation in central Beringia was controlled by regional to global climate patterns as well as by local disturbances.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao
2016-10-13
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN
Directory of Open Access Journals (Sweden)
Yuan Pu
2015-01-01
Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.
Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis
Feng, Yitao; Zhang, Lu; Wu, Shaowen; Liu, Zhijun; Gao, Xin; Zhang, Xu; Liu, Maili; Liu, Jianwei; Huang, Xuhui; Wang, Wenning
2016-01-01
The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim
Vega-Hissi, Esteban G.; Estrada, Mario R.; Lavecchia, Martín J.; Pis Diez, Reinaldo
2013-01-01
The pKa, the negative logarithm of the acid dissociation equilibrium constant, of the carboxylic acid groups of unconjugated bilirubin in water is a discussed issue because there are quite different experimental values reported. Using quantum mechanical calculations we have studied the conformational behavior of unconjugated bilirubin species (in gas phase and in solution modeled implicitly and explicitly) to provide evidence that may clarify pKa values because of its pathophysiological relevance. Our results show that rotation of carboxylate group, which is not restricted, settles it in a suitable place to establish stronger interactions that stabilizes the monoanion and the dianion to be properly solvated, demonstrating that the rationalization used to justify the high pKa values of unconjugated bilirubin is inappropriate. Furthermore, low unconjugated bilirubin (UCB) pKa values were estimated from a linear regression analysis.
Catalogue of extreme wave events in Ireland: revised and updated for 14 680 BP to 2017
O'Brien, Laura; Renzi, Emiliano; Dudley, John M.; Clancy, Colm; Dias, Frédéric
2018-03-01
This paper aims to extend and update the survey of extreme wave events in Ireland that was previously carried out by O'Brien et al. (2013). The original catalogue highlighted the frequency of such events dating back as far as the turn of the last ice age and as recent as 2012. Ireland's marine territory extends far beyond its coastline and is one of the largest seabed territories in Europe. It is therefore not surprising that extreme waves have continued to occur regularly since 2012, particularly considering the severity of weather during the winters of 2013-2014 and 2015-2016. In addition, a large number of storm surges have been identified since the publication of the original catalogue. This paper updates the O'Brien et al. (2013) catalogue to include events up to the end of 2017. Storm surges are included as a new category and events are categorised into long waves (tsunamis and storm surges) and short waves (storm and rogue waves). New results prior to 2012 are also included and some of the events previously documented are reclassified. Important questions regarding public safety, services and the influence of climate change are also highlighted. An interactive map has been created to allow the reader to navigate through events: https://drive.google.com/open?id=19cZ59pDHfDnXKYIziYAVWV6AfoE&usp=sharing" target="_blank">https://drive.google.com/open?id=19cZ59pDHfDnXKYIziYAVWV6AfoE&usp=sharing.
Ka-band Technologies for Small Spacecraft Communications via Relays and Direct Data Downlink
Budinger, James M.; Niederhaus, Charles; Reinhart, Richard; Downey, Joe; Roberts, Anthony
2016-01-01
As the scientific capabilities and number of small spacecraft missions in the near Earth region increase, standard yet configurable user spacecraft terminals operating in Ka-band are needed to lower mission cost and risk and enable significantly higher data return than current UHF or S-band terminals. These compact Ka-band terminals are intended to operate with both the current and next generation of Ka-band relay satellites and via direct data communications with near Earth tracking terminals. This presentation provides an overview of emerging NASA-sponsored and commercially provided technologies in software defined radios (SDRs), transceivers, and electronically steered antennas that will enable data rates from hundreds of kbps to over 1 Gbps and operate in multiple frequency bands (such as S- and X-bands) and expand the use of NASA's common Ka-bands frequencies: 22.55-23.15 GHz for forward data or uplink; and 25.5-27.0 GHz for return data or downlink. Reductions in mass, power and volume come from integration of multiple radio functions, operations in Ka-band, high efficiency amplifiers and receivers, and compact, flat and vibration free electronically steered narrow beam antennas for up to + 60 degrees field of regard. The software defined near Earth space transceiver (SD-NEST) described in the presentation is intended to be compliant with NASA's space telecommunications radio system (STRS) standard for communications waveforms and hardware interoperability.
Ka-band waveguide rotary joint
Yevdokymov, Anatoliy
2013-04-11
The authors present a design of a waveguide rotary joint operating in Ka-band with central frequency of 33 GHz, which also acts as an antenna mount. The main unit consists of two flanges with a clearance between them; one of the flanges has three circular choke grooves. Utilisation of three choke grooves allows larger operating clearance. Two prototypes of the rotary joint have been manufactured and experimentally studied. The observed loss is from 0.4 to 0.8 dB in 1.5 GHz band.
MARIJANSKA PUČKA BLAGDANSKA IMENA NA DUBROVAČKOM PODRUČJU
Vulić, Sanja
2009-01-01
U radu se opisuju pučka imena blagdana Gospe Karmelske, Gospe od Anđela, Gospina Pohoda sv. Elizabeti, Gospe od Krunice, Gospe Snježne, Gospe od Zdravlja, Gospe Lurdske, Gospe Fatimske, Imena Marijina, Gospe od Sedam Žalosti, Bezgrješnoga Začeća, Velike Gospe, Male Gospe i nekih lokalnih svetkovina. Uglavnom se razmatraju pučka blagdanska imena koja sam prikupila osobnim terenskim istraživanjem u samom gradu Dubrovniku, u Postranju u Župi dubrovačkoj, u Trpnju i Orebiću na Pelješcu te na otok...
Aeroflot tahab ka ise Moskvast Tallinna lennata / Raimo Poom
Poom, Raimo
2011-01-01
Aeroflot kavatseb suurendada oma rahvusvaheliste reiside hulka umbes veerandi võrra, uute sihtkohtade seas on infoportaali ATO.ru andmeil ka Tallinn. Tallinna lennujaama juhatuse liikme Erik Sakkovi kommentaare
Ka-Band Electronically Steered CubeSat Antenna, Phase II
National Aeronautics and Space Administration — Kymeta Government Solutions (KGS) designed, analyzed, built, tested, and delivered a small, lightweight, low-cost, low-power electronically steered Ka-band prototype...
Ka-Band Klystron Amplifier for CUBESATs, Phase I
National Aeronautics and Space Administration — We propose a Ka-Band klystron amplifier for use in CubeSats. It will operate at 35.7 GHz, have 400 MHz of bandwidth, and output at least 32 watts of saturated power....
pKa-critical Interpretations of Solubility–pH Profiles: PG 300995 and NSC-639829 Case Studies
Directory of Open Access Journals (Sweden)
George Butcher
2015-07-01
Full Text Available Two weak bases, PG-300995 (anti-HIV agent and NSC-639829 (anti-tumor agent, whose log S – pH profiles had been previously published, but whose pKa values had not been reported, were analyzed using a method which can determine pKa values from log S – pH data. This “SpH-pKa” technique, although often practiced, can result in inaccurate pKa values, for a variety of reasons. The operational SpH-pKa values were compared to those predicted by MarvinSketch (ChemAxon, ADMET Predictor (Simulation Plus, and ACD/Percepta (ACD/Labs. The agreement for the sparingly-soluble PG-300995 was reasonably good. However, a substantial difference was found for the practically-insoluble NSC-639829. To probe this further, the pKa of NSC‑639829 was measured by an independent spectrophotometric cosolvent technique. The log S - pH profile of NSC-639829 was then re‑analyzed with the independently-measured pKa. It was found that the equilibrium model which best fit the solubility data is consistent with the presence of a monocationic NSC-639829 dimeric species below pH 4. This illustrates that an independently-determined accurate pKa is critical to mechanistic interpretations of solubility-pH data. Apparently, the Henderson-Hasselbalch equation holds for PG-300995, but not NSC-639829.
Definition of invariants in 3-D application: study of the number of jets in e+e- events
International Nuclear Information System (INIS)
Proriol, J.
1993-01-01
In e + e - events, the jets have a spherical 3D symmetry. The usual method to tag the number of jets is the clusterization using classical algorithms. A set of invariants is defined for 3D objects with a spherical symmetry. These new invariants are used to study the number of jets in e + e - events. (K.A.) 5 refs.; 2 figs
Dryness crisis of the late V BP milenium in the west coast of Port of Mazarron (Murcia, Spain)
International Nuclear Information System (INIS)
Navarro Hervas, F.; Rodriguez Estrella, T.; Carrion Garcia, J. S.; Ros Sala, M. M.; Fernandez Jimenez, S.; Garcia Martinez, M. S.; Mancheno Jimenez, M. A.; Alvarez Rogel, Y.
2009-01-01
Here we describe a formerly unrecognized dry spell dated at between c. 4330 and 3950 radiocarbon years BP, and located in the Puerto de Mazarron (Murcia, southeastern Spain). The palaeoclimatical inference is provided by halite levels within a long sequence of a multiple core study carried in a palaeo-lagoon. The lithological inference is corroborated by palynological records involving a forest depletion. The event is also linked to a population decline in the study region. (Author) 6 refs.
TopBP1-mediated DNA processing during mitosis.
Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H
2016-01-01
Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.
BP pääseb lekkest kuiva nahaga / Heiki Suurkask
Suurkask, Heiki, 1972-
2010-01-01
BP saab peagi valmis tagavara-naftapuuraugu, lekkinud puuraugule õnnestus peale valada betoonkiht. Autor märgib, et tegelikult ei saa USA võimud ühtegi edusammu naftalekke peatamisel selgelt oma nimele kirjutada ning ainsaks kaotajaks selles lekkes peale looduse ja kalurite paistab olevat ameti kaotav BP juht Tony Hatward
Descriptional Complexity of the Languages KaL: Automata, Monoids and Varieties
Directory of Open Access Journals (Sweden)
Ondřej Klíma
2010-08-01
Full Text Available The first step when forming the polynomial hierarchies of languages is to consider languages of the form KaL where K and L are over a finite alphabet A and from a given variety V of languages, a being a letter from A. All such KaL's generate the variety of languages BPol1(V. We estimate the numerical parameters of the language KaL in terms of their values for K and L. These parameters include the state complexity of the minimal complete DFA and the size of the syntactic monoids. We also estimate the cardinality of the image of A* in the Schuetzenberger product of the syntactic monoids of K and L. In these three cases we obtain the optimal bounds. Finally, we also consider estimates for the cardinalities of free monoids in the variety of monoids corresponding to BPol1(V in terms of sizes of the free monoids in the variety of monoids corresponding to V.
Le, Wei; Qi, Lixin; Li, Jiaxuan; Wu, DengIong; Xu, Jun; Zhang, Jinfu
2016-01-01
The present study aims to examine the effect of low-dose ionizing irradiation on DNA double strand breaks (DSB) in mouse spermatogonial stem cells (SSCs) and reveal the underlying pathways for the DNA repair for DSB in SSCs. Eighteen one-month-old mice were divided into 6 groups and sacrificed separately at 45 minutes, 2 hours, 24 hours, 48 hours, and 72 hours after 0.1Gy X-ray irradiation (mice without receiving ionizing irradiation served as control). After perfusion fixation, testes were removed, sectioned, and followed by staining of γH2AX, 53BP1, Caspase 3, and promyelocytic leukemia zinc-finger (PLZF) for analysis among the different groups. The staining was observed by immunofluorescence visualized by confocal laser scanning. After low-dose irradiation, only 53BP1, but not Caspase3 or γH2AX was upregulated in PLZF positive SSCs within 45 minutes. The expression level of 53BP1 gradually decreased 24 hours after irradiation. Moreover, low-dose irradiation had no effect on the cell number and apoptotic status of SSCs. However other spermatogenic cells highly expressed γH2AX shortly after irradiation which was dramatically reduced following the events of DNA repair. It appears that low-dose ionizing irradiation may cause the DNA DSB of mouse spermatogenic cells. 53BP1, but not γH2AX, is involved in the DNA repair for DSB in SSCs. Our data indicates that 53BP1 plays an important role in the pathophysiological repair of DNA DSB in SSCs. This may open a new avenue to understanding the mechanisms of DNA repair of SSCs and male infertility.
200-BP-5 operable unit Technical Baseline report
International Nuclear Information System (INIS)
Jacques, I.D.; Kent, S.K.
1991-10-01
This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted
Advertising as Insurance or Commitment? Evidence from the BP Oil Spill
Lint Barrage; Eric Chyn; Justine Hastings
2014-01-01
This paper explores how advertising impacts the consumer response to news about unobserved product quality. Specifically, we estimate how British Petroleum’s (BP) 2000-2008 “Beyond Petroleum” advertising campaign affected the impact of the 2010 BP oil spill. We find that BP station margins declined by 4.2 cents per gallon, and volumes declined by 3.6 percent after the spill. However, pre-spill advertising significantly dampened the price response in the short-run, and reduced the fraction of ...
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
International Nuclear Information System (INIS)
Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.
2015-01-01
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication
Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication
Energy Technology Data Exchange (ETDEWEB)
Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)
2015-04-15
The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.
Wang, Jianjun; Sun, Liguang; Chen, Liqi; Xu, Libin; Wang, Yuhong; Wang, Xinming
2016-06-10
Extreme climatic events have profound impacts on human society. Here we present the results of a study of organic biomarkers within a sedimentary section at the archaeological site of Yuchisi, eastern China, in order to reconstruct climatic variability during the Dawenkou (5,050-4,400 yr BP) and Longshan (4,400-4,000 yr BP) cultures. At ~4,400 yr BP, within the cultural transition horizon, abrupt changes in biomarkers, such as the fatty acid ratio C18:2/C18:0, 2C31/(C27 + C29), n-C18-ol and n-C30-ol, indicate the occurrence of local climate changes over the course of a few decades. These changes occurred during the transition from the Holocene warm period to a subsequent cold period which lasted for the following 600 years. This climatic shift has been recorded at numerous sites worldwide, and it is likely to have been the main cause of the widespread collapse of many isolated cultures at that time. The palaeoclimatic and archaeological data from the Yuchisi sediments may provide new insights into the relationship between climate change and prehistoric cultural transitions.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Directory of Open Access Journals (Sweden)
Tin Nguyen
Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori
2012-01-01
MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.
NOAA Ship Ka'imimoana Underway Meteorological Data, Quality Controlled
National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Ka'imimoana Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic System...
Revalidation and rationale for high pKa values of unconjugated bilirubin
Directory of Open Access Journals (Sweden)
Ostrow J Donald
2007-05-01
Full Text Available Abstract Background Our prior solvent partition analysis, published in 1992, yielded pKa values for unconjugated bilirubin of about 8.1 and 8.4, but these results have been challenged and studies by other methods have suggested pKa values below 5.0. Methods We repeated our published solvent partition studies, using 14C-unconjugated bilirubin highly purified by extraction of residual labeled impurities from CHCl3 into an aqueous buffer, pH 7.0. Partition ratios at six pH values from 5.0 to 9.0 were determined by radioassay and compared with our prior values obtained by diazo assay. Results At pH values ranging from 4.8 to 9.2, stable aqueous/chloroform 14C-partition ratios did not differ significantly from our published partition ratios based on diazo assay. Conclusion These results support the high pKa values of unconjugated bilirubin, above 8.0, derived from our earlier solvent partition study. In both studies, our measurements were based on the rapid analysis of clearly under-saturated solutions of highly-purified bilirubin over a wide pH range, using properly purified and preserved solvents. No previous direct estimate of the aqueous pKa values of unconjugated bilirubin meets all these preconditions. Three theoretical factors acting in combination, each related to the unique, extensive internal H-bonding of the -COOH groups, are proposed to support high pKa values of unconjugated bilirubin in water: a donation of an H-bond from the -OH moiety of the -COOH group, which is broken on ionization; b hindered solvation of the -COO- group after ionization; and c restricted rotation of the -COO- and -COOH groups. Our findings and rationale rebut methodological and theoretical criticisms leveled against our prior work. High pKa values for unconjugated bilirubin dictate that: a bilirubin diacid, which readily diffuses across membranes and can cause neurotoxicity, is the dominant unbound bilirubin species of unconjugated bilirubin in plasma at
Yu, Donghai; Du, Ruobing; Xiao, Ji-Chang
2016-07-05
Ninety-six acidic phosphorus-containing molecules with pKa 1.88 to 6.26 were collected and divided into training and test sets by random sampling. Structural parameters were obtained by density functional theory calculation of the molecules. The relationship between the experimental pKa values and structural parameters was obtained by multiple linear regression fitting for the training set, and tested with the test set; the R(2) values were 0.974 and 0.966 for the training and test sets, respectively. This regression equation, which quantitatively describes the influence of structural parameters on pKa , and can be used to predict pKa values of similar structures, is significant for the design of new acidic phosphorus-containing extractants. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
GPM, DPR Level 2A Ka Precipitation V03
National Aeronautics and Space Administration — The 2AKa algorithm provides precipitation estimates from the Ka radar of the Dual-Frequency Precipitation Radar on the core GPM spacecraft. The product contains two...
Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.
Marriott, James; Muttitt, Greg
2006-01-01
An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.
Predicting the pKa and stability of organic acids and bases at an oil-water interface
DEFF Research Database (Denmark)
Andersson, Martin Peter; Olsson, Mats Henrik Mikael; Stipp, Susan Louise Svane
2014-01-01
We have used density functional theory and the implicit solvent model, COSMO-RS, to investigate how the acidity constant, pKa, of organic acids and bases adsorbed at the organic compound-aqueous solution interface changes, compared to its value in the aqueous phase. The pKa determine the surface...... phase and the rest remains in the hydrophilic phase. We found that the pKa for acids is shifted by ∼1 pH unit to higher values compared to the bulk water pKa, whereas they are shifted to lower values by a similar amount for bases. Because this pKa shift is similar in magnitude for each of the molecules...... is not the same as in the bulk. For example, species such as carboxylic acids are enriched at the interface, where they can dominate surface properties, even when they are a modest component in the bulk fluid. For high surface concentrations of carboxylic acid groups at an interface, such as a self...
Perner, Kerstin; Moros, Matthias; De Deckker, Patrick; Blanz, Thomas; Wacker, Lukas; Telford, Richard; Siegel, Herbert; Schneider, Ralph; Jansen, Eystein
2018-01-01
The Leeuwin Current (LC), an eastern boundary current, transports tropical waters from the Indo-Pacific Warm Pool (IPWP) towards southern latitudes and modulates oceanic conditions offshore southern Australia. New, high-resolution planktic foraminifer assemblage data and alkenone-derived sea surface temperatures (SST) provide an in-depth view on LC variability and mechanisms driving the current's properties during the mid to late Holocene (last c. 7.4 ka BP). Our marine reconstructions highlight a longer-term mid to late Holocene reduction of tropical heat export from the IPWP area into the LC. Mid Holocene (c. 7.4 to 3.5 ka BP) occurrence of high SSTs (>19.5 °C), tropical planktic foraminifera and a well-stratified water column document an enhanced heat export from the tropics. From c. 3.5 ka BP onwards, a weaker LC and a notably reduced tropical heat export cause oceanic cooling offshore southern Australia. The observed mid to late Holocene trends likely result from large-scale changes in the IPWP's heat storage linked to the El Niño-Southern Oscillation (ENSO) phenomenon. We propose that a strong and warm LC occurs in response to a La Niña-like state of ENSO during the mid Holocene. The late Holocene LC cooling, however, results from a shift towards an El Niño-like state and a more variable ENSO system that causes cooling of the IPWP. Superimposed on these longer-term trends we find evidence of distinct late Holocene millennial-scale phases of enhanced El Niño/La Niña development, which appear synchronous with northern hemispheric climatic variability. Phases of dominant El Niño-like states occur parallel to North Atlantic cold phases: the '2800 years BP cooling event', the 'Dark Ages' and the 'Little Ice Age', whereas the 'Roman Warm Period' and the 'Medieval Climate Anomaly' parallel periods of a predominant La Niña-like state. Our findings provide further evidence of coherent interhemispheric climatic and oceanic conditions during the mid to late
Directory of Open Access Journals (Sweden)
Smita Srivastava
2008-05-01
Full Text Available Vpx is a small virion-associated adaptor protein encoded by viruses of the HIV-2/SIVsm lineage of primate lentiviruses that enables these viruses to transduce monocyte-derived cells. This probably reflects the ability of Vpx to overcome an as yet uncharacterized block to an early event in the virus life cycle in these cells, but the underlying mechanism has remained elusive. Using biochemical and proteomic approaches, we have found that Vpx protein of the pathogenic SIVmac 239 strain associates with a ternary protein complex comprising DDB1 and VprBP subunits of Cullin 4-based E3 ubiquitin ligase, and DDA1, which has been implicated in the regulation of E3 catalytic activity, and that Vpx participates in the Cullin 4 E3 complex comprising VprBP. We further demonstrate that the ability of SIVmac as well as HIV-2 Vpx to interact with VprBP and its associated Cullin 4 complex is required for efficient reverse transcription of SIVmac RNA genome in primary macrophages. Strikingly, macrophages in which VprBP levels are depleted by RNA interference resist SIVmac infection. Thus, our observations reveal that Vpx interacts with both catalytic and regulatory components of the ubiquitin proteasome system and demonstrate that these interactions are critical for Vpx ability to enable efficient SIVmac replication in primary macrophages. Furthermore, they identify VprBP/DCAF1 substrate receptor for Cullin 4 E3 ubiquitin ligase and its associated protein complex as immediate downstream effector of Vpx for this function. Together, our findings suggest a model in which Vpx usurps VprBP-associated Cullin 4 ubiquitin ligase to enable efficient reverse transcription and thereby overcome a block to lentivirus replication in monocyte-derived cells, and thus provide novel insights into the underlying molecular mechanism.
Alloway, Brent V.; Lowe, David J.; Barrell, David J. A.; Newnham, Rewi M.; Almond, Peter C.; Augustinus, Paul C.; Bertler, Nancy A. N.; Carter, Lionel; Litchfield, Nicola J.; McGlone, Matt S.; Shulmeister, Jamie; Vandergoes, Marcus J.; Williams, Paul W.; Members, Nz-Intimate
2007-01-01
It is widely recognised that the acquisition of high-resolution palaeoclimate records from southern mid-latitude sites is essential for establishing a coherent picture of inter-hemispheric climate change and for better understanding of the role of Antarctic climate dynamics in the global climate system. New Zealand is considered to be a sensitive monitor of climate change because it is one of a few sizeable landmasses in the Southern Hemisphere westerly circulation zone, a critical transition zone between subtropical and Antarctic influences. New Zealand has mountainous axial ranges that amplify the climate signals and, consequently, the environmental gradients are highly sensitive to subtle changes in atmospheric and oceanic conditions. Since 1995, INTIMATE has, through a series of international workshops, sought ways to improve procedures for establishing the precise ages of climate events, and to correlate them with high precision, for the last 30 000 calendar years. The NZ-INTIMATE project commenced in late 2003, and has involved virtually the entire New Zealand palaeoclimate community. Its aim is to develop an event stratigraphy for the New Zealand region over the past 30 000 years, and to reconcile these events against the established climatostratigraphy of the last glacial cycle which has largely been developed from Northern Hemisphere records (e.g. Last Glacial Maximum (LGM), Termination I, Younger Dryas). An initial outcome of NZ-INTIMATE has been the identification of a series of well-dated, high-resolution onshore and offshore proxy records from a variety of latitudes and elevations on a common calendar timescale from 30 000 cal. yr BP to the present day. High-resolution records for the last glacial coldest period (LGCP) (including the LGM sensu stricto) and last glacial-interglacial transition (LGIT) from Auckland maars, Kaipo and Otamangakau wetlands on eastern and central North Island, marine core MD97-2121 east of southern North Island, speleothems
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
Under tõi kirjanduse juurde ka Ilvese / Jaanus Kulli
Kulli, Jaanus, 1955-
2009-01-01
Sirje Kiini raamatust "Marie Under : elu, luuletaja identiteet ja teoste vastuvõtt" (Tallinn : Tänapäev, 2009), mille esitlus toimus 10. dets. Kirjanike Majas Tallinnas. Sõnavõtuga esines ka president Toomas Hendrik Ilves
Swedbank hüvitab tekitatud kahju ka fondi vahetajatele
2009-01-01
Swedbank hüvitab veel enne 2009. aasta lõppu Private Debt Fondi osaku puhasväärtuse alanemise kolmandas kvartalis ning kompensatsiooni saavad ka need kliendid, kes on andnud sisse pensionifondi vahetamise taotluse
Internetiside VoIP sobib ka ettevõtteile / Valdur Laid
Laid, Valdur, 1969-
2005-01-01
Ilmunud ka: Delovõje Vedomosti 8. juuni lk. 19. Kommunikatsiooni liikumisest internetti ehk IP-võrku ning selle võimalustest ettevõtjaile. Vt. samas: Väikefirmade IP-lahendus jõuab aasta lõpus massturule
Study on MPGA-BP of Gravity Dam Deformation Prediction
Directory of Open Access Journals (Sweden)
Xiaoyu Wang
2017-01-01
Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.
RanBP3 influences interactions between CRM1 and its nuclear protein export substrates
Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike
2001-01-01
We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...
BP Investment Exceeds $4 Bln in china
Institute of Scientific and Technical Information of China (English)
Wang Ping
2008-01-01
@@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.
Directory of Open Access Journals (Sweden)
Kerstin Lidén
2006-12-01
Full Text Available Genetic variation in the chemokine receptor gene CCR5 has received considerable scientific interest during the last few years. Protection against HIV-infection and AIDS, together with specific geographic distribution are the major reasons for the great interest in CCR5 32bp deletion. The event for the occurrence of this mutation has been postulated by coalescence dating to the 14th century, or 5000 BP. In our prehistoric Swedish samples we show that the frequency of 32pb deletion in CCR5 in the Neolithic population does not deviate from the frequency in a modern Swedish population, and that the deletion existed in Sweden already during the Mesolithic period.
Comparison of AltiKa and CryoSat-2 Elevation and Elevation Rates over the Amundsen Sea Sector
Otosaka, I.; Shepherd, A.; Hogg, A.
2017-12-01
Altimeters have been successfully used for more than two decades to observe changes in the ice sheet surface and to estimate the contribution of ice sheets to sea level rise. The Satellite for Argos and AltiKa (SARAL) was launched in February 2013 as a joint mission between the French space agency (CNES) and the Indian Space Research Organisation (ISRO). While the altimeters previously launched into space are operating at Ku-band (13.6 GHz), the altimeter on board SARAL, AltiKa, is the first instrument to operate at Ka-band (36.8 GHz). The higher frequency of AltiKa is expected to lead to reduced penetration of the radar signal into the snowpack, compared to Ku-band. A comparison of ice sheet elevation measurements recorded at the two frequencies may therefore provide useful information on surface and its scattering properties. In this study, we compare elevation and elevation rates recorded by AltiKa and CryoSat-2 between March 2013 and April 2017 over the Amundsen Sea Sector (ASS), one of the most rapidly changing sectors of West Antarctica. Elevation and elevation rates are computed within 5 km grid cells using a plane fit method, taking into account the contributions of topography and fluctuations in elevation and backscatter. The drifting orbit and imaging modes of CryoSat-2 result in 78,7 % sampling of the study area, whereas AltiKa samples 39,7 % due to its sparser orbit pattern and due to loss of signal in steeply sloping coastal margins. Over the study period, the root mean square difference between elevation and elevation change recorded at Ka-band and Ku-band were 40.3 m and 0.54 m/yr, respectively. While the broad spatial pattern of elevation change is well resolved by both satellites, data gaps along the Getz coastline may be partly responsible for the lower elevation change rate observed at Ka-band. We also compared CryoSat-2 and AltiKa to coincident airborne data from NASA's Operation IceBridge (OIB). The mean difference of elevation rate between
Upadhyaya, Himanshu; Tanaka, Yoko; Lipsius, Sarah; Kryzhanovskaya, Ludmila A; Lane, Jeannine R; Escobar, Rodrigo; Trzepacz, Paula T; Allen, Albert J
2015-01-01
Adults with attention-deficit/hyperactivity disorder treated with atomoxetine were examined for time-to-onset and -resolution of common treatment-emergent adverse events (TEAEs) and male sexual dysfunction, and for changes in blood pressure (BP) and heart rate (HR) upon atomoxetine discontinuation. 12-week open-label atomoxetine (40-100 mg/day) was followed by 12-week double-blind maintenance treatment (atomoxetine 80 or 100 mg/day). Responders were then randomized to atomoxetine (n = 266) or placebo (n = 258) for 25-week randomized withdrawal. Examined were (1) median time-to-onset and -resolution of TEAEs during atomoxetine treatment, and (2) within group, visitwise mean changes for sitting HR, systolic BP, and diastolic BP for the postrandomization placebo group. Common adverse events (AEs) appeared early, within week 1 of atomoxetine treatment. Some AEs resolve relatively rapidly, whereas others have a more lingering course of resolution (including male sexual side effects); median resolution times were 3 - 53 days. BP and HR increases during atomoxetine treatment returned to baseline upon atomoxetine discontinuation. Atomoxetine is associated with common AEs, with 3- to 53-day median resolution times. ClincialTrials.gov - NCT00700427.
Ehitusala tõus jätkus ka mullu
2004-01-01
Ilmunud ka: Delovõje Vedomosti, 3. nov. 2004, lk. 14-15. Ehitusfirmade TOP 95 aastal 2003. Kasumi TOP 40. Käibe TOP 40. TOP-i koostamise metoodika. Kasumi kasvu TOP 20. Käibe kasvu TOP 20. Omakapitali tootluse TOP 20. Rentaabluse TOP 20. Ehitusettevõtete üld- ja finantsandmed
Directory of Open Access Journals (Sweden)
Aikaterini Patsatsi
2012-01-01
Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.
Intensified summer monsoon and the urbanization of Indus Civilization in northwest India.
Dixit, Yama; Hodell, David A; Giesche, Alena; Tandon, Sampat K; Gázquez, Fernando; Saini, Hari S; Skinner, Luke C; Mujtaba, Syed A I; Pawar, Vikas; Singh, Ravindra N; Petrie, Cameron A
2018-03-09
Today the desert margins of northwest India are dry and unable to support large populations, but were densely occupied by the populations of the Indus Civilization during the middle to late Holocene. The hydroclimatic conditions under which Indus urbanization took place, which was marked by a period of expanded settlement into the Thar Desert margins, remains poorly understood. We measured the isotopic values (δ 18 O and δD) of gypsum hydration water in paleolake Karsandi sediments in northern Rajasthan to infer past changes in lake hydrology, which is sensitive to changing amounts of precipitation and evaporation. Our record reveals that relatively wet conditions prevailed at the northern edge of Rajasthan from ~5.1 ± 0.2 ka BP, during the beginning of the agricultural-based Early Harappan phase of the Indus Civilization. Monsoon rainfall intensified further between 5.0 and 4.4 ka BP, during the period when Indus urban centres developed in the western Thar Desert margin and on the plains of Haryana to its north. Drier conditions set in sometime after 4.4 ka BP, and by ~3.9 ka BP an eastward shift of populations had occurred. Our findings provide evidence that climate change was associated with both the expansion and contraction of Indus urbanism along the desert margin in northwest India.
Sleep-time BP: prognostic marker of type 2 diabetes and therapeutic target for prevention.
Hermida, Ramón C; Ayala, Diana E; Mojón, Artemio; Fernández, José R
2016-02-01
We investigated the prognostic value of clinic and ambulatory BP (ABP) to predict new-onset diabetes and whether risk reduction is related to the progressive decrease of clinic BP or awake or asleep ABP. We prospectively evaluated 2,656 individuals without diabetes, 1,292 men and 1,364 women, 50.6 ± 14.3 years of age, with baseline BP ranging from normotension to hypertension according to ABP criteria. At baseline and annually (more frequently if hypertension treatment was adjusted based on ABP) thereafter, ABP and physical activity (wrist actigraphy) were simultaneously monitored for 48 h to accurately derive the awake and asleep BP means. During a 5.9-year median follow-up, 190 participants developed type 2 diabetes. The asleep systolic ABP mean was the most significant predictor of new-onset diabetes in a Cox proportional-hazard model adjusted for age, waist circumference, glucose, chronic kidney disease (CKD) and hypertension treatment. Daytime clinic BP and awake or 48 h ABP mean had no predictive value when corrected by the asleep ABP mean. Analyses of BP changes during follow-up revealed a 30% reduction in the risk of new-onset diabetes per 1-SD decrease in asleep systolic ABP mean, independent of changes in clinic BP or awake or 48 h ABP means. Sleep-time BP is a highly significant independent prognostic marker for new-onset diabetes. Alteration in sleep-time BP regulation seems to precede, rather than follow, the development of new-onset diabetes. Most important, lowering asleep BP, a novel therapeutic target requiring ABP evaluation, could be a significant method for reducing new-onset diabetes risk.
CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc
International Nuclear Information System (INIS)
Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.
2010-01-01
BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.
Rayne, Sierra; Forest, Kaya
2016-10-14
In order to estimate isomer-specific acidity constants (pKa) for the perfluorinated sulfonic acid (PFSA) environmental contaminants, the parameterization method 6 (PM6) pKa prediction method was extensively validated against a wide range of carbon oxyacids and related sulfonic/sulfinic acids. Excellent pKa prediction performance was observed for the carbon oxyacids using the PM6 method, but this approach was found to have a severe positive bias for sulfonic/sulfinic acids. To overcome this obstacle, a correlation was developed between non-adjusted PM6 pKa values and the corresponding experimentally obtained/estimated acidity constants for a range of representative alkyl, aryl and halogen-substituted sulfonic acids. Application of this correction to the PM6 values allows for extension of this computational method to a new acid functional group. When used to estimate isomer-specific pKa values for the C1 through C8 PFSAs, the modified PM6 approach suggests an adjusted pKa range from -5.3 to -9.0, indicating that all members of this class of well-known environmental contaminants will be effectively completely dissociated in aquatic systems.
Overexpressed CacyBP/SIP leads to the suppression of growth in renal cell carcinoma
International Nuclear Information System (INIS)
Sun, Shiren; Ning, Xiaoxuan; Liu, Jie; Liu, Lili; Chen, Yu; Han, Shuang; Zhang, Yanqi; Liang, Jie; Wu, Kaichun; Fan, Daiming
2007-01-01
Calcyclin-binding protein/Siah-1-interacting protein (CacyBP/SIP), a target protein of S100, has been identified as a component of a novel ubiquitinylation complex leading to β-catenin degradation, which was found to be related to the malignant phenotypes of gastric cancer. However, the roles of CacyBP/SIP in renal cell carcinoma still remain unclear. In the present study, we had analyzed the expression of the CacyBP/SIP protein in human renal cancer cells and clinical tissue samples. The possible roles of CacyBP/SIP in regulating the malignant phenotype of renal cancer cells were also investigated. The results demonstrated that the expression of CacyBP/SIP was markedly down-regulated in renal cell carcinoma tissues and cell lines. Ectopic overexpression of CacyBP/SIP in A498 cells inhibited the proliferation of this cell and delayed cell cycle progression significantly, which might be related to the down-regulation of Cyclin D1 through reducing β-catenin protein. CacyBP/SIP also suppressed colony formation in soft agar and its tumorigenicity in nude mice. Taken together, our work showed that CacyBP/SIP, as a novel down-regulated gene in renal cell carcinoma, suppressed proliferation and tumorigenesis of renal cancer cells
Bidet, Katell; Dadlani, Dhivya; Garcia-Blanco, Mariano A
2014-07-01
Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV). We examined three conserved host RNA-binding proteins (RBPs) G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2) infection and found them to be novel regulators of the interferon (IFN) response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs), and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA), which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
The IUPAC aqueous and non-aqueous experimental pKa data repositories of organic acids and bases.
Slater, Anthony Michael
2014-10-01
Accurate and well-curated experimental pKa data of organic acids and bases in both aqueous and non-aqueous media are invaluable in many areas of chemical research, including pharmaceutical, agrochemical, specialty chemical and property prediction research. In pharmaceutical research, pKa data are relevant in ligand design, protein binding, absorption, distribution, metabolism, elimination as well as solubility and dissolution rate. The pKa data compilations of the International Union of Pure and Applied Chemistry, originally in book form, have been carefully converted into computer-readable form, with value being added in the process, in the form of ionisation assignments and tautomer enumeration. These compilations offer a broad range of chemistry in both aqueous and non-aqueous media and the experimental conditions and original reference for all pKa determinations are supplied. The statistics for these compilations are presented and the utility of the computer-readable form of these compilations is examined in comparison to other pKa compilations. Finally, information is provided about how to access these databases.
Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches
Directory of Open Access Journals (Sweden)
Gurmanik Kaur
2014-01-01
Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Prediction of BP reactivity to talking using hybrid soft computing approaches.
Kaur, Gurmanik; Arora, Ajat Shatru; Jain, Vijender Kumar
2014-01-01
High blood pressure (BP) is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI), and arm circumference (AC) were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA) was fused with artificial neural network (ANN), adaptive neurofuzzy inference system (ANFIS), and least square-support vector machine (LS-SVM) model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R (2)), root mean square error (RMSE), and mean absolute percentage error (MAPE) revealed that PCA based LS-SVM (PCA-LS-SVM) model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.
Danngarrd-Oscar events recorded in a terrestrial sequence in central British Columbia, Canada
Ward, B. C.; Geertsema, M.; Telka, A.; Mathewes, R.
2012-12-01
The Indianpoint section, 90 km southeast of Prince George, presents a >25 ka record of paleoenvironmental changes from non-glacial MIS 3 time to just before Late Wisconsinan (MIS2) ice from the Cordilleran Ice Sheet overran the site. Detailed plant and insect macrofossil and pollen analyses were carried out on a 5-6 m thick fine-grained unit. It represents a small lake, based on aquatic plants and insects, and taxa indicative of riparian or shoreline environments. A total of 11 radiocarbon ages, most obtained on willow (Salix) twigs provide chronological control for 8 levels. Radiocarbon ages of >44 ka (CAMS-96170) and 46.5 ka (CAMS 93938) were obtained near the base and are associated with spruce macrofossils (abundant needles, seeds and seed wings) and high spruce pollen. Between 37.0 ka (CAMS115785) and 25.9 ka (CAMS117312) alternations between open spruce forest and tundra with minor willow and birch occur. In the upper 2.5 m of the section, between 24.5 ka (CAMS 93940) and 20.4 ka (CAMS 93939), the vegetation changes to dry shrub tundra, dominated again by willow with minor birch. Most pollen from this interval comes from herbs such as sedges, grasses and Artemisia. Also present are characteristic insects such as the weevil Vitavitus thulius and the ground beetles Trichocellus mannerheimi, Pteriostichus (Cryobius) nivalis, and Amara alpina that are presently only found in dry tundra habitats. The decrease in the occurrence of willow and birch in the upper 40-50 cm reflects increasingly harsh conditions as glaciers approached the site. An age of 19.9 ka (AA44045) has been obtained on a willow twig 20-30 cm below where the unit is truncated by a Late Wisconsinan till. The lacustrine unit of the Indianpoint section spans >25 ka and records climatic variation during MIS 3 and deterioration associated with the growth of the Cordilleran Ice Sheet during the Late Wisconsinan (MIS 2). The alternations in the middle portion of the record are thought to represent
High Current, Low Voltage Power Converter [20kA, 6V] LHC Converter Prototype
Jørgensen, H E; Dupaquier, A; Fernqvist, G
1998-01-01
The superconducting LHC accelerator requires high currents (~12.5kA) and relatively low voltages (~10 V) for its magnets. The need to install the power converters underground is the driving force for reduced volume and high efficiency. Moreover, the LHC machine will require a very high level of performance from the power converters, particularly in terms of DC stability, dynamic response and also in matters of EMC. To meet these requirements soft-switching techniques will be used. This paper describes the development of a [20kA,6V] power converter intended as a stable high-current source for D CCT calibration and an evaluation prototype for the future LHC converters. The converter is made with a modular concept with five current sources [4kA,6V] in parallel. The 4kA sources are built as plu g-in modules: a diode rectifier on the AC mains with a damped L-C passive filter, a Zero Voltage Switching inverter working at 20 kHz and an output stage (high frequency transformers, Schottky rectifi ers and output filter...
Divergent homologs of the predicted small RNA BpCand697 in Burkholderia spp.
Damiri, Nadzirah; Mohd-Padil, Hirzahida; Firdaus-Raih, Mohd
2015-09-01
The small RNA (sRNA) gene candidate, BpCand697 was previously reported to be unique to Burkholderia spp. and is encoded at 3' non-coding region of a putative AraC family transcription regulator gene. This study demonstrates the conservation of BpCand697 sequence across 32 Burkholderia spp. including B. pseudomallei, B. mallei, B. thailandensis and Burkholderia sp. by integrating both sequence homology and secondary structural analyses of BpCand697 within the dataset. The divergent sequence of BpCand697 was also used as a discriminatory power in clustering the dataset according to the potential virulence of Burkholderia spp., showing that B. thailandensis was clearly secluded from the virulent cluster of B. pseudomallei and B. mallei. Finally, the differential co-transcript expression of BpCand697 and its flanking gene, bpsl2391 was detected in Burkholderia pseudomallei D286 after grown under two different culture conditions using nutrient-rich and minimal media. It is hypothesized that the differential expression of BpCand697-bpsl2391 co-transcript between the two standard prepared media might correlate with nutrient availability in the culture media, suggesting that the physical co-localization of BpCand697 in B. pseudomallei D286 might be directly or indirectly involved with the transcript regulation of bpsl2391 under the selected in vitro culture conditions.
Test results on prototype 50-kA conductors for tokamak induction heating coils
International Nuclear Information System (INIS)
Wollan, J.J.; Williamson, K.D. Jr.; Turck, B.
1979-01-01
Fabricability of a very large, 50-kA superconducting cable has been demonstrated. Test results of critical current and stability measurements are presented. The design critical current of 55 kA at 7 T was met. The recovery current was degraded as a result of the expectedly poor insulation system. Energy loss measurements on prototype advanced mixed matrix conductors, which will be incorporated into a second prototype cable, are presented
Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon
2015-01-01
Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...
Mallamaci, Francesca; Tripepi, Rocco; Leonardis, Daniela; Mafrica, Angela; Versace, Maria Carmela; Provenzano, Fabio; Tripepi, Giovanni; Zoccali, Carmine
2016-10-01
The clinical relevance of ambulatory blood pressure monitoring (ABPM) for risk stratification in renal transplant patients still remains poorly defined. We investigated the association between clinic and ABPM with an established biomarker of atherosclerosis (intima-media thickness [IMT] by echo-color Doppler) in a large, inclusive survey (n = 172) in renal transplant patients at a single institution. Forty-two patients (24%) were classified as hypertensive by ABPM criteria and 29 (17%) by clinic blood pressure (BP) criteria. Average daytime and nighttime BP was 126 ± 12/78 ± 9 mm Hg and 123 ± 13/74 ± 10 mm Hg, respectively. Forty-five patients (26%) were classified as hypertensive by the daytime criterion (>135/85 mm Hg) and a much higher proportion (n = 119, 69%) by the nighttime criterion (>120/70 mm Hg). Sixty-two patients (36%) had a night-day ratio of 1 or greater, indicating clear-cut nondipping. The average nighttime systolic BP (r = 0.24, P = 0.001) and the night-day systolic BP ratio (r = 0.23, P = 0.002) were directly related to IMT, and these associations were much more robust than the 24-hour systolic BP-IMT relationship (r = 0.16, P = 0.04). Average daytime BP and clinic B were unrelated to IMT. In a multiple regression analysis adjusting for confounders, the night-day systolic BP ratio maintained an independent association with IMT (β = 0.14, P = 0.04). In renal transplant patients, the prevalence of nocturnal hypertension by far exceeds the prevalence of hypertension as assessed by clinic, daytime, and 24-hour ABPM. Nighttime systolic BP and the night-day ratio but no other BP metrics are independently associated with IMT. Blood pressure during nighttime may provide unique information for the assessment of cardiovascular risk attributable to BP burden in renal transplant patients.
Di Rita, Federico; Lirer, Fabrizio; Bonomo, Sergio; Cascella, Antonio; Ferraro, Luciana; Florindo, Fabio; Insinga, Donatella Domenica; Lurcock, Pontus Conrad; Margaritelli, Giulia; Petrosino, Paola; Rettori, Roberto; Vallefuoco, Mattia; Magri, Donatella
2018-01-01
A new high-resolution pollen record, spanning the last five millennia, is presented from the Gulf of Gaeta (Tyrrhenian Sea, central Italy), with the aim of verifying if any vegetation change occurred in the central Mediterranean region in relation to specific well-known global and/or regional climate events, including the 4.2 ka event, the Medieval Climate Anomaly (MCA) and the Little Ice Age (LIA), and to detect possible vegetation changes related to still under-investigated climate signals, for example the so-called "Bond 2" cold event around 2.8 ka BP. The vegetation dynamics of the Gaeta record shows a recurrent pattern of forest increase and decline punctuating the mid- and late Holocene. When the timing of these patterns is compared with the climate proxy data available from the same core (planktonic foraminifera assemblages and oxygen stable isotope record) and with the NAO (North Atlantic Oscillation) index, it clearly appears that the main driver for the forest fluctuations is climate, which may even overshadow the effects of human activity. We have found a clear correspondence between phases with negative NAO index and forest declines. In particular, around 4200 cal BP, a drop in AP (Arboreal Pollen) confirms the clearance recorded in many sites in Italy south of 43°N. Around 2800 cal BP, a vegetation change towards open conditions is found at a time when the NAO index clearly shows negative values. Between 800 and 1000 AD, a remarkable forest decline, coeval with a decrease in the frequencies of both Castanea and Olea, matches a shift in the oxygen isotope record towards positive values, indicating cooler temperatures, and a negative NAO. Between 1400-1850 AD, in the time period chronologically corresponding to the LIA (Little Ice Age), the Gaeta record shows a clear decline of the forest cover, particularly evident after 1550 AD, once again in correspondence with negative NAO index.
Climate in the Western Cordillera of the Central Andes over the last 4300 years
Engel, Zbyněk; Skrzypek, Grzegorz; Chuman, Tomáš; Šefrna, Luděk; Mihaljevič, Martin
2014-09-01
The Distichia peat core obtained in the Carhuasanta valley near Nevado Mismi, Cordillera Chila, provides information on climatic and environmental conditions over the last ˜4300 years. The relative changes in the stable carbon isotope composition of plant remains preserved in the core reflect major temperature fluctuations in the Western Cordillera of the southern Peruvian Andes. These temperature variations can be additionally linked with the changes in precipitation patterns by analysing C% and C/N ratio in the core. Relatively warm and moist conditions prevailed from 4280 to 3040 cal. yrs BP (BC 2330-1090) with a short colder dry episode around 3850 cal. yrs BP (BC 1900). The most prominent climate changes recorded in the peat occurred between 3040 and 2750 cal. yrs BP (BC 1090-800) when the initial warming turned to a rapid cooling to temperatures at least 2 °C lower than the mean for the Late Holocene. Initially drier conditions within this event turned to a short wet phase after 2780 cal. yrs BP (BC 830) when the temperature increased again. This event coincides with significant changes in peat and ice core records in the Central Andes matching the timing of the global climate event around 2.8 cal. ka BP. Climatic conditions in the study area became relatively dry and stable after the event for about 800 years. Highly variable temperatures and humidity prevailed during the last 2000 years when an extended warm and relatively humid period occurred between 640 and 155 cal. yrs BP (AD 1310-1795) followed by predominantly colder and drier conditions. The established δ13C peat record represents the first continuous proxy for the temperature in the southern Peruvian Andes dated by the AMS 14C. Distichia peat is wide spread in the Andes and the proposed approach can be applied elsewhere in high altitudes, where no other traditional climate proxies are available.
Directory of Open Access Journals (Sweden)
Chi-Ho Chan
Full Text Available Optimization of the surface charges is a promising strategy for increasing thermostability of proteins. Electrostatic contribution of ionizable groups to the protein stability can be estimated from the differences between the pKa values in the folded and unfolded states of a protein. Using this pKa-shift approach, we experimentally measured the electrostatic contribution of all aspartate and glutamate residues to the stability of a thermophilic ribosomal protein L30e from Thermococcus celer. The pKa values in the unfolded state were found to be similar to model compound pKas. The pKa values in both the folded and unfolded states obtained at 298 and 333 K were similar, suggesting that electrostatic contribution of ionizable groups to the protein stability were insensitive to temperature changes. The experimental pKa values for the L30e protein in the folded state were used as a benchmark to test the robustness of pKa prediction by various computational methods such as H++, MCCE, MEAD, pKD, PropKa, and UHBD. Although the predicted pKa values were affected by crystal contacts that may alter the side-chain conformation of surface charged residues, most computational methods performed well, with correlation coefficients between experimental and calculated pKa values ranging from 0.49 to 0.91 (p<0.01. The changes in protein stability derived from the experimental pKa-shift approach correlate well (r = 0.81 with those obtained from stability measurements of charge-to-alanine substituted variants of the L30e protein. Our results demonstrate that the knowledge of the pKa values in the folded state provides sufficient rationale for the redesign of protein surface charges leading to improved protein stability.
Lin, J.C.; Broecker, W.S.; Hemming, S.R.; Hajdas, I.; Anderson, Robert F.; Smith, G.I.; Kelley, M.; Bonani, G.
1998-01-01
U-Th isochron ages of tufas formed on shorelines suggest that the last pluvial event in Lake Lahontan and Searles Lake was synchronous at about 16,500 cal yr B.P. (equivalent to a radiocarbon age of between 14,000 and 13,500 yr B.P.), whereas the timing of this pluvial event determined by radiocarbon dating is on the order of 1000 yr younger. The timing of seven distinct periods of near desiccation in Searles Lake during late-glacial time has been reinvestigated for U-Th age determination by mass spectrometry. U-Th dating of evaporite layers in the interbedded mud and salt unit called the Lower Salt in Searles Lake was hampered by the uncertainty in assessing the initial 230Th/232Th of the samples. The resulting ages, corrected by a conservative range of initial 230Th/ 232Th ratios, suggest close correlation of the abrupt changes recorded in Greenland ice cores (Dansgaard-Oeschger events) and wet-dry conditions in Searles Lake between 35,000 and 24,000 Cal yr B.P. ?? 1998 University of Washington.
International Nuclear Information System (INIS)
Horrocks, M.; Deng, Y.; Nichol, S.L.; Shane, P.A.; Ogden, J.
2002-01-01
A multi-proxy analysis of a sediment core from Waiatarua, Auckland Isthmus, adds to an environmental history from the local wetland spanning the Late Glacial to modern times. Several distal tephra were recorded in the core: 8.5 ka Rotoma (reworked), 6.1 ka Tuhua (primary and reworked), most likely the 1.8 ka Taupo (the latter is previously unreported for the Auckland Isthmus), and one unidentified, possibly 665 yr BP Kaharoa. Pollen and diatom analyses of the core show that during the period c. 6000-c. 4800 yr BP, the site was a lake fringed with Cyperaceae/Leptospermum swamp. The lake became progressively shallower after c. 4800 yr BP, probably due to hydroseral infilling. Surrounding the lake was forest dominated by Dacrydium, Prumnopitys, Metrosideros, and Nestegis. Transition to the Polynesian era appears unclear because the site probably endured a hiatus due to destruction of peat by burning in European times. (author). 39 refs., 4 figs., 2 tabs
Directory of Open Access Journals (Sweden)
Larsen S
2014-11-01
Full Text Available Stig Larsen,1 Kritiya Butthongkomvong,2 Alexey Manikhas,3 Ekaterina Trishkina,4 Elena Poddubuskaya,5 Marina Matrosova,6 Vichien Srimuninnimit,7 Steen Lindkær-Jensen81Department of Controlled Clinical Trials and Biostatistics, Centre for Epidemiology and Biostatistics, University of Life Science, Oslo, Norway; 2Udonthani Cancer Hospital, Udonthani, Thailand; 3Department of Oncology, City Clinical Oncology, Dispensary, St Petersburg, Russia; 4Department of Oncology, Leningrad Regional Oncology Centre, St Petersburg, Russia; 5Department of Oncology, Unit of Russian Academy of Medical Science, Moscow, Russia; 6Department of Oncology, N Novgorod Regional Oncology Dispensary, Novgorod, Russia; 7Division of Medical Oncology, Faculty of Medicine, Siriraj Hospital, Mahidol University, Bangkok, Thailand; 8Department of Surgery and Cancer, Imperial College, Hammersmith Hospital, London, UKAbstract: The aims were to compare the efficacy and tolerability of a new benzene-poly-carboxylic acids complex with cis-diammineplatinum (II dichloride (BP-C1 versus placebo and to investigate the long-term tolerability of BP-C1 in the treatment of patients with metastatic breast cancer.Material and methods: A randomized, double-blind, placebo-controlled multicenter study was performed with a semi-crossover design. Patients allocated to placebo switched to BP-C1 after 32 days of treatment. Patients who completed 32 days of BP-C1 treatment were offered the opportunity to continue on BP-C1 for an additional 32 days in an open-label extension. Patients were then followed up for another 28 days. Thirty patients were given daily intramuscular injections of 0.035 mg/kg of body weight BP-C1 or placebo for 32 days. Biochemistry, hematology, National Cancer Institute Common Terminology Criteria for Adverse Events (CTC-NCI, European Organisation for Research and Treatment of Cancer quality of life questionnaire (QOL-C30 and the breast-cancer–specific BR23 data were recorded at
Aquatic ecosystem responses to Holocene climate change and biome development in boreal, central Asia
Mackay, Anson W.; Bezrukova, Elena V.; Leng, Melanie J.; Meaney, Miriam; Nunes, Ana; Piotrowska, Natalia; Self, Angela; Shchetnikov, Alexander; Shilland, Ewan; Tarasov, Pavel; Wang, Luo; White, Dustin
2012-05-01
Boreal ecosystems are highly vulnerable to climate change, and severe ecological impacts in the near future are virtually certain to occur. We undertook a multiproxy study on an alpine lake (ESM-1) at the modern tree-line in boreal, southern Siberia. Steppe and tundra biomes were extensive in eastern Sayan landscapes during the early Holocene. Boreal forest quickly expanded by 9.1 ka BP, and dominated the landscape until c 0.7 ka BP, when the greatest period of compositional turnover occurred. At this time, alpine meadow landscape expanded and Picea obovata colonised new habitats along river valleys and lake shorelines, because of prevailing cool, moist conditions. During the early Holocene, chironomid assemblages were dominated by cold stenotherms. Diatoms for much of the Holocene were dominated by alkaliphilous, fragilarioid taxa, up until 0.2 ka BP, when epiphytic species expanded, indicative of increased habitat availability. C/N mass ratios ranged between 9.5 and 13.5 (11.1-15.8 C/N atomic ratios), indicative of algal communities dominating organic matter contributions to bottom sediments with small, persistent contributions from vascular plants. However, δ13C values increased steadily from -34.9‰ during the early Holocene (9.3 ka BP) to -24.8‰ by 0.6 ka BP. This large shift in magnitude may be due to a number of factors, including increasing within-lake productivity, increasing disequilibrium between the isotopic balance of the lake with the atmosphere as the lake became isotopically ‘mature’, and declining soil respiration linked to small, but distinct retreat in forest biomes. The influence of climatic variables on landscape vegetation was assessed using redundancy analysis (RDA), a linear, direct ordination technique. Changes in July insolation at 60 °N significantly explained over one-fifth of the variation in species composition, while changes in estimates of northern hemisphere temperature and ice-rafted debris events in the North Atlantic
Directory of Open Access Journals (Sweden)
Katell Bidet
2014-07-01
Full Text Available Viral RNA-host protein interactions are critical for replication of flaviviruses, a genus of positive-strand RNA viruses comprising major vector-borne human pathogens including dengue viruses (DENV. We examined three conserved host RNA-binding proteins (RBPs G3BP1, G3BP2 and CAPRIN1 in dengue virus (DENV-2 infection and found them to be novel regulators of the interferon (IFN response against DENV-2. The three RBPs were required for the accumulation of the protein products of several interferon stimulated genes (ISGs, and for efficient translation of PKR and IFITM2 mRNAs. This identifies G3BP1, G3BP2 and CAPRIN1 as novel regulators of the antiviral state. Their antiviral activity was antagonized by the abundant DENV-2 non-coding subgenomic flaviviral RNA (sfRNA, which bound to G3BP1, G3BP2 and CAPRIN1, inhibited their activity and lead to profound inhibition of ISG mRNA translation. This work describes a new and unexpected level of regulation for interferon stimulated gene expression and presents the first mechanism of action for an sfRNA as a molecular sponge of anti-viral effectors in human cells.
Cukur, D.; Krastel, S.; Schmincke, H.; Sumita, M.; Tomonaga, Y.; Damci, E.
2013-12-01
Lake Van is the largest soda lake in the world with a present surface of 3,574 km2 and a maximum water depth of 450 m. Sedimentary deposits in the lake preserve one of the most complete record of continental climate in the Middle East since the Middle Pleistocene. We studied these deposits to characterize the evolution of the lake level and its possible relationships with changes in climate, volcanic, and regional tectonics since the formation of the lake ca. 600 ka ago. Changes in lake level were determined based on high-resolution seismic reflection profiles showing erosional surfaces, changes in stratal geometries such as downward shifts in coastal onlap, and recognition of distinctive stratigraphic features such as prograding delta clinoforms. Our results show that Lake Van has undergone drastic changes in surface elevation by as much as 600 meters over the past ca. 600 ka. Five major lowstands occurred at ca. ~600 ka, ca. 365-340 ka, ca 290-230 ka; ca. 150-130 ka; and ca. 30-14 ka. During a first period (A) (ca. 600-ca 230 ka) lake levels changed drastically by hundreds of m but at longer time intervals between low and high stands. Changes occurred more frequently but mostly by a few tens of m during the past ca. 230 ka years where we can distinguish a first period (B1) of stepwise transgressions between ca. 230 and 150 ka followed by a short regression between ca. 150 and 130 ka. Lake level rose stepwise again during period B2 lasting until ca 30 ka. During the past 30 ka a regression and a final transgression each lasted ca. 15 ka years. The major lowstand periods in Lake Van occurred during glacial periods, arguing for a climatic control of these lake-level fluctuations (i.e., significantly reduced precipitation leading to lake level low stands). Although climate forcing may have been the dominant cause for the drastic lake level changes of Lake Van, volcanic and tectonic forcing factors are also invoked. For example, the number of distinct tephra layers
Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP
Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and
PODJETNIŠKA AKTIVNOST NA KOROŠKEM
Marhl, Anja
2010-01-01
Da bi se posameznik podal na podjetniško pot mora zaznati poslovno priložnost, hkrati pa mora imeti tudi ustrezno znanje oziroma sposobnosti. Odločitev za podjetništvo je vedno osebna odločitev. Posameznik se mora sam odločiti ali bo deloval kot podjetnik, ali pa se bo ukvarjal s čim drugim. Koroška regija je ena izmed najstarejših slovenskih industrijskih regij. Prevladujejo predelovalne dejavnosti (proizvodnja kovin in kovinskih izdelkov, proizvodnja iz gume in plastike ter proizvodnja ...
NOAA Ship Ka'imimoana Underway Meteorological Data, Near Real Time
National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Ka'imimoana Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System (SAMOS)...
Determination of the pKa of Benzophenones in Ethanol-Water
Directory of Open Access Journals (Sweden)
G. T. Castro
2000-03-01
Full Text Available The pKa of monohydroxylated benzophenones was determined by UV spectroscopy. The values obtained are coherent with the resonant forms and hydrogen bond intramolecular of the analyzed compounds.
An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network
Directory of Open Access Journals (Sweden)
Wei He
2013-01-01
Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.
Thermal Runaway of the 13 kA Busbar Joints in the LHC
Verweij, A P
2010-01-01
Triggered by the incident in the LHC in September 2008, the thermo-electrical stability of the 10,000 soldered busbar joints in the 13 kA circuits of the LHC has been re-assessed. For this purpose the computer model QP3 has been developed. In this paper the results of some calculations are presented, and it is shown how the results have been used to improve the quench detection system and ensure safe future operation. First the layout of the 13 kA circuits, the geometry of the soldered joints...
The prenyl-binding protein PrBP/δ: a chaperone participating in intracellular trafficking.
Zhang, Houbin; Constantine, Ryan; Frederick, Jeanne M; Baehr, Wolfgang
2012-12-15
Expressed ubiquitously, PrBP/δ functions as chaperone/co-factor in the transport of a subset of prenylated proteins. PrBP/δ features an immunoglobulin-like β-sandwich fold for lipid binding, and interacts with diverse partners. PrBP/δ binds both C-terminal C15 and C20 prenyl side chains of phototransduction polypeptides and small GTP-binding (G) proteins of the Ras superfamily. PrBP/δ also interacts with the small GTPases, ARL2 and ARL3, which act as release factors (GDFs) for prenylated cargo. Targeted deletion of the mouse Pde6d gene encoding PrBP/δ resulted in impeded trafficking to the outer segments of GRK1 and cone PDE6 which are predicted to be farnesylated and geranylgeranylated, respectively. Rod and cone transducin trafficking was largely unaffected. These trafficking defects produce progressive cone-rod dystrophy in the Pde6d(-/-) mouse. Copyright © 2012 Elsevier Ltd. All rights reserved.
DARHT 2 kA Cathode Development
Energy Technology Data Exchange (ETDEWEB)
Henestroza, E.; Houck, T.; Kwan, J.W.; Leitner, M.; Miram, G.; Prichard, B.; Roy, P.K.; Waldron, W.; Westenskow, G.; Yu, S.; Bieniosek, F.M.
2009-03-09
In the campaign to achieve 2 kA of electron beam current, we have made several changes to the DARHT-II injector during 2006-2007. These changes resulted in a significant increase in the beam current, achieving the 2 kA milestone. Until recently (before 2007), the maximum beam current that was produced from the 6.5-inch diameter (612M) cathode was about 1300 A when the cathode was operating at a maximum temperature of 1140 C. At this temperature level, the heat loss was dominated by radiation which is proportional to temperature to the fourth power. The maximum operating temperature was limited by the damage threshold of the potted filament and the capacity of the filament heater power supply, as well as the shortening of the cathode life time. There were also signs of overheating at other components in the cathode assembly. Thus it was clear that our approach to increase beam current could not be simply trying to run at a higher temperature and the preferred way was to operate with a cathode that has a lower work function. The dispenser cathode initially used was the type 612M made by SpectraMat. According to the manufacturer's bulletin, this cathode should be able to produce more than 10 A/cm{sup 2} of current density (corresponding to 2 kA of total beam current) at our operating conditions. Instead the measured emission (space charge limited) was 6 A/cm{sup 2}. The result was similar even after we had revised the activation and handling procedures to adhere more closely to the recommend steps (taking longer time and nonstop to do the out-gassing). Vacuum was a major concern in considering the cathode's performance. Although the vacuum gauges at the injector vessel indicated 10{sup -8} Torr, the actual vacuum condition near the cathode in the central region of the vessel, where there might be significant out-gassing from the heater region, was never determined. Poor vacuum at the surface of the cathode degraded the emission (by raising the work function
DARHT 2 kA Cathode Development
International Nuclear Information System (INIS)
Henestroza, E.; Houck, T.; Kwan, J.W.; Leitner, M.; Miram, G.; Prichard, B.; Roy, P.K.; Waldron, W.; Westenskow, G.; Yu, S.; Bieniosek, F.M.
2009-01-01
In the campaign to achieve 2 kA of electron beam current, we have made several changes to the DARHT-II injector during 2006-2007. These changes resulted in a significant increase in the beam current, achieving the 2 kA milestone. Until recently (before 2007), the maximum beam current that was produced from the 6.5-inch diameter (612M) cathode was about 1300 A when the cathode was operating at a maximum temperature of 1140 C. At this temperature level, the heat loss was dominated by radiation which is proportional to temperature to the fourth power. The maximum operating temperature was limited by the damage threshold of the potted filament and the capacity of the filament heater power supply, as well as the shortening of the cathode life time. There were also signs of overheating at other components in the cathode assembly. Thus it was clear that our approach to increase beam current could not be simply trying to run at a higher temperature and the preferred way was to operate with a cathode that has a lower work function. The dispenser cathode initially used was the type 612M made by SpectraMat. According to the manufacturer's bulletin, this cathode should be able to produce more than 10 A/cm 2 of current density (corresponding to 2 kA of total beam current) at our operating conditions. Instead the measured emission (space charge limited) was 6 A/cm 2 . The result was similar even after we had revised the activation and handling procedures to adhere more closely to the recommend steps (taking longer time and nonstop to do the out-gassing). Vacuum was a major concern in considering the cathode's performance. Although the vacuum gauges at the injector vessel indicated 10 -8 Torr, the actual vacuum condition near the cathode in the central region of the vessel, where there might be significant out-gassing from the heater region, was never determined. Poor vacuum at the surface of the cathode degraded the emission (by raising the work function value). We reexamined
[Segmentation of whole body bone SPECT image based on BP neural network].
Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan
2007-10-01
In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.
Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W
1997-12-05
The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.
Ka-band SAR interferometry studies for the SWOT mission
Fernandez, D. E.; Fu, L.; Rodriguez, E.; Hodges, R.; Brown, S.
2008-12-01
The primary objective of the NRC Decadal Survey recommended SWOT (Surface Water and Ocean Topography) Mission is to measure the water elevation of the global oceans, as well as terrestrial water bodies (such as rivers, lakes, reservoirs, and wetlands), to answer key scientific questions on the kinetic energy of ocean circulation, the spatial and temporal variability of the world's surface freshwater storage and discharge, and to provide societal benefits on predicting climate change, coastal zone management, flood prediction, and water resources management. The SWOT mission plans to carry the following suite of microwave instruments: a Ka-band interferometer, a dual-frequency nadir altimeter, and a multi-frequency water-vapor radiometer dedicated to measuring wet tropospheric path delay to correct the radar measurements. We are currently funded by the NASA Earth Science Technology Office (ESTO) Instrument Incubator Program (IIP) to reduce the risk of the main technological drivers of SWOT, by addressing the following technologies: the Ka-band radar interferometric antenna design, the on-board interferometric SAR processor, and the internally calibrated high-frequency radiometer. The goal is to significantly enhance the readiness level of the new technologies required for SWOT, while laying the foundations for the next-generation missions to map water elevation for studying Earth. The first two technologies address the challenges of the Ka-band SAR interferometry, while the high- frequency radiometer addresses the requirement for small-scale wet tropospheric corrections for coastal zone applications. In this paper, we present the scientific rational, need and objectives behind these technology items currently under development.
Batistela, Vagner Roberto; Pellosi, Diogo Silva; de Souza, Franciane Dutra; da Costa, Willian Ferreira; de Oliveira Santin, Silvana Maria; de Souza, Vagner Roberto; Caetano, Wilker; de Oliveira, Hueder Paulo Moisés; Scarminio, Ieda Spacino; Hioka, Noboru
2011-09-01
Xanthenes form to an important class of dyes which are widely used. Most of them present three acid-base groups: two phenolic sites and one carboxylic site. Therefore, the p Ka determination and the attribution of each group to the corresponding p Ka value is a very important feature. Attempts to obtain reliable p Ka through the potentiometry titration and the electronic absorption spectrophotometry using the first and second orders derivative failed. Due to the close p Ka values allied to strong UV-Vis spectral overlap, multivariate analysis, a powerful chemometric method, is applied in this work. The determination was performed for eosin Y, erythrosin B, and bengal rose B, and also for other synthesized derivatives such as 2-(3,6-dihydroxy-9-acridinyl) benzoic acid, 2,4,5,7-tetranitrofluorescein, eosin methyl ester, and erythrosin methyl ester in water. These last two compounds (esters) permitted to attribute the p Ka of the phenolic group, which is not easily recognizable for some investigated dyes. Besides the p Ka determination, the chemometry allowed for estimating the electronic spectrum of some prevalent protolytic species and the substituents effects evaluation.
Directory of Open Access Journals (Sweden)
Tao Qin
Full Text Available Dendritic cells (DCs play a vital role in the regulation of immune-mediated inflammatory diseases. Thus, DCs have been regarded as a major target for the development of immunomodulators. However, oxidative stress could disturb inflammatory regulation in DCs. Here, we examined the effect of bursopentine (BP5, a novel pentapeptide isolated from chicken bursa of fabricius, on the protection of DCs against oxidative stress for immunosuppression. BP5 showed potent protective effects against the lipopolysaccharide (LPS-induced oxidative stress in DCs, including nitric oxide, reactive oxygen species and lipid peroxidation. Furthermore, BP5 elevated the level of cellular reductive status through increasing the reduced glutathione (GSH and the GSH/GSSG ratio. Concomitant with these, the activities of several antioxidative redox enzymes, including glutathione peroxidase (GPx, catalase (CAT and superoxide dismutase (SOD, were obviously enhanced. BP5 also suppressed submucosal DC maturation in the LPS-stimulated intestinal epithelial cells (ECs/DCs coculture system. Finally, we found that heme oxygenase 1 (HO-1 was remarkably upregulated by BP5 in the LPS-induced DCs, and played an important role in the suppression of oxidative stress and DC maturation. These results suggested that BP5 could protect the LPS-activated DCs against oxidative stress and have potential applications in DC-related inflammatory responses.
Kui suudab Steve, suudab ka Apple / Tarvo Vaarmets
Vaarmets, Tarvo
2008-01-01
Ehkki Apple'i kolmanda kvartali kasum kasvas kolmandiku võrra ja oli oodatust kümnendiku jagu suurem, langes ettevõtte aktsia hind börsil. Investoreid teeb rahutuks nii ettevõtte juhi Steve Jobsi tervis kui ka Apple'i majandusprognoos neljandaks kvartaliks. Lisa: Analüütikud on aktsia suhtes üksmeelel. Diagramm: Aktsia hinnal taas suund alla
Ka-Band, Multi-Gigabit-Per-Second Transceiver
Simons, Rainee N.; Wintucky, Edwin G.; Smith, Francis J.; Harris, Johnny M.; Landon, David G.; Haddadin, Osama S.; McIntire, William K.; Sun, June Y.
2011-01-01
A document discusses a multi-Gigabit-per-second, Ka-band transceiver with a software-defined modem (SDM) capable of digitally encoding/decoding data and compensating for linear and nonlinear distortions in the end-to-end system, including the traveling-wave tube amplifier (TWTA). This innovation can increase data rates of space-to-ground communication links, and has potential application to NASA s future spacebased Earth observation system. The SDM incorporates an extended version of the industry-standard DVB-S2, and LDPC rate 9/10 FEC codec. The SDM supports a suite of waveforms, including QPSK, 8-PSK, 16-APSK, 32- APSK, 64-APSK, and 128-QAM. The Ka-band and TWTA deliver an output power on the order of 200 W with efficiency greater than 60%, and a passband of at least 3 GHz. The modem and the TWTA together enable a data rate of 20 Gbps with a low bit error rate (BER). The payload data rates for spacecraft in NASA s integrated space communications network can be increased by an order of magnitude (>10 ) over current state-of-practice. This innovation enhances the data rate by using bandwidth-efficient modulation techniques, which transmit a higher number of bits per Hertz of bandwidth than the currently used quadrature phase shift keying (QPSK) waveforms.
Moskva ründab britte viisarelvaga / Sirje Rank
Rank, Sirje, 1966-
2008-01-01
Ilmunud ka: Delovõje Vedomosti 9. juuli lk. 9. Briti kütusekontserni BP tütarfirma TNK-BP mitu võtmeisikut on sunnitud Venemaalt lahkuma, sest nende viisat ja elamisluba pole pikendatud. Vt. samas: Taust; Võrdlus Jukosega
"7 vaprat" ei lõpeta ka suvel / H. S.
H. S.
2002-01-01
Populaarne muusikaedetabelisaade "7 vaprat" läheb juunis ansamblitega Terminaator, Tuberkuloited, No Big Silence, Blacky, Speed Free ja Hell Can Wait suvetuurile. 11. juunil antakse kontsert Tartus, 12. juunil Rakveres, 13. juunil Pärnus ja 15. juunil Tallinnas. Kontsertidest valmivad ka telesaated, saatejuht Villu Tamme
Long-term monitoring of Sgr A* at 7 mm with VERA and KaVA
Akiyama, K.; Kino, M.; Sohn, B.; Lee, S.; Trippe, S.; Honma, M.
2014-05-01
We present the results of radio monitoring observations of Sgr A* at 7 mm (i.e. 43 GHz) with the VLBI Exploration of Radio Astrometry (VERA), which is a VLBI array in Japan. VERA provides angular resolution on millisecond scales, resolving structures within 100 Schwarzschild radii of Sgr A* , similar to the Very Large Baseline Array (VLBA). We performed multi-epoch observations of Sgr A* in 2005 - 2008, and started monitoring it again with VERA from 2013 January to trace the current G2 encounter event. Our preliminary results in 2013 show that Sgr A* on mas scales has been in an ordinary state as of August 2013, although some fraction of the G2 cloud already passed the pericenter of Sgr A* in April 2013. We will continue monitoring Sgr A* with VERA and the newly developed KaVA (KVN and VERA Array).
Ahn, Hyeon-Seon; Sohn, Young Kwan; Lee, Jin-Young; Kim, Jin Cheul
2018-05-01
Paleomagnetic and rock magnetic investigations were performed on a 64-cm-thick section of nonmarine unconsolidated muddy sediment from the Gosan Formation on Jeju Island, Korea. This sediment was recently dated to have been deposited between 22 and 17 kyr BP calibrated, with a sedimentation rate of 13-25 cm/kyr, based on many radiocarbon ages. Interestingly, stepwise alternating field (AF) demagnetization revealed characteristic natural remanent magnetizations with anomalous directions, manifested by marked deviations from the direction of today's axial dipole field, for some separate depth levels. On the other hand, stepwise thermal (TH) demagnetization showed more complex behavior, resulting in the identification of multiple remanence components. For all TH-treated specimens, consistently two different components are predominant: a low-temperature component unblocked below 240-320 °C entirely having normal-polarity apparently within the secular variation range of the Brunhes Chron, and a high-temperature component with unblocking temperatures (Tubs) between 240-320 and 520-580 °C that have anomalous directions, concentrated in the 13-34-cm-depth interval ( 17-19 ka in inferred age) and possibly below 53 cm depth (before 20 ka). Rock magnetic results also infer the dominance of low-coercivity magnetic particles having 300 and 580 °C Curie temperature as remanence carriers, suggestive of (titano)maghemite and/or Ti-rich titanomagnetite and magnetite (or Ti-poor titanomagnetite), respectively. A noteworthy finding is that AF demagnetizations in this study often lead to incomplete separation of the two remanence components possibly due to their strongly overlapping AF spectra. The unusual directions do not appear to result from self-reversal remanences. Then, one interpretation is that the low-temperature components are attributable to post-depositional chemical remanences, associated possibly with the later formation of the mineral phase having Tub 300
An integrated Ka/Ku-band payload for personal, mobile and private business communications
Hayes, Edward J.; Keelty, J. Malcolm
1991-01-01
The Canadian Department of Communications has been studying options for a government-sponsored demonstration payload to be launched before the end of the century. A summary of the proposed system concepts and network architectures for providing an advanced private business network service at Ku-band and personal and mobile communications at Ka-band is presented. The system aspects addressed include coverage patterns, traffic capacity, and grade of service, multiple access options as well as special problems, such as Doppler in mobile applications. Earth terminal types and the advanced payload concept proposed in a feasibility study for the demonstration mission are described. This concept is a combined Ka-band/Ku-band payload which incorporates a number of advanced satellite technologies including a group demodulator to convert single-channel-per-carrier frequency division multiple access uplink signals to a time division multiplex downlink, on-board signal regeneration, and baseband switching to support packet switched data operation. The on-board processing capability of the payload provides a hubless VSAT architecture which permits single-hop full mesh interconnectivity. The Ka-band and Ku-band portions of the payload are fully integrated through an on-board switch, thereby providing the capability for fully integrated services, such as using the Ku-band VSAT terminals as gateway stations for the Ka-band personal and mobile communications services.
Cijepani litički materijal s prapovijesnog nalazišta Slavča, Nova Gradiška
Šošić, Rajna; Karavanić, Ivor
2005-01-01
SUMMARY TECHNOLOGICAL AND TYPOLOGICAL ANALYSIS OF THE CHIPPED STONE ARTIFACTS FROM THE PREHISTORIC SITE OF SLAV^A, NOVA GRADI[KA The site of Slav~a is situated on the south flanks of Psunj Mountain, in the town of Nova Gradi{ ka, Western Slavonia. The site has been continuosly excavated since 1997 by the City Museum of Nova Gradi{ka. A total number of 1655 chipped stone artifacts have been analyised, classified to the Sopot, Kostolac and Lasinja cultures, in effect a peri...
Prediction of pKa values using the PM6 semiempirical method
Directory of Open Access Journals (Sweden)
Jimmy C. Kromann
2016-08-01
Full Text Available The PM6 semiempirical method and the dispersion and hydrogen bond-corrected PM6-D3H+ method are used together with the SMD and COSMO continuum solvation models to predict pKa values of pyridines, alcohols, phenols, benzoic acids, carboxylic acids, and phenols using isodesmic reactions and compared to published ab initio results. The pKa values of pyridines, alcohols, phenols, and benzoic acids considered in this study can generally be predicted with PM6 and ab initio methods to within the same overall accuracy, with average mean absolute differences (MADs of 0.6–0.7 pH units. For carboxylic acids, the accuracy (0.7–1.0 pH units is also comparable to ab initio results if a single outlier is removed. For primary, secondary, and tertiary amines the accuracy is, respectively, similar (0.5–0.6, slightly worse (0.5–1.0, and worse (1.0–2.5, provided that di- and tri-ethylamine are used as reference molecules for secondary and tertiary amines. When applied to a drug-like molecule where an empirical pKa predictor exhibits a large (4.9 pH unit error, we find that the errors for PM6-based predictions are roughly the same in magnitude but opposite in sign. As a result, most of the PM6-based methods predict the correct protonation state at physiological pH, while the empirical predictor does not. The computational cost is around 2–5 min per conformer per core processor, making PM6-based pKa prediction computationally efficient enough to be used for high-throughput screening using on the order of 100 core processors.
Gangarapu, Satesh; Marcelis, Antonius T M; Zuilhof, Han
2013-04-02
The pKa of the conjugate acids of alkanolamines, neurotransmitters, alkaloid drugs and nucleotide bases are calculated with density functional methods (B3LYP, M08-HX and M11-L) and ab initio methods (SCS-MP2, G3). Implicit solvent effects are included with a conductor-like polarizable continuum model (CPCM) and universal solvation models (SMD, SM8). G3, SCS-MP2 and M11-L methods coupled with SMD and SM8 solvation models perform well for alkanolamines with mean unsigned errors below 0.20 pKa units, in all cases. Extending this method to the pKa calculation of 35 nitrogen-containing compounds spanning 12 pKa units showed an excellent correlation between experimental and computational pKa values of these 35 amines with the computationally low-cost SM8/M11-L density functional approach. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Maksude tõstmine lööb nii ettevõtlust kui ka tavalist inimest / Mirko Ojakivi
Ojakivi, Mirko
2008-01-01
Konjunktuuriinstituudi direktori Marje Josingu sõnul halvendaks maksutõus nii ettevõtluse konkurentsivõimet kui ka inimeste võimet eluga toime tulla, ka maksumaksjate liidu esimees Lasse Lehis peab maksude tõstmist valeks, eriti vale oleks tema väitel tõsta käibemaksu
Full Ka Band Waveguide-to-Microstrip Inline Transition Design
Li, Jianxing; Li, Lei; Qiao, Yu; Chen, Juan; Chen, Jianzhong; Zhang, Anxue
2018-05-01
In this paper, a compact and broadband inline waveguide-to-microstrip transition is proposed to cover the full Ka band. The transition can be segmented from the electric point of view into three building blocks, comprising a microstrip line to rectangular coaxial line, a wedged rectangular coaxial line to ridged waveguide, and a final tapered ridged waveguide impedance transformer to standard waveguide. Both good electrical performance and simple modular assembly without any soldering have been simultaneously obtained. The validation of the design concept has been conducted by numerical simulations and experimental measurements. The experimental results of a fabricated back-to-back transition prototype coincide with the simulated results. It shows that the proposed transition achieves good return loss of lower than 15.5 dB and low insertion loss with a fluctuation between 0.23 to 0.60 dB across the entire Ka band. Details of design considerations and operation mechanism as well as simulation and measurement results are presented.
BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme
Tamme, Jürgen
2010-01-01
Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart
Budsky, Alexander; Scholz, Denis; Mertz-Kraus, Regina; Spötl, Christoph; Gibert, Luis; Jochum, Klaus Peter
2017-04-01
Here we present three flowstone records from Cueva Victoria, SE Spain, covering the period between Marine Isotope Stage (MIS) 5 and MIS 3, the Late Glacial and the Holocene. The flowstones were precisely dated by the MC-ICPMS 230Th/U-method. In addition, stable oxygen and carbon isotope ratios as well as trace element concentrations were determined at high resolution (centennial to decadal scale). Present-day climate of SE Spain is classified as semi-arid with dry summer months (Iberian margin. δ18O values are around -3.5 ‰ and decrease to -5 to -6 ‰ during D/O events, while δ13C values are around -9 ‰ and decrease to -10 to -11 ‰ ) during D/O events. We interpret these changes as more humid conditions during D/O events, with elevated sea-surface temperatures in the North Atlantic and the Mediterranean Sea leading to increased moisture transport and precipitation on the SE Iberian Peninsula. As a consequence, vegetation density increased, which is reflected by the decrease in δ13C values and Mg and Sr concentrations and an increase in P content. In the Holocene, the flowstone grew continuously from the Bølling/Allerød to the mid-Holocene (7 ka). Stable isotopes record a trend of increasing temperatures with decreasing values towards the mid-Holocene (δ18O ≈ - 6.4 ‰ , δ13C ≈ -11 ‰ ). However, δ13C values record a significant excursion with elevated values (up to -3.8 ‰ ) during a period from 9.5 to 7.7 ka related to cold Bond-events in the North Atlantic, which is interpreted as a dry period in SE Spain. Budsky, A., Scholz, D., Gibert, L., Mertz-Kraus, R., 2015. 230Th/U-dating of the Cueva Victoria flowstone sequence: Preliminary results and paleoclimate implications, in: Gibert, L., Ferràndez-Canadell, C. (Eds.), Geology and Paleontology of Cueva Victoria. Mastia 11-13, Cartagena, pp. 101-109.
Developing hybrid approaches to predict pKa values of ionizable groups
Witham, Shawn; Talley, Kemper; Wang, Lin; Zhang, Zhe; Sarkar, Subhra; Gao, Daquan; Yang, Wei
2011-01-01
Accurate predictions of pKa values of titratable groups require taking into account all relevant processes associated with the ionization/deionization. Frequently, however, the ionization does not involve significant structural changes and the dominating effects are purely electrostatic in origin allowing accurate predictions to be made based on the electrostatic energy difference between ionized and neutral forms alone using a static structure. On another hand, if the change of the charge state is accompanied by a structural reorganization of the target protein, then the relevant conformational changes have to be taken into account in the pKa calculations. Here we report a hybrid approach that first predicts the titratable groups, which ionization is expected to cause conformational changes, termed “problematic” residues, then applies a special protocol on them, while the rest of the pKa’s are predicted with rigid backbone approach as implemented in multi-conformation continuum electrostatics (MCCE) method. The backbone representative conformations for “problematic” groups are generated with either molecular dynamics simulations with charged and uncharged amino acid or with ab-initio local segment modeling. The corresponding ensembles are then used to calculate the pKa of the “problematic” residues and then the results are averaged. PMID:21744395
EST Table: BP117517 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %
Directory of Open Access Journals (Sweden)
Hua Bai
Full Text Available Mutations of the insulin/IGF signaling (IIS pathway extend Drosophila lifespan. Based on genetic epistasis analyses, this longevity assurance is attributed to downstream effects of the FOXO transcription factor. However, as reported FOXO accounts for only a portion of the observed longevity benefit, suggesting there are additional outputs of IIS to mediate aging. One candidate is target of rapamycin complex 1 (TORC1. Reduced TORC1 activity is reported to slow aging, whereas reduced IIS is reported to repress TORC1 activity. The eukaryotic translation initiation factor 4E binding protein (4E-BP is repressed by TORC1, and activated 4E-BP is reported to increase Drosophila lifespan. Here we use genetic epistasis analyses to test whether longevity assurance mutants of chico, the Drosophila insulin receptor substrate homolog, require Drosophila d4eBP to slow aging. In chico heterozygotes, which are robustly long-lived, d4eBP is required but not sufficient to slow aging. Remarkably, d4eBP is not required or sufficient for chico homozygotes to extend longevity. Likewise, chico heterozygote females partially require d4eBP to preserve age-dependent locomotion, and both chico genotypes require d4eBP to improve stress-resistance. Reproduction and most measures of growth affected by either chico genotype are always independent of d4eBP. In females, chico heterozygotes paradoxically produce more rather than less phosphorylated 4E-BP (p4E-BP. Altered IRS function within the IIS pathway of Drosophila appears to have partial, conditional capacity to regulate aging through an unconventional interaction with 4E-BP.
MCM-BP regulates unloading of the MCM2–7 helicase in late S phase
Nishiyama, Atsuya; Frappier, Lori; Méchali, Marcel
2011-01-01
Origins of DNA replication are licensed by recruiting MCM2–7 to assemble the prereplicative complex (pre-RC). How MCM2–7 is inactivated or removed from chromatin at the end of S phase is still unclear. Here, we show that MCM-BP can disassemble the MCM2–7 complex and might function as an unloader of MCM2–7 from chromatin. In Xenopus egg extracts, MCM-BP exists in a stable complex with MCM7, but is not associated with the MCM2–7 hexameric complex. MCM-BP accumulates in nuclei in late S phase, well after the loading of MCM2–7 onto chromatin. MCM-BP immunodepletion in Xenopus egg extracts inhibits replication-dependent MCM dissociation without affecting pre-RC formation and DNA replication. When excess MCM-BP is incubated with Xenopus egg extracts or immunopurified MCM2–7, it binds to MCM proteins and promotes disassembly of the MCM2–7 complex. Recombinant MCM-BP also releases MCM2–7 from isolated late-S-phase chromatin, but this activity is abolished when DNA replication is blocked. MCM-BP silencing in human cells also delays MCM dissociation in late S phase. We propose that MCM-BP plays a key role in the mechanism by which pre-RC is cleared from replicated DNA in vertebrate cells. PMID:21196493
A central role for R7bp in the regulation of itch sensation.
Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F
2017-05-01
Itch is a protective sensation producing a desire to scratch. Pathologic itch can be a chronic symptom of illnesses such as uremia, cholestatic liver disease, neuropathies and dermatitis, however current therapeutic options are limited. Many types of cell surface receptors, including those present on cells in the skin, on sensory neurons and on neurons in the spinal cord, have been implicated in itch signaling. The role of G protein signaling in the regulation of pruriception is poorly understood. We identify here 2 G protein signaling components whose mutation impairs itch sensation. R7bp (a.k.a. Rgs7bp) is a palmitoylated membrane anchoring protein expressed in neurons that facilitates Gαi/o -directed GTPase activating protein activity mediated by the Gβ5/R7-RGS complex. Knockout of R7bp diminishes scratching responses to multiple cutaneously applied and intrathecally-administered pruritogens in mice. Knock-in to mice of a GTPase activating protein-insensitive mutant of Gαo (Gnao1 G184S/+) produces a similar pruriceptive phenotype. The pruriceptive defect in R7bp knockout mice was rescued in double knockout mice also lacking Oprk1, encoding the G protein-coupled kappa-opioid receptor whose activation is known to inhibit itch sensation. In a model of atopic dermatitis (eczema), R7bp knockout mice showed diminished scratching behavior and enhanced sensitivity to kappa opioid agonists. Taken together, our results indicate that R7bp is a key regulator of itch sensation and suggest the potential targeting of R7bp-dependent GTPase activating protein activity as a novel therapeutic strategy for pathological itch.
Directory of Open Access Journals (Sweden)
O'Brien Karel
2012-04-01
Full Text Available Abstract Background The use of mechanical ventilation is associated with lung injury in preterm infants and therefore the goal is to avoid or minimize its use. To date there is very little consensus on what is considered the "best non-invasive ventilation mode" to be used post-extubation. The objective of this study was to compare the effectiveness of biphasic nasal continuous positive airway pressure (BP-NCPAP vs. NCPAP in facilitating sustained extubation in infants ≤ 1,250 grams. Methods We performed a randomized controlled trial of BP-NCPAP vs. NCPAP in infants ≤ 1,250 grams extubated for the first time following mechanical ventilation since birth. Infants were extubated using preset criteria or at the discretion of the attending neonatologist. The primary outcome was the incidence of sustained extubation for 7 days. Secondary outcomes included incidence of adverse events and short-term neonatal outcomes. Results Sixty-seven infants received BP-NCPAP and 69 NCPAP. Baseline characteristics were similar between groups. The trial was stopped early due to increased use of non-invasive ventilation from birth, falling short of our calculated sample size of 141 infants per group. The incidence of sustained extubation was not statistically different between the BP-NCPAP vs. NCPAP group (67% vs. 58%, P = 0.27. The incidence of adverse events and short-term neonatal outcomes were similar between the two groups (P > 0.05 except for retinopathy of prematurity which was noted to be higher (P = 0.02 in the BP-NCPAP group. Conclusions Biphasic NCPAP may be used to assist in weaning from mechanical ventilation. The effectiveness and safety of BP-NCPAP compared to NCPAP needs to be confirmed in a large multi-center trial as our study conclusions are limited by inadequate sample size. Clinical Trials Registration # NCT00308789 Source of support Grant # 06-06, Physicians Services Incorporated Foundation, Toronto, Canada. Summit technologies Inc. provided
Additive manufacturing of Ka-band antennas for wireless communications
DEFF Research Database (Denmark)
Armendariz, Unai; Rommel, Simon; Rodríguez Páez, Juan Sebastián
2016-01-01
This paper presents the design and fabrication of WR-28 waveguide horn antennas operating in the Ka-band frequency range between 26.5 GHz and 40 GHz through 3D printing. Three different antennas are fabricated from polylactide acid filaments in conductive and non-conductive variants; the latter i...
A thermally switched 9 kA superconducting rectifier fluxpump
ten Kate, Herman H.J.; Bunk, Paul B.; Steffens, Harry A.; van de Klundert, Louis J.M.
1981-01-01
The feasibility of superconducting rectifier-fluxpumps has to be demonstrated at current levels of 10 - 100 kA, where is asked for in the superconducting devices now being planned. An intensive program has been started at the low temperature division of the University of Twente to construct such
Tõnu Talve "Ka" tuuritab Kadrinas ja Rakveres / Ants Juske
Juske, Ants, 1956-2016
2005-01-01
Tõnu Talve maalidest. Kadrinas esitatud trio Fragile performance'st ja näitusest tsüklist "Ka" Rakveres. Rakvere näitusel Teele Tuuna ja kolmeaastase tütre Anneliise tööd. Trio Fragile koosseisus on kitarrist Robert Jürjendal, trummar Arvo Urb ja maalija Tõnu Talve
Giguet-Covex, Charline; Arnaud, Fabien; Enters, Dirk; Poulenard, Jérôme; Millet, Laurent; Francus, Pierre; David, Fernand; Rey, Pierre-Jérôme; Wilhelm, Bruno; Delannoy, Jean-Jacques
2012-01-01
In central Western Europe, several studies have shown that colder Holocene periods, such as the Little Ice Age, also correspond to wet periods. However, in mountain areas which are highly sensitive to erosion processes and where precipitation events can be localized, past evolution of hydrological activity might be more complicated. To assess these past hydrological changes, a paleolimnological approach was applied on a 13.4-m-long sediment core taken in alpine Lake Anterne (2063 m asl) and representing the last 3.5 ka. Lake sedimentation is mainly composed of flood deposits triggered by precipitation events. Sedimentological and geochemical analyses show that floods were more frequent during cold periods while high-intensity flood events occurred preferentially during warmer periods. In mild temperature conditions, both flood patterns are present. This underlines the complex relationship between flood hazards and climatic change in mountain areas. During the warmer and/or dryer times of the end of Iron Age and the Roman Period, both the frequency and intensity of floods increased. This is interpreted as an effect of human-induced clearing for grazing activities and reveals that anthropogenic interferences must be taken into account when reconstructing climatic signals from natural archives.
Sparice, Domenico; Scarpati, Claudio; Perrotta, Annamaria; Mazzeo, Fabio Carmine; Calvert, Andrew T.; Lanphere, Marvin A.
2017-11-01
Pre-caldera (> 22 ka) lateral activity at Somma-Vesuvius is related to scoria- and spatter-cone forming events of monogenetic or polygenetic nature. A new stratigraphic, sedimentological, textural and lithofacies investigation was performed on five parasitic cones (Pollena cones, Traianello cone, S. Maria a Castello cone and the recently found Terzigno cone) occurring below the Pomici di Base (22 ka) Plinian products emplaced during the first caldera collapse at Somma-Vesuvius. A new Ar/Ar age of 23.6 ± 0.3 ka obtained for the Traianello cone as well as the absence of a paleosol or reworked material between the S. Maria a Castello cone and the Pomici di Base deposits suggest that such cone-forming eruptions occurred near the upper limit of the pre-caldera period (22-39 ky). The stratigraphy of three of these eccentric cones (Pollena cones and Traianello cone) exhibits erosion surfaces, exotic tephras, volcaniclastic layers, paleosols, unconformity and paraconformity between superimposed eruptive units revealing their multi-phase, polygenetic evolution related to activation of separate vents and periods of quiescence. Such eccentric cones have been described as composed of scoria deposits and pure effusive lavas by previous authors. Lavas are here re-interpreted as welded horizons (lava-like) composed of coalesced spatter fragments whose pyroclastic nature is locally revealed by relicts of original fragments and remnants of clast outlines. These welded horizons show, locally, rheomorphic structures allowing to define them as emplaced as clastogenic lava flows. The lava-like facies is transitional, upward and downward, to less welded facies composed of agglutinated to unwelded spatter horizons in which clasts outlines are increasingly discernible. Such textural characteristics and facies variation are consistent with a continuous fall deposition of Hawaiian fire-fountains episodes alternated with Strombolian phases emplacing loose scoria deposits. High enrichment
Uusim tehnika annab säästu ka maasoojuspumpades / Lauri Lehtinen
Lehtinen, Lauri
2009-01-01
Õhksoojuspumpadega tuntust kogunud inverter- ehk sagedusmuunduriga kompressortehnikat kasutatakse ka uue põlvkonna maasoojuspumpades. Tootjate sõnul annab invertertehnika varasemate seadmetega võrreldes umbes 10–15% kokkuhoidu
CacyBP/SIP binds ERK1/2 and affects transcriptional activity of Elk-1
International Nuclear Information System (INIS)
Kilanczyk, Ewa; Filipek, Slawomir; Jastrzebska, Beata; Filipek, Anna
2009-01-01
In this work we showed for the first time that mouse CacyBP/SIP interacts with extracellular signal regulated kinases 1 and 2 (ERK1/2). We also established that a calcium binding protein, S100A6, competes for this interaction. Moreover, the E217K mutant of CacyBP/SIP does not bind significantly to ERK1/2 although it retains the ability to interact with S100A6. Molecular modeling shows that the E217K mutation in the 189-219 CacyBP/SIP fragment markedly changes its electrostatic potential, suggesting that the binding with ERK1/2 might have an electrostatic character. We also demonstrate that CacyBP/SIP-ERK1/2 interaction inhibits phosphorylation of the Elk-1 transcription factor in vitro and in the nuclear fraction of NB2a cells. Altogether, our data suggest that the binding of CacyBP/SIP with ERK1/2 might regulate Elk-1 phosphorylation/transcriptional activity and that S100A6 might further modulate this effect via Ca 2+ -dependent interaction with CacyBP/SIP and competition with ERK1/2.
BP and sustainable development and biodiversity in Azerbaijan
International Nuclear Information System (INIS)
Grant, Vidrine; Askerov, Faig
2002-01-01
Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in
Maailma esimene online-maakler teenindab ka eesti keeles / Romet Kreek
Kreek, Romet, 1972-
2005-01-01
Maailma esimene online-maaklerfirma E*Trade avas eestikeelse kauplemiskeskkonna, kuhu lähikuudel lisandub võimalus kaubelda ka Eesti aktsiatega. Tabel: E*Trade pakub konkurentsi kohalikele maakleritele. Kommenteerib Peeter Koppel. Vt. samas: Lauri Matsulevitsh. LHV konkurenti ei karda
Tänane heategevuskontsert toetab ka Kiigemetsa kooli / Vaike Käosaar
Käosaar, Vaike
2007-01-01
Heategevuskontserdist "Ma olen eriline" Põltsamaa lossihoovis, kus esinevad mitmed Eestimaa tuntud muusikud ja mille tulusid kasutatakse samasuguse pealkirjaga raamatu kirjastamise toetuseks, et aidata peresid, kus kasvab autistlikke lapsi ning Kiigemetsa Kooli, kus õpetatakse teiste seas ka autismipuudega lapsi
TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells
DEFF Research Database (Denmark)
Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob
2015-01-01
mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...
BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.
Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo
2011-10-01
To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.