WorldWideScience

Sample records for k01

  1. Cardiothoracic and Vascular Surgeons Achieve High Rates of K-Award Conversion Into R01 Funding.

    Science.gov (United States)

    Narahari, Adishesh K; Mehaffey, J Hunter; Hawkins, Robert B; Baderdinni, Pranav K; Chandrabhatla, Anirudha S; Tribble, Curtis G; Kron, Irving L; Roeser, Mark E; Walters, Dustin M; Ailawadi, Gorav

    2018-03-14

    Obtaining National Institutes of Health (NIH) R01 funding remains extremely difficult. The utility of career development grants (K awards) for achieving the goal of R01 funding remains debated, particularly for surgeon-scientists. We examined the success rate for cardiothoracic and vascular (CTV) surgeons compared to other specialties in converting K-level grants into R01 equivalents. All K (K08 and K23) grants awarded to surgeons by the NIH between 1992-2017 were identified through NIH RePORTER, an online database combining funding, publications, and patents. Only grants awarded to CTV surgeons were included. Grants active within the past year were excluded. Mann-Whitney U-tests and Chi-squared tests were used to compare groups. A total of 62 K grants awarded to CTV surgeons were identified during this period. Sixteen grants were still active within the last year and excluded from analysis. Twenty-two (48%) of the remaining K awardees successfully transitioned to an R01 or equivalent grant. Awardees with successful conversion published 9 publications per K grant compared to 4 publications for those who did not convert successfully (p=0.01). The median time for successful conversion to an R grant was 5.0 years after the K award start date. Importantly, the 10-year conversion rate to R01 was equal for CTV surgeons compared to other clinician-investigators (52.6% vs 42.5%). CTV surgeons have an equal 10-year conversion rate to first R01 award compared to other clinicians. These data suggest that NIH achieves a good return on investment when funding CTV surgeon-scientists with K-level funding. Copyright © 2018 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  2. Compact AC susceptometer for fast sample characterization down to 0.1 K

    Energy Technology Data Exchange (ETDEWEB)

    Yonezawa, Shingo, E-mail: yonezawa@scphys.kyoto-u.ac.jp; Higuchi, Takumi; Sugimoto, Yusuke; Sow, Chanchal; Maeno, Yoshiteru [Department of Physics, Graduate School of Science, Kyoto University, Kyoto 606-8502 (Japan)

    2015-09-15

    We report a new design of an AC magnetic susceptometer compatible with the Physical Properties Measurement System (PPMS) by Quantum Design, as well as with its adiabatic demagnetization refrigerator option. With the elaborate compact design, the susceptometer allows simple and quick sample mounting process. The high performance of the susceptometer down to 0.1 K is demonstrated using several superconducting and magnetic materials. This susceptometer provides a method to quickly investigate qualities of a large number of samples in the wide temperature range between 0.1 and 300 K.

  3. The gravitational wave detector NAUTILUS operating at T = 0.1 K

    International Nuclear Information System (INIS)

    Astone, P.; Bassan, M.; Bonifazi, P.

    1997-02-01

    They report on the ultralow-temperature resonant-mass gravitational-wave detector NAUTILUS operating at the Frascati INFN Laboratories. The present aim of this detector is to achieve a sensitivity sufficient to detect bursts of gravitational radiation from sources located in our Galaxy and in the local group. Progress in transducer technology is likely to lead to sensitivities that will enable them to observe events from sources as far away as the Virgo cluster of galaxies. They describe the cryogenic apparatus, readout system cosmic-ray veto system, and give first results obtained during one year of continuous operation at T = 0.1 K. In particular the Brownian noise of the detector at T = 0.1 K was measured. The measured strain sensitivity was h-tilde ∼ 6 10 -22 Hz -1/2 at the frequencies of the two modes, 908 Hz and 924 Hz, with bandwidths of about 1 Hz

  4. Development of a 0.1 kW thermoelectric power generator for military applications

    International Nuclear Information System (INIS)

    Menchen, W.R.

    1986-01-01

    A man-portable thermoelectric power source is being developed for the U.S. Army. Initially used as a dedicated power supply for the XM-21 Chemical Agent Alarm System, the set can also meet a variety of general purpose user requirements. Development of a thermoelectric power conversion device is being undertaken by the U.S. Army LABCOM Electronics Technology and Devices Laboratory to fill a need for a generator that is silent, lightweight, multi-fueled and reliable. The 0.1 kW Power Generator is rectangular in configuration and consists of a power module, electronic control assembly and fuel delivery system housed within a tubular structural frame. The generator operates on military fuels ranging from kerosene to diesel oil. Multi-fuel capability is achieved using an ultrasonic atomizer and regenerative burner developed specifically for this application. This paper provides the first public presentation of results achieved during the Advanced Development Phase of the 0.1 kW Power Generator. The development process is briefly traced with emphasis on a description of the system and test results obtained to date

  5. Budding yeast cDNA sequencing project: S03052-01_K20 [Budding yeast cDNA sequencing project

    Lifescience Database Archive (English)

    Full Text Available GTCTTTGCTTCTAAA GCTTAACCATANAGTCACGGACTTAAGACTGTACGACCTGAAGGGCGCAAAAGGTGTATG CG Quality >S03052-01_K20.phd 4...C ATATACAATGTTGTCANGAGTAGCTAAACGTGCGTTTTCCTCTACANTTGCCAACCCTTA TAAAGTGACTGTCTTGGGTGCAGGCGGTGGTATTGGACAACCATT

  6. [Effect of Recombinant Adenovirus AdE-SH2-Caspase 8 on the Apoptosis of Imatinib-resistant K562/G01 Cell Line].

    Science.gov (United States)

    Wang, Lin; Fei, Chang; Huang, Zheng-Lan; Li, Hui; Liu, Zhang-Lin; Feng, Wen-Li

    2015-08-01

    To investigate the effect of SH2-Caspase 8 fusion protein expressed by recombinant adenovirus AdE-SH2-Caspase8-HA-GFP (SC) on the apoptosis of K562/G01 cell line, which is a BCR/ABL positive chronic myeloid leukemia cell line and resistant to imatinib. The K562/G01 cell line was infected with AdE-SH2-Caspase 8-HA-GFP adenovirus (SC), then the cells were divided into 3 groups: AdE-SH2m-Caspase 8-HA-GFP (SmC) group, AdE-GFP (CMV) group and PBS group as control. The infection efficiency was observed under fluorescent microscopy and by flow cytometry. The expression of fusion protein SH2-Caspase 8-HA was measured by Western blot. The morphology of the cells detected by Wright's staining. The apoptosis of the cells were detected by flow cytometry and DNA ladder. The expression of Caspase 3 and PARP were detected by Western blot. The infection efficiency of SC on K562/G01 cells was high which was confirmed by fluorescent microscopy and FCM. SH2-Caspase 8-HA fusion protein were expressed correctly in K562/G01 cells. After treatment with SC the apoptosis of K562/G01 cells could be observed by microscopy. The result of FCM showed that early apoptosis of K562/G01 cells increased significantly as compared with control groups (P SH2-Caspase 8 fusion protein can induces the apoptosis of K562/G01 cells.

  7. Acoustic resonator providing fixed points of temperature between 0.1 and 2 K

    International Nuclear Information System (INIS)

    Salmela, Anssi; Tuoriniemi, Juha; Pentti, Elias; Sebedash, Alexander; Rysti, Juho

    2009-01-01

    Below 2 K the speed of second sound in mixtures of liquid 3 He and 4 He first increases to a maximum of 30-40 m/s at about 1 K and then decreases again at lower temperatures to values below 15 m/s. The exact values depend on the concentration and pressure of the mixture. This can be exploited to provide fixed points in temperature by utilizing a resonator with appropriate dimensions and frequency to excite standing waves in the resonator cavity filled with helium mixture. We demonstrate that commercially mass produced quartz tuning forks can be used for this purpose. They are meant for frequency standards operating at 32 kHz. Their dimensions are typically of order 1 mm matching the wavelength of the second sound in helium mixtures at certain values of temperature. Due to the complicated geometry, we observe some 20 sharp acoustic resonances in the range 0.1l 2 K having temperature resolution of order 1 μK. The quartz resonators are cheap, compact, simple to implement, easy to measure with great accuracy, and, above all, they are not sensitive to magnetic field, which is a great advantage compared to fixed point devices based on superconductivity transitions. The reproducibility of the resonance pattern upon thermal cycling remains to be verified.

  8. Tunable exchange bias effect in magnetic Bi0.9Gd0.1Fe0.9Ti0.1O3 nanoparticles at temperatures up to 250K

    DEFF Research Database (Denmark)

    Basith, M. A.; Khan, F. A.; Ahmmad, Bashir

    2015-01-01

    that the strength of the exchange bias effect is tunable by the field cooling. The HEB values are also found to be dependent on the temperature. This magnetically tunable exchange bias obtained at temperatures up to 250K in Bi0.9Gd0.1Fe0.9Ti0.1O3 nanoparticles may be worthwhile for potential applications.......The exchange bias (EB) effect has been observed in magnetic Bi0.9Gd0.1Fe0.9Ti0.1O3 nanoparticles.The influence of magnetic field cooling on the exchange bias effect has also been investigated. The magnitude of the exchange bias field (HEB) increases with the cooling magnetic field, showing...

  9. Design and manufacturing of 05F-01K instrumented capsule for nuclear fuel irradiation in Hanaro

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, J. M.; Shin, Y. T.; Park, S. J. (and others)

    2007-07-15

    An instrumented capsule was developed to be able to measure fuel characteristics, such as fuel temperature, internal pressure of fuel rod, fuel pellet elongation, and neutron flux, etc., during the irradiation test of nuclear fuel in Hanaro. The instrumented capsule(02F-11K) for measuring and monitoring and monitoring fuel centerline temperature and neutron flux was designed and manufactured. It was successfully irradiated in the test hole OR5 of Hanaro from March 14, 2003 to June 1, 2003 (53.84 full power days at 24 MW). In the year of 2004, 3 test fuel rods and the instrumented capsule(03F-05K) were designed and manufactured to measure fuel centerline temperature, internal pressure of fuel rod, and fuel axial deformation during irradiation test. This capsule was irradiated in the test hole OR5 of Hanaro reactor from April 26, 2004 to October 1, 2004 (59.5 EFPD at 24 {approx} 30 MW). The six typed dual instrumented fuel rods, which allow for two characteristics to be measured simultaneously in one fuel rod, have been designed and manufactured to enhance the efficiency of the irradiation test using the instrumented fuel capsule. The 05F-01K instrumented fuel capsule was designed and manufactured for a design verification test of the three dual instrumented fuel rods. The irradiation test of the 05F-01K instrumented fuel capsule will be carried out at the OR5 vertical experimental hole of Hanaro.

  10. Thermodynamic functions of hydration of hydrocarbons at 298.15 K and 0.1 MPa

    Science.gov (United States)

    Plyasunov, Andrey V.; Shock, Everett L.

    2000-02-01

    An extensive compilation of experimental data yielding the infinite dilution partial molar Gibbs energy of hydration Δ hGO, enthalpy of hydration Δ hHO, heat capacity of hydration Δ hCpO, and volume V2O, at the reference temperature and pressure, 298.15 K and 0.1 MPa, is presented for hydrocarbons (excluding polyaromatic compounds) and monohydric alcohols. These results are used in a least-squares procedure to determine the numerical values of the corresponding properties of the selected functional groups. The simple first order group contribution method, which in general ignores nearest-neighbors and steric hindrance effects, was chosen to represent the compiled data. Following the precedent established by Cabani et al. (1981), the following groups are considered: CH 3, CH 2, CH, C for saturated hydrocarbons; c-CH 2, c-CH, c-C for cyclic saturated hydrocarbons; CH ar, C ar for aromatic hydrocarbons (containing the benzene ring); C=C, C≡C for double and triple bonds in linear hydrocarbons, respectively; c-C=C for the double bond in cyclic hydrocarbons; H for a hydrogen atom attached to the double bond (both in linear and cyclic hydrocarbons) or triple bond; and OH for the hydroxyl functional group. In addition it was found necessary to include the "pseudo"-group I(C-C) to account for the specific interactions of the neighboring hydrocarbon groups attached to the benzene or cyclic ring (in the latter case only for cis-isomers). Results of this study, the numerical values of the group contributions, will allow in most cases reasonably accurate estimations of Δ hGO, Δ hHO, Δ hCpO, and V2O at 298.15 K, 0.1 MPa for many hydrocarbons involved in geochemical and environmental processes.

  11. Irradiation test plan of instrumented capsule(05F-01K) for nuclear fuel irradiation in Hanaro (Revision 1)

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Jae Min; Kim, B. G.; Choi, M. H. (and others)

    2006-09-15

    An instrumented capsule was developed to be able to measure fuel characteristics, such as fuel temperature, internal pressure of fuel rod, fuel pellet elongation, and neutron flux, etc., during the irradiation test of nuclear fuel in HANARO. The instrumented capsule for measuring and monitoring fuel centerline temperature and neutron flux was designed and manufactured. And then, to verify the design of the instrumented capsule in the test hole, it was successfully irradiated in the test hole of HANARO from March 14, 2003 to June 1, 2003 (53.84 full power days at 24 MW). In the year of 2004, 3 test fuel rods and the 03F-05K instrumented fuel capsule were designed and fabricated to measure fuel centerline temperature, internal pressure of fuel rod, and fuel axial deformation during irradiation test. Now, this capsule was successfully irradiated in the test hole OR5 of HANARO reactor from April 27, 2004 to October 1, 2004 (59.5 full power days at 24-30 MW). The capsule and fuel rods have been be dismantled and fuel rods have been examined at the hot cell of IMEF. The instrumented fuel capsule (05F-01K) was designed and manufactured for a design verification test of the dual instrumented fuel rods. The irradiation test of the 05F-01K instrumented fuel capsule will be carried out at the OR5 vertical experimental hole of HANARO.

  12. Isobaric specific heat capacity of water and aqueous cesium chloride solutions for temperatures between 298 K and 370 K at p = 0.1 MPa

    International Nuclear Information System (INIS)

    Lourenco, M.J.V.; Santos, F.J.V.; Ramires, M.L.V.; Nieto de Castro, C.A.

    2006-01-01

    There has been some controversy regarding the uncertainty of measurements of thermal properties using differential scanning calorimeters, namely heat capacity of liquids. A differential scanning calorimeter calibrated in enthalpy and temperature was used to measure the isobaric specific heat capacity of water and aqueous solutions of cesium chloride, in the temperature range 298 K to 370 K, for molalities up 3.2 mol . kg -1 , at p = 0.1 MPa, with an estimated uncertainty (ISO definition) better than 1.1%, at a 95% confidence level. The measurements are completely traceable to SI units of energy and temperature. The results obtained were correlated as a function of temperature and molality and compared with other authors, obtained by different methods and permit to conclude that a DSC calibrated by Joule effect is capable of very accurate measurements of the isobaric heat capacity of liquids, traceable to SI units of measurement

  13. Conceptual design of a 0.1 W magnetic refrigerator for operation between 10 K and 2 K

    International Nuclear Information System (INIS)

    Helvensteijn, B.P.M.; Kashani, A.

    1990-01-01

    The design of a magnetic refrigerator for space applications is discussed. The refrigerator is to operate in the temperature range of 10 K-2 K, at a 2 K cooling power of 0.10 W. As in other magnetic refrigerators operating in this temperature range GGG has been selected as the refrigerant. Crucial to the design of the magnetic refrigerator are the heat switches at both the hot and cold ends of the GGG pill. The 2 K heat switch utilizes a narrow He II filled gap. The 10 K heat switch is based on a narrow helium gas gap. For each switch, the helium in the gap is cycled by means of activated carbon pumps. The design concentrates on reducing the switching times of the pumps and the switches as a whole. A single stage system (one magnet; one refrigerant pill) is being developed. Continuous cooling requires the fully stationary system to have at least two stages running parallel/out of phase with each other. In order to conserve energy, it is intended to recycle the magnetic energy between the magnets. To this purpose, converter networks designed for superconducting magnetic energy storage are being studied. 17 refs

  14. Polarographic study of the Cu(II)/Cu(I) system in the presence of 1-ascorbic acid and 0,1 M ClK; Estudio polarografico del sistema Cu(II)/Cu(I) en presencia del acido 1-ascorbico y en ClK 0,1 M

    Energy Technology Data Exchange (ETDEWEB)

    Alonso Lopez, J

    1969-07-01

    While studying the catalytic effect of Cu{sup {down_arrow}}2 ions on the oxidation process of 1-ascorbic acid, it has been observed that, in a 0,1 M solution of K1 at a pH 6 to 7, the above acid gives rise in the presence of Cu{sup {down_arrow}}2 ions to a polarographic wave of half-wave potential of -0,41 V (vs. S.C.E.). (Author) 14 refs.

  15. (Vapour+liquid) equilibria of {xCH3Cl+(1-x)HCl} at temperatures (159.01 and 182.33) K

    International Nuclear Information System (INIS)

    Senra, A.M.P.; Fonseca, I.M.A.; Lobo, L.Q.

    2005-01-01

    VLE for (CH 3 Cl+HCl) has been experimentally determined at temperatures (159.01 and 182.33) K, using a static; method. The data were used to calculate the molar excess Gibbs energy at the two temperatures. The excess molar enthalpy estimated from the G m E values for the equimolar mixture is relatively large and negative: H m E =-(1011+/-318) J.mol -1 . The results have been compared with estimates from the chemical theory of solutions

  16. Thermal resistance of indium coated sapphire–copper contacts below 0.1K

    CERN Document Server

    Eisel, T; Koettig, T

    2014-01-01

    High thermal resistances exist at ultra-low temperatures for solid-solid interfaces. This is especially true for pressed metal-sapphire joints, where the heat is transferred by phonons only. For such pressed joints it is difficult to achieve good physical, i.e. thermal contacts due to surface irregularities in the microscopic or larger scale. Applying ductile indium as an intermediate layer reduces the thermal resistance of such contacts. This could be proven by measurements of several researchers. However, the majority of the measurements were performed at temperatures higher than 1 K. Consequently, it is difficult to predict the thermal resistance of pressed metal-sapphire joints at temperatures below 1 K. In this paper the thermal resistances across four different copper-sapphire-copper sandwiches are presented in a temperature range between 30 mK and 100 mK. The investigated sandwiches feature either rough or polished sapphire discs (empty set 20 mm x 1.5 mm) to investigate the phonon scattering at the bo...

  17. Branching fraction and $CP$ asymmetry of the decays $B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^+$ and $B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 K^+$

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    An analysis of $B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^+$ and $B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 K^+$ decays is performed with the LHCb experiment. The $pp$ collision data used correspond to integrated luminosities of 1fb$^{-1}$ and 2fb$^{-1}$ collected at centre-of-mass energies of $\\sqrt{s}=7\\mathrm{\\,Te\\kern -0.1em V}$ and $\\sqrt{s}=8\\mathrm{\\,Te\\kern -0.1em V}$, respectively. The ratio of branching fractions and the direct $CP$ asymmetries are measured to be $\\mathcal{B}(B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 K^+)/\\mathcal{B}(B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^+) = 0.064 \\pm 0.009\\textrm{ (stat.)} \\pm 0.004\\textrm{ (syst.)}$, $\\mathcal{A}^{\\it CP}(B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^+) = -0.022 \\pm 0.025\\textrm{ (stat.)} \\pm 0.010\\textrm{ (syst.)}$ and $\\mathcal{A}^{\\it CP}(B^+ \\to K_{\\rm \\scriptscriptstyle S}^0 K^+) = -0.21 \\pm 0.14\\textrm{ (stat.)} \\pm 0.01\\textrm{ (syst.)}$. The data sample taken at $\\sqrt{s}=7\\mathrm{\\,Te\\kern -0.1em V}$ is used to search for $B_c^+ \\to K_{\\...

  18. Observing electron spin resonance between 0.1 and 67 GHz at temperatures between 50 mK and 300 K using broadband metallic coplanar waveguides

    Science.gov (United States)

    Wiemann, Yvonne; Simmendinger, Julian; Clauss, Conrad; Bogani, Lapo; Bothner, Daniel; Koelle, Dieter; Kleiner, Reinhold; Dressel, Martin; Scheffler, Marc

    2015-05-01

    We describe a fully broadband approach for electron spin resonance (ESR) experiments, where it is possible to tune not only the magnetic field but also the frequency continuously over wide ranges. Here, a metallic coplanar transmission line acts as compact and versatile microwave probe that can easily be implemented in different cryogenic setups. We perform ESR measurements at frequencies between 0.1 and 67 GHz and at temperatures between 50 mK and room temperature. Three different types of samples (Cr3+ ions in ruby, organic radicals of the nitronyl-nitroxide family, and the doped semiconductor Si:P) represent different possible fields of application for the technique. We demonstrate that an extremely large phase space in temperature, magnetic field, and frequency for ESR measurements, substantially exceeding the range of conventional ESR setups, is accessible with metallic coplanar lines.

  19. Ilves külastas veriste kätega diktaatorit

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves käis Aserbaidžaani riigipea Ilham Alijevi kutsel 12.-15.01.2009 ametlikul visiidil Bakuus. Kesknädala arvates heidab Eesti presidendi külaskäik diktatuuririiki Eestile varju rahvusvahelise üldsuse silmis

  20. Polarographic study of the Cu(II)/Cu(I) system in the presence of 1-ascorbic acid and 0,1 M ClK

    International Nuclear Information System (INIS)

    Alonso Lopez, J.

    1969-01-01

    While studying the catalytic effect of Cu ↓ 2 ions on the oxidation process of 1-ascorbic acid, it has been observed that, in a 0,1 M solution of K1 at a pH 6 to 7, the above acid gives rise in the presence of Cu ↓ 2 ions to a polarographic wave of half-wave potential of -0,41 V (vs. S.C.E.). (Author) 14 refs

  1. Finding the optimal dose of vitamin K1 to treat vitamin K deficiency and to avoid anaphylactoid reactions.

    Science.gov (United States)

    Mi, Yan-Ni; Ping, Na-Na; Li, Bo; Xiao, Xue; Zhu, Yan-Bing; Cao, Lei; Ren, Jian-Kang; Cao, Yong-Xiao

    2017-10-01

    Vitamin K1 injection induces severe dose-related anaphylactoid reactions and overdose for the treatment of vitamin K deficiency. We aimed to find an optimal and small dose of vitamin K1 injection to treat vitamin K deficiency and avoid anaphylactoid reactions in animal. Rats were administered a vitamin K-deficient diet and gentamicin to establish vitamin K deficiency model. Behaviour tests were performed in beagle dogs to observe anaphylactoid reactions. The results showed an increased protein induced by vitamin K absence or antagonist II (PIVKA-II) levels, a prolonging of prothrombin time (PT) and activated partial thromboplastin time (APTT) and a decrease in vitamin K-dependent coagulation factor (F) II, VII, IX and X activities in the model group. In vitamin K1 0.01 mg/kg group, the liver vitamin K1 levels increased fivefold and the liver vitamin K2 levels increased to the normal amount. Coagulation markers PT, APTT, FVII and FIX activities returned to normal. Both in the 0.1 and 1.0 mg/kg vitamin K1 groups, coagulation functions completely returned to normal. Moreover, the amount of liver vitamin K1 was 40 (0.1 mg/kg) or 100 (1.0 mg/kg) times as in normal. Vitamin K2 was about 4 (0.1 mg/kg) or 5 (1.0 mg/kg) times as the normal amount. There was no obvious anaphylactoid symptom in dogs with the dose of 0.03 mg/kg, which is equivalent to the dose of 0.01 mg/kg in rats. These results demonstrated that a small dose of vitamin K1 is effective to improve vitamin K deficiency and to prevent anaphylactoid reactions, simultaneously. © 2017 Société Française de Pharmacologie et de Thérapeutique.

  2. The combinatorial PP1-binding consensus Motif (R/Kx( (0,1V/IxFxx(R/Kx(R/K is a new apoptotic signature.

    Directory of Open Access Journals (Sweden)

    Angélique N Godet

    Full Text Available BACKGROUND: Previous studies established that PP1 is a target for Bcl-2 proteins and an important regulator of apoptosis. The two distinct functional PP1 consensus docking motifs, R/Kx((0,1V/IxF and FxxR/KxR/K, involved in PP1 binding and cell death were previously characterized in the BH1 and BH3 domains of some Bcl-2 proteins. PRINCIPAL FINDINGS: In this study, we demonstrate that DPT-AIF(1, a peptide containing the AIF(562-571 sequence located in a c-terminal domain of AIF, is a new PP1 interacting and cell penetrating molecule. We also showed that DPT-AIF(1 provoked apoptosis in several human cell lines. Furthermore, DPT-APAF(1 a bi-partite cell penetrating peptide containing APAF-1(122-131, a non penetrating sequence from APAF-1 protein, linked to our previously described DPT-sh1 peptide shuttle, is also a PP1-interacting death molecule. Both AIF(562-571 and APAF-1(122-131 sequences contain a common R/Kx((0,1V/IxFxxR/KxR/K motif, shared by several proteins involved in control of cell survival pathways. This motif combines the two distinct PP1c consensus docking motifs initially identified in some Bcl-2 proteins. Interestingly DPT-AIF(2 and DPT-APAF(2 that carry a F to A mutation within this combinatorial motif, no longer exhibited any PP1c binding or apoptotic effects. Moreover the F to A mutation in DPT-AIF(2 also suppressed cell penetration. CONCLUSION: These results indicate that the combinatorial PP1c docking motif R/Kx((0,1V/IxFxxR/KxR/K, deduced from AIF(562-571 and APAF-1(122-131 sequences, is a new PP1c-dependent Apoptotic Signature. This motif is also a new tool for drug design that could be used to characterize potential anti-tumour molecules.

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-3068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3068 ref|NP_960250.1| AppC [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS03633.1| AppC [Mycobacterium avium subsp. paratuberculosis K-10] NP_960250.1 2.1 28% ...

  4. NCBI nr-aa BLAST: CBRC-TTRU-01-0414 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0414 ref|YP_015999.1| hypothetical protein MMOB3020 [Mycoplasma mobile... 163K] gb|AAT27788.1| hypothetical protein MMOB3020 [Mycoplasma mobile 163K] YP_015999.1 0.012 22% ...

  5. NCBI nr-aa BLAST: CBRC-DNOV-01-2631 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2631 ref|YP_016140.1| hypothetical protein MMOB4430 [Mycoplasma mobile... 163K] gb|AAT27929.1| conserved hypothetical membrane protein [Mycoplasma mobile 163K] YP_016140.1 0.008 27% ...

  6. NCBI nr-aa BLAST: CBRC-TTRU-01-1308 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1308 ref|ZP_00517365.1| K+ channel, pore region [Crocosphaera watsonii... WH 8501] gb|EAM49562.1| K+ channel, pore region [Crocosphaera watsonii WH 8501] ZP_00517365.1 0.029 26% ...

  7. Observing electron spin resonance between 0.1 and 67 GHz at temperatures between 50 mK and 300 K using broadband metallic coplanar waveguides

    International Nuclear Information System (INIS)

    Wiemann, Yvonne; Simmendinger, Julian; Clauss, Conrad; Bogani, Lapo; Dressel, Martin; Scheffler, Marc; Bothner, Daniel; Koelle, Dieter; Kleiner, Reinhold

    2015-01-01

    We describe a fully broadband approach for electron spin resonance (ESR) experiments, where it is possible to tune not only the magnetic field but also the frequency continuously over wide ranges. Here, a metallic coplanar transmission line acts as compact and versatile microwave probe that can easily be implemented in different cryogenic setups. We perform ESR measurements at frequencies between 0.1 and 67 GHz and at temperatures between 50 mK and room temperature. Three different types of samples (Cr 3+ ions in ruby, organic radicals of the nitronyl-nitroxide family, and the doped semiconductor Si:P) represent different possible fields of application for the technique. We demonstrate that an extremely large phase space in temperature, magnetic field, and frequency for ESR measurements, substantially exceeding the range of conventional ESR setups, is accessible with metallic coplanar lines

  8. Observing electron spin resonance between 0.1 and 67 GHz at temperatures between 50 mK and 300 K using broadband metallic coplanar waveguides

    Energy Technology Data Exchange (ETDEWEB)

    Wiemann, Yvonne; Simmendinger, Julian; Clauss, Conrad; Bogani, Lapo; Dressel, Martin; Scheffler, Marc [1. Physikalisches Institut, Universität Stuttgart, Pfaffenwaldring 57, 70569 Stuttgart (Germany); Bothner, Daniel; Koelle, Dieter; Kleiner, Reinhold [Physikalisches Institut and Center for Collective Quantum Phenomena in LISA+, Universität Tübingen, Auf der Morgenstelle 14, 72076 Tübingen (Germany)

    2015-05-11

    We describe a fully broadband approach for electron spin resonance (ESR) experiments, where it is possible to tune not only the magnetic field but also the frequency continuously over wide ranges. Here, a metallic coplanar transmission line acts as compact and versatile microwave probe that can easily be implemented in different cryogenic setups. We perform ESR measurements at frequencies between 0.1 and 67 GHz and at temperatures between 50 mK and room temperature. Three different types of samples (Cr{sup 3+} ions in ruby, organic radicals of the nitronyl-nitroxide family, and the doped semiconductor Si:P) represent different possible fields of application for the technique. We demonstrate that an extremely large phase space in temperature, magnetic field, and frequency for ESR measurements, substantially exceeding the range of conventional ESR setups, is accessible with metallic coplanar lines.

  9. NCBI nr-aa BLAST: CBRC-CREM-01-1284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1284 ref|NP_962383.1| SugI [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS05999.1| SugI [Mycobacterium avium subsp. paratuberculosis K-10] NP_962383.1 2e-85 55% ...

  10. NCBI nr-aa BLAST: CBRC-MDOM-01-0302 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0302 ref|ZP_05500348.1| RarD protein, DMT superfamily transporter [Thiomonas intermedia... K12] gb|EEU54627.1| RarD protein, DMT superfamily transporter [Thiomonas intermedia K12] ZP_05500348.1 1.9 27% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-01-0247 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0247 ref|ZP_00545283.1| 60 kDa inner membrane protein [Ehrlichia chaffee...nsis str. Sapulpa] gb|EAM85346.1| 60 kDa inner membrane protein [Ehrlichia chaffeensis str. Sapulpa] ZP_00545283.1 2.1 30% ...

  12. {11-bar 01} twin dislocation structures in evaporated titanium thin films

    International Nuclear Information System (INIS)

    Bursill, L.A.; Peng, Julin; Fan, Xudong; Kasukabe, Y.; Yamada, Y.

    1995-01-01

    High-resolution transmission electron micrographs of { 11-bar 01} interfacial twin dislocations in Ti thin films are reexamined. Computer simulations of the experimental images were obtained using atomic models deduced by Pond, Bacon and Serra (Phil Mag Letts, 1995). Two twin dislocations were analysed, with step heights of 4 x d(K 1 ) and 2 x d (K 1 ), where d(K 1 ) is the spacing of the { 11-bar 01 } planes. Reasonable agreement with the predicted structures was obtained at about 0.17nm resolution. 10 refs., 2 figs

  13. Temperature profiles from MBT casts from the CIRRUS and CUMULUS from Ocean Weather Station K (OWS-K) and M (OWS-M) in the North Atlantic Ocean from 1969-01-01 to 1970-01-16 (NODC Accession 7000939)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathythermograph data were collected from the CIRRUS and CUMULUS within a 1-mile radius of Ocean Weather Station K (4500N 01600W), M (6600N 00200E), and in transit....

  14. MO-FG-CAMPUS-IeP1-01: Alternative K-Edge Filters for Low-Energy Image Acquisition in Contrast Enhanced Spectral Mammography

    Energy Technology Data Exchange (ETDEWEB)

    Shrestha, S; Vedantham, S; Karellas, A [University of Massachusetts Medical School, Worcester, MA (United States)

    2016-06-15

    Purpose: In Contrast Enhanced Spectral Mammography (CESM), Rh filter is often used during low-energy image acquisition. The potential for using Ag, In and Sn filters, which exhibit K-edge closer to, and just below that of Iodine, instead of the Rh filter, was investigated for the low-energy image acquisition. Methods: Analytical computations of the half-value thickness (HVT) and the photon fluence per mAs (photons/mm2/mAs) for 50µm Rh were compared with other potential K-edge filters (Ag, In and Sn), all with K-absorption edge below that of Iodine. Two strategies were investigated: fixed kVp and filter thickness (50µm for all filters) resulting in HVT variation, and fixed kVp and HVT resulting in variation in Ag, In and Sn thickness. Monte Carlo simulations (GEANT4) were conducted to determine if the scatter-to-primary ratio (SPR) and the point spread function of scatter (scatter PSF) differed between Rh and other K-edge filters. Results: Ag, In and Sn filters (50µm thick) increased photon fluence/mAs by 1.3–1.4, 1.8–2, and 1.7–2 at 28-32 kVp compared to 50µm Rh, which could decrease exposure time. Additionally, the fraction of spectra closer to and just below Iodine’s K-edge increased with these filters, which could improve post-subtraction image contrast. For HVT matched to 50µm Rh filtered spectra, the thickness range for Ag, In, and Sn were (41,44)µm, (49,55)µm and (45,53)µm, and increased photon fluence/mAs by 1.5–1.7, 1.6–2, and 1.6–2.2, respectively. Monte Carlo simulations showed that neither the SPR nor the scatter PSF of Ag, In and Sn differed from Rh, indicating no additional detriment due to x-ray scatter. Conclusion: The use of Ag, In and Sn filters for low-energy image acquisition in CESM is potentially feasible and could decrease exposure time and may improve post-subtraction image contrast. Effect of these filters on radiation dose, contrast, noise and associated metrics are being investigated. Funding Support: Supported in

  15. NCBI nr-aa BLAST: CBRC-ACAR-01-0968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0968 ref|NP_001103230.1| Fanconi anemia core complex 100 kDa subunit i...soform b [Homo sapiens] sp|Q0VG06|FP100_HUMAN Fanconi anemia-associated protein of 100 kDa NP_001103230.1 2e-50 46% ...

  16. Fully automatized apparatus for determining speed of sound for liquids in the temperature and pressure interval (283.15–343.15) K and (0.1–95) MPa

    International Nuclear Information System (INIS)

    Yebra, Francisco; Troncoso, Jacobo; Romaní, Luis

    2017-01-01

    Highlights: • An apparatus for measuring speed of sound of liquids is described. • Pressure and temperature control is fully automatized. • Uncertainty of the measurements is estimated in 0.1%. • Comparison with literature data confirms the reliability of the methodology. - Abstract: An instrument for determining the speed of sound as a function of temperature and pressure for liquids is described. It was totally automatized: pressure and temperature values are controlled and time of flight of the ultrasonic wave data were acquired using a digital system which automatically made all required actions. The instrument calibration was made only at atmospheric pressure using high quality data of water and methanol. For higher pressures, the calibration parameters were predicted using a model for the high pressure cell, through finite-element calculations (FEM), in order to realistically determine the changes in the cell induced by the compression. Uncertainties in pressure and temperature were 20 mK and 0.1 MPa, respectively and in speed of sound it was estimated to be about 0.1%. The speeds of sound for water, methanol, hexane, heptane, octane, toluene, ethanol and 1-propanol were determined in the temperature and pressure ranges (283.15–343.15) K and (0.1–95) MPa. Comparison with literature data reveals the high reliability of the experimental procedure.

  17. Observation of B Meson Decays to omegapi+, omegaK+, and omegaK0

    International Nuclear Information System (INIS)

    Smith, James G

    2003-01-01

    The authors present preliminary measurements of B meson decays to B + → ωπ + , B + → ωK + , and B 0 → ωK 0 . The data were recorded with the BABAR detector and correspond to 88.9 x 10 6 B(bar B) pairs produced in e + e - annihilation at the Υ(4S) resonance. They find statistically significant signals for all three channels: Β(B + → ωπ + ) = (5.4 ± 1.0 ± 0.5) x 10 -6 , Β(B + → ωK + ) = (5.0 ± 1.0 ± 0.4) x 10 -6 , and Β(B 0 → ωK 0 ) = (5.3 -1.2 +1.4 ± 0.5) x 10 -6 . They also measure time-integrated charge asymmetries Α ch (B + → ωπ + ) = 0.04 ± 0.17 ± 0.01 and Α ch (B + → ωK + ) = -0.05 ± 0.16 ± 0.01

  18. Partial molar volume of paracetamol in water, 0.1 M HCl and 0.154 M NaCl at T = (298.15, 303.15, 308.15 and 310.65) K and at 101.325 kPa

    Energy Technology Data Exchange (ETDEWEB)

    Iqbal, Muhammad Javed [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: mjiqauchem@yahoo.com; Malik, Qaisar Mahmood [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: qaisar_@hotmail.com

    2005-12-15

    The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V {sub m}, of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E {sup .}, the isobaric coefficient of thermal expansion, {alpha} {sub p}, and the interaction coefficient, S {sub v}, have also been computed. The expansivity data show dependence of E {sup .} values on the structure of the solute molecules.

  19. Partial molar volume of paracetamol in water, 0.1 M HCl and 0.154 M NaCl at T = (298.15, 303.15, 308.15 and 310.65) K and at 101.325 kPa

    International Nuclear Information System (INIS)

    Iqbal, Muhammad Javed; Malik, Qaisar Mahmood

    2005-01-01

    The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V m , of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E . , the isobaric coefficient of thermal expansion, α p , and the interaction coefficient, S v , have also been computed. The expansivity data show dependence of E . values on the structure of the solute molecules

  20. Studies of the decays $B^+ \\to p \\bar p h^+$ and observation of $B^+ \\to \\kern 0.1em\\bar{\\kern -0.1em\\Lambda}(1520)p$

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    Dynamics and direct $CP$ violation in three-body charmless decays of charged $B$ mesons to a proton, an antiproton and a light meson (pion or kaon) are studied using data, corresponding to an integrated luminosity of 1.0$ {\\,fb}^{-1}$, collected by the ${LHCb}$ experiment in $pp$ collisions at a center-of-mass energy of 7 TeV. Production spectra are determined as a function of Dalitz-plot and helicity variables. The forward-backward asymmetry of the light meson in the $p\\bar p$ rest frame is measured. No significant $CP$ asymmetry in $B^+ \\to p \\bar p K^+$ decay is found in any region of the Dalitz plane. We present the first observation of the decay $B^+ \\to \\kern 0.1em\\bar{\\kern -0.1em\\Lambda}(1520)(\\to K^+\\bar p)p$ near the $K^+\\bar p$ threshold and measure $\\mathcal{B}(B^+ \\to \\kern 0.1em\\bar{\\kern -0.1em\\Lambda}(1520)p)=(3.9^{+1.0}_{-0.9} (\\mathrm{stat})\\pm0.1 (\\mathrm{syst})\\pm0.3 (\\mathrm{BF}))\\times 10^{-7}$, where BF denotes the uncertainty on secondary branching fractions.

  1. Calibration of thermometers in the range from 4K to 40K

    International Nuclear Information System (INIS)

    Cruz, M.E. de la; Sereni, Julian; Salva, Horacio.

    1977-06-01

    Carbon and Germanium resistors have been calibrated against a standard in the temperature range from 4K to 40K. From the data, values of temperature are obtained with 0,1% error (std deviation). These calibrations have been also checked against specific heat measurements. (author) [es

  2. NCBI nr-aa BLAST: CBRC-TBEL-01-1998 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1998 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-82 95% ...

  3. NCBI nr-aa BLAST: CBRC-EEUR-01-0561 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0561 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-160 88% ...

  4. NCBI nr-aa BLAST: CBRC-BTAU-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0320 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-159 88% ...

  5. NCBI nr-aa BLAST: CBRC-OANA-01-0544 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0544 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-124 71% ...

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-0496 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0496 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-148 82% ...

  7. NCBI nr-aa BLAST: CBRC-DNOV-01-1358 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1358 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-127 77% ...

  8. NCBI nr-aa BLAST: CBRC-BTAU-01-1781 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1781 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-120 67% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  10. NCBI nr-aa BLAST: CBRC-DNOV-01-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0029 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 4e-99 83% ...

  11. NCBI nr-aa BLAST: CBRC-OGAR-01-0926 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0926 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-150 79% ...

  12. NCBI nr-aa BLAST: CBRC-DNOV-01-2040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2040 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 5e-74 62% ...

  13. NCBI nr-aa BLAST: CBRC-LAFR-01-1318 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1318 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-120 68% ...

  14. NCBI nr-aa BLAST: CBRC-LAFR-01-0314 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0314 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 90% ...

  15. NCBI nr-aa BLAST: CBRC-DNOV-01-1298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1298 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 2e-77 66% ...

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-0611 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0611 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-160 87% ...

  17. NCBI nr-aa BLAST: CBRC-DNOV-01-1757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1757 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-167 90% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  19. NCBI nr-aa BLAST: CBRC-DNOV-01-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0070 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 2e-81 71% ...

  20. NCBI nr-aa BLAST: CBRC-BTAU-01-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0090 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-162 90% ...

  1. Effective lifetime measurements in the $B_{s}^{0} \\rightarrow K^{+}K^{-}$, $B^{0} \\rightarrow K^{+}\\pi^{-}$ and $B_{s}^{0} \\rightarrow \\pi^{+}K^{-}$ decays

    CERN Document Server

    INSPIRE-00258707; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J.E.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J.J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T.J.V.; Bowen, E.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N.H.; Brown, H.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Campora Perez, D.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L.Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Cheung, S.F.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G.A.; Craik, D.C.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P.N.Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; de Miranda, J.M.; De Paula, L.; De Silva, W.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Esen, S.; Evans, T.; Falabella, A.; Farber, C.; Farinelli, C.; Farley, N.; Farry, S.; Ferguson, D.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gaspar, C.; Gauld, R.; Gavardi, L.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani', S.; Gibson, V.; Giubega, L.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Gotti, C.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Grunberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S.C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S.T.; Harrison, J.; Hartmann, T.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J.A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hunt, P.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jaton, P.; Jawahery, A.; Jezabek, M.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Joram, C.; Jost, B.; Jurik, N.; Kaballo, M.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T.M.; Kelsey, M.; Kenyon, I.R.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R.F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J.H.; Lopez-March, N.; Lowdon, P.; Lu, H.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Manzali, M.; Maratas, J.; Marchand, J.F.; Marconi, U.; Benito, C.Marin; Marino, P.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin Sanchez, A.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D.A.; Minard, M.N.; Moggi, N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M.J.; Moron, J.; Mountain, R.; Muheim, F.; Muller, K.; Muresan, R.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A.D.; Nguyen, T.D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, G.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Oyanguren, A.; Pal, B.K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Patrignani, C.; Pazos Alvarez, A.; Pearce, A.; Pellegrino, A.; Pepe Altarelli, M.; Perazzini, S.; Perez Trigo, E.; Perret, P.; Perrin-Terrin, M.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Plo Casasus, M.; Polci, F.; Poluektov, A.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, W.; Rachwal, B.; Rademacker, J.H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M.S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Reichert, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Richards, A.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Roa Romero, D.A.; Robbe, P.; Rodrigues, A.B.; Rodrigues, E.; Rodriguez Perez, P.; Roiser, S.; Romanovsky, V.; Vidal, A.Romero; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, H.; Valls, P.Ruiz; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, N.A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M.D.; Soler, F.J.P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spinella, F.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Subbiah, V.K.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szilard, D.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M.T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vallier, A.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Voss, H.; de Vries, J.A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiedner, D.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S.A.; Wright, S.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.

    2014-01-01

    Measurements of the effective lifetimes in the $B_{s}^{0} \\rightarrow K^{+}K^{-}$, $B^{0} \\rightarrow K^{+}\\pi^{-}$ and $B_{s}^{0} \\rightarrow \\pi^{+}K^{-}$ decays are presented using $1.0~\\mathrm{fb^{-1}}$ of $pp$ collision data collected at a centre-of-mass energy of 7 TeV by the LHCb experiment. The analysis uses a data-driven approach to correct for the decay time acceptance. The measured effective lifetimes are $\\tau_{B_{s}^{0} \\rightarrow K^{+}K^{-}}$ = $1.407~\\pm~0.016~\\pm~0.007~\\mathrm{ps}$, $\\tau_{B^{0} \\rightarrow K^{+}\\pi^{-}}$ = $1.524~\\pm~0.011~\\pm~0.004~\\mathrm{ps}$, $\\tau_{B_{s}^{0} \\rightarrow \\pi^{+}K^{-}}$ = $1.60~\\pm~0.06~\\pm~0.01~\\mathrm{ps}$. This is the most precise determination to date of the effective lifetime in the $B_{s}^{0} \\rightarrow K^{+}K^{-}$ decay and provides constraints on contributions from physics beyond the Standard Model to the $B_{s}^{0}$ mixing phase and the width difference $\\Delta\\Gamma_{s}$.

  2. 26 CFR 1.401(k)-2 - ADP test.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false ADP test. 1.401(k)-2 Section 1.401(k)-2 Internal... TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.401(k)-2 ADP test. (a) Actual deferral percentage (ADP) test—(1) In general—(i) ADP test formula. A cash or deferred arrangement satisfies the ADP...

  3. k c anjaneya

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K C ANJANEYA. Articles written in Bulletin of Materials Science. Volume 39 Issue 5 September 2016 pp 1279-1284. Structural, electrical and electrochemical studies of LiNi 0.4 M 0.1 Mn 1.5 O 4 ( M = Co, Mg) solid solutions for lithium ion battery · G P NAYAKA K V PAI J ...

  4. Search for the decay of a B0 or B0bar meson to K*0bar K0 or K*0 K0bar

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-06-27

    The authors present a search for the decay of a B{sup 0} or {bar B}{sup 0} meson to a {bar K}*{sup 0} K{sup 0} or K*{sup 0} {bar K}{sup 0} final state, using a sample of approximately 232 million B{bar B} events collected with the BABAR detector at the PEP-II asymmetric energy e{sup +}e{sup -} collider at SLAC. The measured branching fraction is {Beta}(B{sup 0} {yields} {bar K}*{sup 0} K{sup 0}) + {Beta}(B{sup 0} {yields} K*{sup 0} {bar K}{sup 0}) = (0.2{sub -0.8, -0.3}{sup +0.9, +0.1}) x 10{sup -6}. They obtain the following upper limit for the branching fraction at 90% confidence level: {Beta}(B{sup 0} {yields} {bar K}*{sup 0} K{sup 0}) + {Beta}(B{sup 0} {yields} K*{sup 0} {bar K}{sup 0}) < 1.9 x 10{sup -6}. They use our result to constrain the Standard Model prediction for the deviation of the CP asymmetry in B{sup 0} {yields} {phi}K{sup 0} from sin 2{beta}.

  5. Measurement of $CP$ asymmetry in $D^0 \\rightarrow K^- K^+$ and $D^0 \\rightarrow \\pi^- \\pi^+$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    Time-integrated $CP$ asymmetries in $D^0$ decays to the final states $K^- K^+$ and $\\pi^- \\pi^+$ are measured using proton-proton collisions corresponding to $3\\mathrm{\\,fb}^{-1}$ of integrated luminosity collected at centre-of-mass energies of $7\\mathrm{\\,Te\\kern -0.1em V}$ and $8\\mathrm{\\,Te\\kern -0.1em V}$. The $D^0$ mesons are produced in semileptonic $b$-hadron decays, where the charge of the accompanying muon is used to determine the initial flavour of the charm meson. The difference in $CP$ asymmetries between the two final states is measured to be \\begin{align} \\Delta A_{CP} = A_{CP}(K^-K^+)-A_{CP}(\\pi^-\\pi^+) = (+0.14 \\pm 0.16\\mathrm{\\,(stat)} \\pm 0.08\\mathrm{\\,(syst)})\\% \\ . \

  6. Electrical characterization of ALD HfO2 high-k dielectrics on ( 2 ¯ 01) β-Ga2O3

    Science.gov (United States)

    Shahin, David I.; Tadjer, Marko J.; Wheeler, Virginia D.; Koehler, Andrew D.; Anderson, Travis J.; Eddy, Charles R.; Christou, Aris

    2018-01-01

    The electrical quality of HfO2 dielectrics grown by thermal atomic layer deposition at 175 °C on n-type ( 2 ¯ 01) β-Ga2O3 has been studied through capacitance- and current-voltage measurements on metal-oxide-semiconductor capacitors. These capacitors exhibited excellent electrical characteristics, including dual-sweep capacitance-voltage curves with low hysteresis and stretch-out and a frequency-stable dielectric constant of k˜14 when measured between 10 kHz and 1 MHz. The C-V curves exhibited a uniform and repeatable +1.05 V shift relative to the ideal case when swept from 3.5 to -5 V, yielding positively measured flatband (+2.15 V) and threshold (+1.05 V) voltages that may be useful for normally off n-channel Ga2O3 devices. Using the Terman method, an average interface trap density of 1.3 × 1011 cm-2.eV-1 was obtained between 0.2 and 0.6 eV below the conduction band edge. The forward bias current-voltage characteristic was successfully fitted to the Fowler-Nordheim tunneling model at a field strength of 5 MV/cm, allowing an extraction of a 1.3 eV conduction band offset between HfO2 and Ga2O3, which matches the value previously determined from x-ray photoelectron spectroscopy. However, a temperature dependence in the leakage current was observed. These results suggest that HfO2 is an appealing dielectric for Ga2O3 device applications.

  7. antimicrobial susceptibility pattern of vibrio cholerae 01 strains

    African Journals Online (AJOL)

    hi-tech

    East African Medical Journal Vol. 77 No. 7 July 2000. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF VIBRIO CHOLERAE 01 STRAINS DURING TWO CHOLERA OUTBREAKS IN DAR ES SALAAM,. TANZANIA. W.K. Urassa, MD, MSc, MMed, Lecturer, Department of Microbiology and Immunology, Muhimbili University ...

  8. Constants of acid‒base equilibria in an aqueous amikacin aminoglycoside solution at 298 K

    Science.gov (United States)

    Alekseev, V. G.; Markova, E. V.

    2016-03-01

    The acid dissociation constants of form p K 1 = 7.34 ± 0.01, p K 2 = 7.84 ± 0.01, p K 3 = 8.77 ± 0.01, p K 4 = 9.49 ± 0.01, and p K 5 = 10.70 ± 0.02 of cationic amikacin are determined by pH-metric titration at 25°C against the background of 0.1 mol/L KNO3. K 1, K 2, K 3, and K 4 correspond to the dissociation of protons coordinated to amino groups, while K 5 characterizes the dissociation of the hydroxyl hydrogen atom, testifying to the amphoteric character of amikacin molecules. Applying density functional theory (DFT) with the B3LYP hybrid functional and the 6-311G**++ basis set, the partial charges on the atoms of an amikacin molecule are calculated. It is concluded that the dissociation of H(55)hydrogen atom occurs with a greatest partial charge of +0.53631.

  9. Experimental Conditions: SE48_S01_M01_D01 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available structure elucidation of 36 specialized metabolites from Oryza sativa (rice) by using MS/MS and NMR analyse...s SE48_S01 Habataki SE48_S01_M01 1 μL SE48_MS01 LC–QTOF-MS/MS analysis SE48_DS01 Data upload Default SE48_AM01 SE48_SS01 Isolation of specialized metabolites ...

  10. Enhanced piezoelectric properties in vanadium-modified lead-free (K{sub 0.485}Na{sub 0.5}Li{sub 0.015})(Nb{sub 0.88}Ta{sub 0.1}V{sub 0.02})O{sub 3} ceramics prepared from nanopowders

    Energy Technology Data Exchange (ETDEWEB)

    Gaur, Roopam; Dhingra, Apurva; Pal, Soham; Chandramani Singh, K., E-mail: kongbam@gmail.com

    2015-03-15

    Highlights: • (K{sub 0.485}Na{sub 0.5}Li{sub 0.015})(Nb{sub 0.9−x}Ta{sub 0.1}V{sub x}) O{sub 3}(x = 0, 0.01, 0.02, 0.03) ceramics were prepared. • These ceramics were synthesized from 35-nm powders. • Density, microstrain, crystallite size, tetragonality were high at x = 0.02. • Dielectric, ferroelectric and piezoelectric properties were enhanced at x = 0.02. • The increased properties are attributed to crystal structure and microstructure. - Abstract: Enhancing the piezoelectric properties of lead-free piezoceramics like alkaline niobate system has been an important research topic in our search for an alternative to widely used but highly toxic lead-based PZT piezoceramics system. In the present study, lead-free alkaline niobate-based compositions (K{sub 0.485}Na{sub 0.5}Li{sub 0.015})(Nb{sub 0.9−x}Ta{sub 0.1}V{sub x})O{sub 3} (x = 0, 0.01, 0.02 and 0.03) were synthesized using conventional solid state reaction method. Nanocrystalline powders of these compositions, produced by high energy ball milling, were sintered at 1050 °C for 4 h to produce corresponding ceramics. Increasing V{sup 5+} content in the ceramics from x = 0 to 0.02 results in a gradual increase in the room temperature dielectric constant (ε{sub r}) from 1185 to 1336, remnant polarization (P{sub r}) from 13.4 μC/cm{sup 2} to 17.1 μC/cm{sup 2}, electromechanical coupling factor (k{sub p}) from 0.37 to 0.40, and piezoelectric charge constant (d{sub 33}) from 156 pC/N to 185 pC/N. Further increase in x to 0.03 lowers these values to 1082, 13.4 μC/cm{sup 2}, 0.36 and 128 pC/N respectively. Correspondingly, the coercive field (E{sub c}) first shows a gradual decline from 8.5 kV/cm to 7.9 kV/cm and then a rise to 9.2 kV/cm, as x increases from 0 to 0.02 and then to 0.03. The enhancement of piezoelectric properties in (K{sub 0.485}Na{sub 0.5}Li{sub 0.015})(Nb{sub 0.88}Ta{sub 0.1}V{sub 0.02})O{sub 3} ceramics is attributed to the associated higher values of density, tetragonality and

  11. Experimental Conditions: SE51_S01_M01_D01 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE51_S01_M01_D01 SE51 RIKEN tandem mass spectral database (ReSpect) for phytochemic...als: A plant-specific MS/MS-based data resource and database SE51_S01 L. japonicus accessions SE51_S01_M01 N

  12. Search for the Theta+ pentaquark in the reactions gammap-->[overline K]0K+n and gammap-->[overline K]0K0p

    Energy Technology Data Exchange (ETDEWEB)

    Raffaella De Vita; Marco Battaglieri; V. Kubarovsky; Nathan Baltzell; Matthew Bellis; John Goett; Lei Guo; Gordon Mutchler; Paul Stoler; Maurizio Ungaro; Dennis Weygand; Moscov Amaryan; Pawel Ambrozewicz; Marco Anghinolfi; Gegham Asryan; Harutyun AVAKIAN; Harutyun Avakian; Hovhannes Baghdasaryan; Nathan Baillie; Jacques Ball; Vitaly Baturin; Ivan Bedlinski; Ivan Bedlinskiy; Nawal Benmouna; Barry Berman; Angela Biselli; Sergey Boyarinov; Sylvain Bouchigny; Robert Bradford; Derek Branford; William Briscoe; William Brooks; Stephen Bueltmann; Volker Burkert; Cornel Butuceanu; John Calarco; Sharon Careccia; Daniel Carman; Shifeng Chen; Eric Clinton; Philip Cole; Patrick Collins; Philip Coltharp; Donald Crabb; Hall Crannell; Volker Crede; John Cummings; D. Dale; Raffaella De Vita; Enzo De Sanctis; Pavel Degtiarenko; Alexandre Deur; Kahanawita Dharmawardane; Chaden Djalali; Gail Dodge; Joseph Donnelly; David Doughty; Michael Dugger; Oleksandr Dzyubak; Hovanes Egiyan; Kim Egiyan; Lamiaa Elfassi; Latifa Elouadrhiri; Paul Eugenio; Gleb Fedotov; Herbert Funsten; Marianna Gabrielyan; Liping Gan; Michel Garcon; Ashot Gasparian; Gagik Gavalian; Gerard Gilfoyle; Kevin Giovanetti; Francois-Xavier Girod; Oleksandr Glamazdin; John Goetz; Evgueni Golovatch; Atilla Gonenc; Christopher Gordon; Ralf Gothe; Keith Griffioen; Michel Guidal; Nevzat Guler; Harutyun Gyurjyan; Cynthia Hadjidakis; Kawtar Hafidi; Hayk Hakobyan; Rafael Hakobyan; John Hardie; F. Hersman; Kenneth Hicks; Ishaq Hleiqawi; Maurik Holtrop; Charles Hyde-Wright; Yordanka Ilieva; David Ireland; Boris Ishkhanov; Eugeny Isupov; Mark Ito; D. Jenkins; Hyon-Suk Jo; Kyungseon Joo; Henry Juengst; James Kellie; Mahbubul Khandaker; Wooyoung Kim; Andreas Klein; Franz Klein; Alexei Klimenko; Mikhail Kossov; Laird Kramer; Joachim Kuhn; Sebastian Kuhn; Sergey Kuleshov; Jeff Lachniet; Jean Laget; Jorn Langheinrich; Dave Lawrence; Tsung-shung Lee; Ji Li; K. Livingston; Haiyun Lu; Marion MacCormick; Nikolai Markov; Bryan McKinnon; Bernhard Mecking; Joseph Melone; Mac Mestayer; Curtis Meyer; Tsutomu Mibe; Konstantin Mikhaylov; Ralph Minehart; Marco Mirazita; R. Miskimen; Vasiliy Mochalov; Viktor Mokeev; Ludyvine Morand; Steven Morrow; Maryam Moteabbed; Pawel Nadel-Turonski; Itaru Nakagawa; Rakhsha Nasseripour; Silvia Niccolai; Gabriel Niculescu; Maria-Ioana Niculescu; Bogdan Niczyporuk; Megh Niroula; Rustam Niyazov; Mina Nozar; Mikhail Osipenko; Alexander Ostrovidov; Kijun Park; Evgueni Pasyuk; Craig Paterson; Joshua Pierce; Nikolay Pivnyuk; Dinko Pocanic; Oleg Pogorelko; Sergey Pozdnyakov; John Price; Yelena Prok; Dan Protopopescu; Brian Raue; Gregory Riccardi; Giovanni Ricco; Marco Ripani; Barry Ritchie; Federico Ronchetti; Guenther Rosner; Patrizia Rossi; Franck Sabatie; Carlos Salgado; Joseph Santoro; Vladimir Sapunenko; Reinhard Schumacher; Vladimir Serov; Youri Sharabian; Nikolay Shvedunov; Elton Smith; Lee Smith; Daniel Sober; Aleksey Stavinskiy; Samuel Stepanyan; Stepan Stepanyan; Burnham Stokes; Igor Strakovski; Steffen Strauch; Mauro Taiuti; David Tedeschi; Aram Teymurazyan; Ulrike Thoma; Avtandil Tkabladze; Svyatoslav Tkachenko; Luminita Todor; Clarisse Tur; Michael Vineyard; Alexander Vlassov; Daniel Watts; Lawrence Weinstein; M. Williams; Elliott Wolin; Michael Wood; Amrit Yegneswaran; Lorenzo Zana; Jixie Zhang; Bo Zhao; Zhiwen Zhao

    2006-11-16

    The exclusive reactions {gamma}p {yields} {bar K}{sup 0} K{sup +} n and {gamma}p {yields} {bar K}{sup 0} K{sup 0} p have been studied in the photon energy range 1.6--3.8 GeV, searching for evidence of the exotic baryon {Theta}{sup +}(1540) in the decays {Theta}{sup +} {yields} nK{sup +} and {Theta}{sup +} {yields} pK{sup 0}. Data were collected with the CLAS detector at the Thomas Jefferson National Accelerator Facility. The integrated luminosity was about 70 pb{sup -1}. The reactions have been isolated by detecting the K{sup +} and proton directly, the neutral kaon via its decay to K{sub S} {yields} {pi}{sup +}{pi}{sup -} and the neutron or neutral kaon via the missing mass technique. The mass and width of known hyperons such as {Sigma}{sup +}, {Sigma}{sup -} and {Lambda}(1116) were used as a check of the mass determination accuracy and experimental resolution. Approximately 100,000 {Lambda}*(1520)'s and 150,000 {phi}'s were observed in the {bar K}{sup 0} K{sup +} n and {bar K}{sup 0} K{sup 0} p final state respectively. No evidence for the {Theta}{sup +} pentaquark was found in the nK{sup +} or pK{sub S} invariant mass spectra. Upper limits were set on the production cross section of the reaction {gamma}p {yields} {Theta}{sup +} {bar K}{sup 0} as functions of center-of-mass angle, nK{sup +} and pK{sub S} masses. Combining the results of the two reactions, the 95% C.L. upper limit on the total cross section for a resonance peaked at 1540 MeV was found to be 0.7 nb. Within most of the available theoretical models, this corresponds to an upper limit on the {Theta}{sup +} width, {Gamma}{sub {Theta}{sup +}}, ranging between 0.01 and 7 MeV.

  13. NCBI nr-aa BLAST: CBRC-OPRI-01-0485 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0485 ref|YP_680544.1| magnesium chelatase subunit D [Roseobacter denit...rificans OCh 114] gb|ABG29858.1| magnesium-chelatase 60 kDa subunit [Roseobacter denitrificans OCh 114] YP_680544.1 0.003 28% ...

  14. Magnetic phase transition in MnFeP0.5As0.4Si0.1

    International Nuclear Information System (INIS)

    Wang, J L; Campbell, S J; Tegus, O; Brueck, E; Dou, S X

    2010-01-01

    We have carried out a detailed investigation of the magnetic phase transition in MnFeP 0.5 As 0.4 Si 0.1 . Temperature hysteresis has been observed in the variable temperature magnetization curves (B appl = 0.01 T) with T C W ∼ 302 K on warming and T C C ∼ 292 K on cooling. The first order nature of this transition in MnFeP 0.5 As 0.4 Si 0.1 is confirmed by the negative slope obtained from isotherms of M 2 versus B/M around the critical temperature. Linear thermal expansion measurements reveal a large volume change, ΔV/V∼8.7x10 -3 at the magnetic phase transition and that this magnetovolume effect is suppressed to ΔV/V ∼ 5.5x10 -3 in an applied field of B appl = 1.0 T. Analyses of 57 Fe Moessbauer spectra (4.5 - 300 K) using a random distribution model and taking nearest-neighbour environments into account, indicate that the paramagnetic and ferromagnetic phases coexist over a temperature range of ∼ 45 K around the Curie temperature. The Debye temperature for MnFeP 0.5 As 0.4 Si 0.1 has been evaluated as θ D = 350 ± 20 K from the temperature dependence of the average isomer shift.

  15. Mamu-A*01/Kb transgenic and MHC Class I knockout mice as a tool for HIV vaccine development

    International Nuclear Information System (INIS)

    Li Jinliang; Srivastava, Tumul; Rawal, Ravindra; Manuel, Edwin; Isbell, Donna; Tsark, Walter; La Rosa, Corinna; Wang Zhongde; Li Zhongqi; Barry, Peter A.; Hagen, Katharine D.; Longmate, Jeffrey; Diamond, Don J.

    2009-01-01

    We have developed a murine model expressing the rhesus macaque (RM) Mamu-A*01 MHC allele to characterize immune responses and vaccines based on antigens of importance to human disease processes. Towards that goal, transgenic (Tg) mice expressing chimeric RM (α1 and α2 Mamu-A*01 domains) and murine (α3, transmembrane, and cytoplasmic H-2K b domains) MHC Class I molecules were derived by transgenesis of the H-2K b D b double MHC Class I knockout strain. After immunization of Mamu-A*01/K b Tg mice with rVV-SIVGag-Pol, the mice generated CD8 + T-cell IFN-γ responses to several known Mamu-A*01 restricted epitopes from the SIV Gag and Pol antigen sequence. Fusion peptides of highly recognized CTL epitopes from SIV Pol and Gag and a strong T-help epitope were shown to be immunogenic and capable of limiting an rVV-SIVGag-Pol challenge. Mamu-A*01/K b Tg mice provide a model system to study the Mamu-A*01 restricted T-cell response for various infectious diseases which are applicable to a study in RM.

  16. Linear thermal expansion measurements on silicon from 6 to 340 K

    International Nuclear Information System (INIS)

    Lyon, K.G.; Salinger, G.L.; Swenson, C.A.; White, G.K.

    1977-01-01

    Linear thermal expansion measurements have been carried out from 6 to 340 K on a high-purity silicon sample using a linear absolute capacitance dilatometer. The accuracy of the measurements varies from +- 0.01 x 10 -8 K -1 at the lowest temperatures to +- 0.1 x 10 -8 K -1 or 0.1%, whichever is greater, near room temperature, and is sufficient to establish silicon as a thermal expansion standard for these temperatures. The agreement with previous data is satisfactory at low temperatures and excellent above room temperature where laser-interferometry data of comparable accuracy exist. Thermal expansions calculated from ultrasonic and heat-capacity data are preferred below 13 K where experimental problems occurred

  17. Metallic and semi-conducting resistivity behaviour of La0.7Ca0.3- x K x MnO3 ( x = 0.05, 0.1) manganites

    Science.gov (United States)

    Varshney, Dinesh; Dodiya, Neha

    2015-12-01

    The temperature dependence of electrical resistivity, ρ, of ceramic La0.7Ca0.3- x K x MnO3 ( x = 0.05, 0.1) is investigated in metallic and semi-conducting phase. The metallic resistivity is attributed to be caused by electron-phonon, electron-electron and electron-magnon scattering. Substitutions affect average mass and ionic radii of A-site resulting in an increase in Debye temperature θ D attributed to hardening of lattice with K doping. The optical phonon modes shift gradually to lower mode frequencies leading to phonon softening. Estimated resistivity compared with reported metallic resistivity, accordingly ρ diff. = [ ρ exp. - { ρ 0 + ρ e-ph (= ρ ac + ρ op)}], infers electron-electron and electron-magnon dependence over most of the temperature range. Semi-conducting nature is discussed with variable range hopping and small polaron conduction model. The decrease in activation energies and increase in density of states at the Fermi level with enhanced Ca doping is consistently explained by cationic disorder and Mn valence.

  18. Experimental (155 K) and predicted (151 K) Curie temperature (Tc) of K2ZnBr4: structural confirmation of ferroelectric state below Tc

    International Nuclear Information System (INIS)

    Abrahams, S.C.

    1994-01-01

    The temperature T c at which K 2 ZnBr 4 is predicted to transform from the paraelectric to the ferroelectric phase is 151 (19) K, based on the crystal structure determinations at 291 and 144 K by Fabry, Breczewski, Zuniga and Arnaiz and the Abrahams-Kurtz-Jamieson relationship. A dielectric and heat-capacity anomaly in this material at 155 K has been reported elsewhere. The locations reported for the ZnBr 2- 4 and K + ions fulfill the requirements of mirror plane symmetry above T c ; ionic displacements along the polar direction that approach but do not exceed 0.1 A and that violate the mirror symmetry on cooling through T c form the basis of the prediction and satisfy the structural criteria for ferroelectricity in the phase below the transition. (orig.)

  19. Measurement of time-dependent $C\\!P$-violating asymmetries in $B^0\\to\\pi^+\\pi^-$ and $B_s^0\\to K^+K^-$ decays at LHCb

    CERN Document Server

    The LHCb Collaboration

    2017-01-01

    The $C\\!P$-violating asymmetries in the decay and in the interference between mixing and decay in the $B^0\\to\\pi^+\\pi^-$ and $B_s^0\\to K^+K^-$ modes are measured using a data sample of $pp$ collisions corresponding to an integrated luminosity of 3 fb$^{-1}$, collected with the LHCb detector at centre-of-mass energies of 7 and 8 TeV. Flavour tagging is performed using only a subset of the current available taggers. The results are $C_{\\pi^+\\pi^-} = -0.24 \\pm 0.07 \\pm 0.01$, $S_{\\pi^+\\pi^-} = -0.68 \\pm 0.06 \\pm 0.01$, $C_{K^+K^-} = 0.24 \\pm 0.06 \\pm 0.02$, $S_{K^+K^-} = 0.22 \\pm 0.06 \\pm 0.02$, and $A_{K^+K^-}^{\\Delta\\Gamma} = -0.75 \\pm 0.07 \\pm 0.11$, where the first uncertainties are statistical and the second systematic.

  20. Edgar Savisaar : peaminister 08.05.1990-29.01.1992 / Edgar Savisaar ; interv. Jaak K. Roosaare

    Index Scriptorium Estoniae

    Savisaar, Edgar, 1950-

    2007-01-01

    Akadeemias Nord erikursuse raames esinenud ekspeaminister Edgar Savisaare poolt käsitletud põhiteemad: peaministriks saamise asjaolud, probleemid peaministriks olemise ajal, õnnestumised ja ebaõnnestumised, hinnang tolleaegsele valitsusele ja pressile, hinnang riigi senisele arengule

  1. Magnetic Properties and Magnetocaloric Effect in Layered NdMn1.9Ti0.1Si2

    Directory of Open Access Journals (Sweden)

    M.F. Md Din

    2014-04-01

    Full Text Available The structural and magnetic properties of the NdMn1.9Ti0.1Si2 compund have been studied by high-intensity x-ray and high-resolution neutron powder diffraction, specific heat, dc magnetization, and differential scanning calorimetry measurements over the temperature range of 3-450 K. The Curie temperature and Néel temperature of layered NdMn1.9Ti0.1Si2 are indicated as TC ~ 22 K and TN ~ 374 K respectively. The first order magnetic transition from antiferromagnetic [AFil-type] to ferromagnetic [F(Nd+Fmc] around TC is found in layered NdMn1.9Ti0.1Si2 and is associated with large magnetocaloric effect. This behavior has been confirmed as a contribution of the magnetostructural coupling by using neutron and x-ray powder diffraction. The magnetic entropy change –ΔSM ~ 15.3 J kg-1 K-1 and adiabatic temperature change ΔTad ~ 4.7 K have been determined using magnetization and specific heat measurement under 0-5 T applied fields. This compound exhibits almost no thermal and magnetic hysteresis, thus potentially applicable in low temperature region for magnetic refrigerator material

  2. Investigation on transition behavior and electrical properties of (K0.5Na0.51-xLixNb0.84Ta0.1Sb0.06O3 around polymorphic phase transition region

    Directory of Open Access Journals (Sweden)

    Chen Zhu

    2014-01-01

    Full Text Available (K0.5Na0.51-xLixNb0.84Ta0.1Sb0.06O3 (KNLNTS lead free ceramics with different Li concentration were fabricated by conventional solid-state reaction method. By increasing Li ions in KNLNTS, the grains grow up and the crystal structure changes from orthorhombic to tetragonal. When 0.03 ≤ x ≤ 0.05, the ceramics structure lays in PPT region. Polarization versus electric field (P-E hysteresis loops at room temperature show good ferroelectric properties and the remnant polarization decreases by increasing Li content while coercive electric keeps almost unchanged. In PPT region, taking x = 0.04 as an example, the sample shows excellent dielectric properties: the dielectric constant is 1159 and loss tangent is 0.04, while the piezoelectric constant d33 is 245 pC/N and kp is 0.44 at room temperature, it is promising for (K0.5Na0.51-xLixNb0.84Ta0.1Sb0.06O3 with 4 at. % Li to substitute PZT.

  3. 31 CFR Appendix K to Subpart C of... - Federal Law Enforcement Training Center

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Federal Law Enforcement Training Center K Appendix K to Subpart C of Part 1 Money and Finance: Treasury Office of the Secretary of the Treasury DISCLOSURE OF RECORDS Privacy Act Pt. 1, Subpt. C, App. K Appendix K to Subpart C of Part 1—Federal Law Enforcement Training Center 1. In...

  4. 31 CFR Appendix K to Subpart A of... - Federal Law Enforcement Training Center

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Federal Law Enforcement Training Center K Appendix K to Subpart A of Part 1 Money and Finance: Treasury Office of the Secretary of the Treasury DISCLOSURE OF RECORDS Freedom of Information Act Pt. 1, Subpt. A, App. K Appendix K to Subpart A of Part 1—Federal Law Enforcement Training...

  5. 5 CFR 551.216 - Law enforcement activities and 7(k) coverage for FLSA pay and exemption determinations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Law enforcement activities and 7(k... ACT Exemptions and Exclusions § 551.216 Law enforcement activities and 7(k) coverage for FLSA pay and... section 7(k) of the Act apply to certain categories of law enforcement employees based on appropriate...

  6. "Minulost je bitevním polem současníků". Konference k osmdesátinám Viléma Prečana

    Czech Academy of Sciences Publication Activity Database

    Hoppe, Jiří

    2013-01-01

    Roč. 20, 1/2 (2013), s. 236-241 ISSN 1210-7050. ["Minulost je bitevním polem současníků". Konference k osmdesátinám Viléma Prečana. Praha, 24.01.2013-25.01.2013] Institutional support: RVO:68378114 Keywords : Vilém Prečan Subject RIV: AB - History

  7. CLUSTER GLIMPSES WITH RAVEN: AO-CORRECTED NEAR AND MID-INFRARED IMAGES OF GLIMPSE C01 AND GLIMPSE C02

    Energy Technology Data Exchange (ETDEWEB)

    Davidge, T. J.; Andersen, D. R. [Dominion Astrophysical Observatory, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Lardière, O., E-mail: tim.davidge@nrc.ca, E-mail: david.andersen@nrc.ca, E-mail: lardiere@uvic.ca [Department of Mechanical Engineering, University of Victoria, Victoria, BC V8W 3P2 (Canada); and others

    2016-12-01

    We discuss images of the star clusters GLIMPSE C01 (GC01) and GLIMPSE C02 (GC02) that were recorded with the Subaru IRCS. Distortions in the wavefront were corrected with the RAVEN adaptive optics (AO) science demonstrator, allowing individual stars in the central regions of both clusters—where the fractional contamination from non-cluster objects is lowest—to be imaged. In addition to J , H , and K ′ images, both clusters were observed through a narrow-band filter centered near 3.05 μ m; GC01 was also observed through two other narrow-band filters that sample longer wavelengths. Stars in the narrow-band images have an FWHM that is close to the telescope diffraction limit, demonstrating that open-loop AO systems like RAVEN can deliver exceptional image quality. The near-infrared color–magnitude diagram of GC01 is smeared by non-uniform extinction with a 1 σ dispersion Δ A{sub K}  = ±0.13 mag. Spatial variations in A{sub K} are not related in a systematic way to location in the field. The Red Clump is identified in the K luminosity function (LF) of GC01, and a distance modulus of 13.6 is found. The K LF of GC01 is consistent with a system that is dominated by stars with an age >1 Gyr. As for GC02, the K LF is flat for K  > 16, and the absence of a sub-giant branch argues against an old age if the cluster is at a distance of ∼7 kpc. Archival SPITZER [3.6] and [4.5] images of the clusters are also examined, and the red giant branch-tip is identified. It is demonstrated in the Appendix that the [3.6] surface brightness profiles of both clusters can be traced out to radii of at least 100 arcsec.

  8. Synthesis, Magnetization, and Electrical Transport Properties of Mn3Zn0.9Cu0.1N

    Directory of Open Access Journals (Sweden)

    Y. Yin

    2013-01-01

    Full Text Available We synthesized Mn3Zn0.9Cu0.1N by solid state reaction, and magnetic as well as electrical transport properties were investigated. It is found that Mn3Zn0.9Cu0.1N exhibits a first-order antiferromagnetism (AFM to paramagnetic (PM transition with the Néel temperature TN ~163 K, and substitution of Cu for Zn would favor ferromagnetism (FM state and weaken AFM ground state, leading to a convex curvature character of M(T curve. With high external fields 10 kOe–50 kOe, magnetic transition remains a robust AFM-PM feature while FM phase is completely suppressed. Thermal hysteresis of M(T under 500 Oe is also suppressed when the magnetic field exceeds 10 kOe. Mn3Zn0.9Cu0.1N exhibits a good metallic behavior except for a slope change around TN, which is closely related to AFM-PM magnetic transition. Compared with the first differential of resistivity with respect to temperature for (dρ/dTMn3ZnN in transition temperature range, the absolute value of (dρ/dTMn3Zn0.9Cu0.1N is much lower which is close to zero.

  9. An inclusive study of the reaction anti NN → K01 + anything below 1.0 GeV/c

    International Nuclear Information System (INIS)

    Angelini, C.

    1975-01-01

    Some preliminary results are presented on an inclusive analysis of anti NN annihilations between 0. and 1.0 GeV/c incident anti p momentum. Inclusive K 0 1 distributions are considered and discussed in the framework of the thermodynamical model. (L.M.K.)

  10. 15 CFR Appendix A to Subpart K of... - Cordell Bank National Marine Sanctuary Boundary Coordinates

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Cordell Bank National Marine Sanctuary... OF COMMERCE OCEAN AND COASTAL RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS Cordell Bank National Marine Sanctuary Pt. 922, Subpt. K, App. A Appendix A to Subpart K of Part 922...

  11. Program NAJOCSC and space charge effect simulation in C01

    International Nuclear Information System (INIS)

    Tang, J.Y.; Chabert, A.; Baron, E.

    1999-01-01

    During the beam tests of the THI project at GANIL, it was found it difficult to increase the beam power above 2 kW at CSS2 extraction. The space charge effect (abbreviated as S.C. effect) in cyclotrons is suspected to play some role in the phenomenon, especially the longitudinal S.C. one and also the coupling between longitudinal and radial motions. The injector cyclotron C01 is studied, and the role played by the S.C. effect in this cyclotron in the THI case is investigated by a simulation method. (K.A.)

  12. Status report of the three phase 25 kA, 1.5 kW thermally switched superconducting rectifier, transformer and switches

    NARCIS (Netherlands)

    ten Kate, Herman H.J.; Holtslag, A.H.M.; Knoben, J.; Steffens, H.A.; van de Klundert, L.J.M.

    1983-01-01

    A 25 kA, 1.5 kW superconducting rectifier system has been developed. This rectifier system working like an a.c.-d.c, converter with a primary current of 35 A at 0.1Hz, will energize a 25 kA coil with an average power of 5.4 MJ/hr and a proposed energy efficiency of at least 96%. Such a highly

  13. Optically isolated, 2 kHz repetition rate, 4 kV solid-state pulse trigger generator.

    Science.gov (United States)

    Barnett, D H; Parson, J M; Lynn, C F; Kelly, P M; Taylor, M; Calico, S; Scott, M C; Dickens, J C; Neuber, A A; Mankowski, J J

    2015-03-01

    This paper presents the design and operation characteristics of a solid-state high voltage pulse generator. Its primary utilization is aimed at triggering a gaseous spark gap with high repeatability. Specifically, the trigger generator is designed to achieve a risetime on the order of 0.1 kV/ns to trigger the first stage, trigatron spark gap of a 10-stage, 500 kV Marx generator. The major design components are comprised of a 60 W constant current DC-DC converter for high voltage charging, a single 4 kV thyristor, a step-up pulse transformer, and magnetic switch for pulse steepening. A risetime of <30 ns and pulse magnitude of 4 kV is achieved matching the simulated performance of the design.

  14. Scholarly productivity and professional advancement of junior researchers receiving KL2, K23, or K08 awards at a large public research institution.

    Science.gov (United States)

    Amory, John K; Louden, Diana K N; McKinney, Christy; Rich, Joanne; Long-Genovese, Stacy; Disis, Mary L

    2017-04-01

    How the productivity and careers of KL2 scholars compare with scholars receiving individual K-awards is unknown. The productivity of KL2 scholars (n=21) at our institution was compared with that of K08 (n=34) and K23 (n=26) scholars. KL2 and K23 scholars had greater productivity than K08 scholars ( p =0.01). Professional advancement was similar among groups. At our institution, scholarly productivity and professional advancement did not differ by type of K-award.

  15. Volumetric properties of binary liquid-phase mixture of (water + glycerol) at temperatures of (278.15 to 323.15) K and pressures of (0.1 to 100) MPa

    International Nuclear Information System (INIS)

    Egorov, Gennadiy I.; Makarov, Dmitriy M.

    2014-01-01

    Highlights: • Coefficients of compressibility of liquid binary mixture (water + glycerol) were measured. • Partial molar volumes of the components and excess molar volumes of the mixture were calculated. • Molar isothermal compression, molar isobaric expansion and molar isochoric elasticity of the mixture were evaluated. • Analysis of volume characteristics confirms glycerol hydrophilic nature. - Abstract: The coefficients of compressibility, k = ΔV/V o , of liquid binary mixture of {water (1) + glycerol (2)} were measured over the whole composition range at pressures from (0.1 to 100) MPa and temperatures from (278.15 to 323.15) K. Excess molar volumes of the mixture, V m E , partial molar volumes of the mixture components, V ¯ i , as well as their limiting values, molar isothermal compression K T,m , molar isobaric expansion E P,m , molar isochoric elasticity (isochoric coefficient of thermal pressure) β m were calculated. It was revealed that with glycerol molar fraction increasing the coefficients of compressibility, k, decreased to x 2 ≈ 0.3 ÷ 0.4 (where x 2 was glycerol molar fraction), and further changed insignificantly. It was shown that all isobars of excess molar volumes were negative and their absolute values, V m E , decreased on temperature and pressure rising. No extremes were observed on concentration dependences of partial molar volumes of glycerol in the mixture at its low concentrations. Under the state parameters studied limiting partial volumes of water and glycerol decrease with pressure rising but increase with temperature growth. Dependences of molar isothermal compression and molar isochoric elasticity on glycerol molar fraction passed extremes, and similar dependences of molar isobaric expansion had the temperature inversion regions

  16. WE-H-202-01: Memorial Introduction

    International Nuclear Information System (INIS)

    Kirby, N.

    2016-01-01

    Deformable image registration has now been commercially available for several years, with solid performance in a number of sites and for several applications including contour and dose mapping. However, more complex applications have arisen, such as assessing response to radiation therapy over time, registering images pre- and post-surgery, and auto-segmentation from atlases. These applications require innovative registration algorithms to achieve accurate alignment. The goal of this session is to highlight emerging registration technology and these new applications. The state of the art in image registration will be presented from an engineering perspective. Translational clinical applications will also be discussed to tie these new registration approaches together with imaging and radiation therapy applications in specific diseases such as cervical and lung cancers. Learning Objectives: To understand developing techniques and algorithms in deformable image registration that are likely to translate into clinical tools in the near future. To understand emerging imaging and radiation therapy clinical applications that require such new registration algorithms. Research supported in part by the National Institutes of Health under award numbers P01CA059827, R01CA166119, and R01CA166703. Disclosures: Phillips Medical systems (Hugo), Roger Koch (Christensen) support, Varian Medical Systems (Brock), licensing agreements from Raysearch (Brock) and Varian (Hugo).; K. Brock, Licensing Agreement - RaySearch Laboratories. Research Funding - Varian Medical Systems; G. Hugo, Research grant from National Institutes of Health, award number R01CA166119.; G. Christensen, Research support from NIH grants CA166119 and CA166703 and a gift from Roger Koch. There are no conflicts of interest.

  17. WE-H-202-01: Memorial Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Kirby, N. [University of Texas HSC SA (United States)

    2016-06-15

    Deformable image registration has now been commercially available for several years, with solid performance in a number of sites and for several applications including contour and dose mapping. However, more complex applications have arisen, such as assessing response to radiation therapy over time, registering images pre- and post-surgery, and auto-segmentation from atlases. These applications require innovative registration algorithms to achieve accurate alignment. The goal of this session is to highlight emerging registration technology and these new applications. The state of the art in image registration will be presented from an engineering perspective. Translational clinical applications will also be discussed to tie these new registration approaches together with imaging and radiation therapy applications in specific diseases such as cervical and lung cancers. Learning Objectives: To understand developing techniques and algorithms in deformable image registration that are likely to translate into clinical tools in the near future. To understand emerging imaging and radiation therapy clinical applications that require such new registration algorithms. Research supported in part by the National Institutes of Health under award numbers P01CA059827, R01CA166119, and R01CA166703. Disclosures: Phillips Medical systems (Hugo), Roger Koch (Christensen) support, Varian Medical Systems (Brock), licensing agreements from Raysearch (Brock) and Varian (Hugo).; K. Brock, Licensing Agreement - RaySearch Laboratories. Research Funding - Varian Medical Systems; G. Hugo, Research grant from National Institutes of Health, award number R01CA166119.; G. Christensen, Research support from NIH grants CA166119 and CA166703 and a gift from Roger Koch. There are no conflicts of interest.

  18. 26 CFR 1.401(k)-5 - Special rules for mergers, acquisitions and similar events. [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Special rules for mergers, acquisitions and similar events. [Reserved] 1.401(k)-5 Section 1.401(k)-5 Internal Revenue INTERNAL REVENUE SERVICE... Bonus Plans, Etc. § 1.401(k)-5 Special rules for mergers, acquisitions and similar events. [Reserved] [T...

  19. 40 CFR 180.1120 - Streptomyces sp. strain K61; exemption from the requirement of a tolerance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Streptomyces sp. strain K61; exemption... FOOD Exemptions From Tolerances § 180.1120 Streptomyces sp. strain K61; exemption from the requirement of a tolerance. The biological pesticide Streptomyces sp. strain K61 is exempted from the requirement...

  20. Effective lifetime measurements in the B{sub s}{sup 0}→K{sup +}K{sup −}, B{sup 0}→K{sup +}π{sup −} and B{sub s}{sup 0}→π{sup +}K{sup −} decays

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); An, L. [Center for High Energy Physics, Tsinghua University, Beijing (China); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andreotti, M. [Sezione INFN di Ferrara, Ferrara (Italy); and others

    2014-09-07

    Measurements of the effective lifetimes in the B{sub s}{sup 0}→K{sup +}K{sup −}, B{sup 0}→K{sup +}π{sup −} and B{sub s}{sup 0}→π{sup +}K{sup −} decays are presented using 1.0 fb{sup −1} of pp collision data collected at a centre-of-mass energy of 7 TeV by the LHCb experiment. The analysis uses a data-driven approach to correct for the decay time acceptance. The measured effective lifetimes are τ{sub B{sub s{sup 0}→K{sup +}K{sup −}}}=1.407±0.016(stat)±0.007(syst) ps, τ{sub B{sup 0}→K{sup +}π{sup −}}=1.524±0.011(stat)±0.004(syst) ps, τ{sub B{sub s{sup 0}→π{sup +}K{sup −}}}=1.60±0.06(stat)±0.01(syst) ps. This is the most precise determination to date of the effective lifetime in the B{sub s}{sup 0}→K{sup +}K{sup −} decay and provides constraints on contributions from physics beyond the Standard Model to the B{sub s}{sup 0} mixing phase and the width difference ΔΓ{sub s}.

  1. Rate constants for the reaction of CF3O radicals with hydrocarbons at 298 K

    DEFF Research Database (Denmark)

    Kelly, C.; Treacy, J.; Sidebottom, H.W.

    1993-01-01

    Rate constant ratios of the reactions of CF3O radicals with a number of hydrocarbons have been determined at 298 +/- 2 K and atmospheric pressure using a relative rate method. Using a previously determined value k(CF30 + C2H6) = 1.2 x 10(-12) cm3 molecule-1 s-1 these rate constant ratios provide...... estimates of the rate constants: k(CF3O + CH4) = (1.2 +/- 0.1) x 10(-14), k(CF3O + c-C3H6) = (3.6 +/- 0.2) x 10(-13), k(CF3O + C3H8) = (4.7 +/- 0.7) x 10(-12), k(CF3O + (CH3)3CH) = (7.2 +/- 0.5) x 10(-12), k(CF3O + C2H4) = (3.0 +/- 0.1) x 10(-11) and k(CF3O + C6H6) = (3.6 +/- 0.1) x 10(-11) cm3 molecule-1 s......-1. The importance of the reactions of CF3O radicals with hydrocarbons under atmospheric conditions is discussed....

  2. Structural Transition and Electrical Properties of (1 - x)(Na0.4K0.1Bi0.5)TiO3- xSrTiO3 Lead-Free Piezoceramics

    Science.gov (United States)

    Liu, Xing; Zhai, Jiwei; Shen, Bo; Li, Feng; Li, Peng

    2017-10-01

    (1 - x)(Na0.4K0.1Bi0.5)TiO3- xSrTiO3 (NKBT- xST) ceramics with x = 0 mol.%, 3 mol.%, and 5 mol.% (0ST, 3ST, and 5ST) have been prepared by a conventional solid-state reaction method and their ferroelectric, electrostrictive, and pyroelectric properties investigated. Addition of ST considerably disrupted the long-range ferroelectric order of NKBT- xST ceramics, and the 5ST ceramic exhibited ergodic relaxor phase structure. T FR shifted to near or below room temperature for 5ST ceramic, accompanied by a significant decline of ferroelectricity and enhanced strain. As the temperature approached T FR, the NKBT- xST ceramics exhibited predominantly electrostrictive effect, and the 5ST ceramic presented relatively high electrostrictive coefficient Q 33 of 0.0193 m4/C2. High pyroelectric response was observed for 0ST, 3ST, and 5ST ceramics in the vicinity of T FR due to the large polarization release during the ferroelectric-relaxor structural transition. The 5ST ceramic exhibited high and frequency-insensitive (100 Hz to 10 kHz) room-temperature pyroelectric properties with pyroelectric coefficient p of 656 μC m-2 K-1 and figures of merit F i, F v, and F d reaching 233 pm/V, 0.013 m2/C, and 7.61 μPa-1/2, respectively, indicating that 5ST ceramic is a promising candidate to replace PZT-based ceramics.

  3. Hierarchy and scaling behavior of multi-rank domain patterns in ferroelectric K0.9Na0.1NbO3 strained films

    Science.gov (United States)

    Braun, Dorothee; Schmidbauer, Martin; Hanke, Michael; Schwarzkopf, Jutta

    2018-01-01

    The formation process of a ferroelectric multi-rank domain pattern in the thickness range of 7-52 nm is investigated for monoclinic K0.9Na0.1NbO3 strained epitaxial films on (110) NdScO3 substrates. Although the elastic strain energy density is degenerated for two pseudocubic orientations, a distinctive hierarchy of domain evolution is observed with exclusive in-plane a1a2 domains for very thin films and the retarded onset of a ferroelectric MC phase at larger film thickness. This is accompanied by a thickness dependent transformation from stripe domains to a herringbone pattern and, eventually, for the thickest film, to a checkerboard-like structure. These transformations in the domain arrangement and width are correlated to energetic aspects as depolarization field and anisotropic strain relaxation in the film. While for the MC domains plastic strain relaxation is throughout observed, the a1a2 domains show a two-step strain relaxation mechanism starting with an in-plane elastic shearing, which is followed by plastic lattice relaxation. Our results highlight a pathway for engineering and patterning of periodic ferroelectric domain structures.

  4. Irradiation-induced displacement of Ag atoms from lattice sites in an Al-0.2% Mg-0.1% Ag crystal

    International Nuclear Information System (INIS)

    Swanson, M.L.; Howe, L.M.; Quenneville, A.F.

    1976-01-01

    In irradiated alloys of Al containing approximately 0.1 at% Ag, the backscattering - channelling method shows that Al-Ag dumbells are created by the trapping of Al interstitial atoms at Ag solute atoms. The present results demonstrate that the addition of 0.2 at% Mg to such irradiated alloys retards not only the formation of Al-Ag dumbells during annealing from 30 to 100 K but also their annihilation during annealing from 180 to 240 K. Al interstitials are released from Mg traps at 100 to 160 K, causing further trapping at Ag atoms. Approximately 70% of the Ag atoms return to lattice sites at approximately 200 K (stage III) (compared with 100% in the Al-0.1% Ag alloys) and the remainder return to lattice sites at approximately 260 K. These results favour migration of Al-Ag dumbells rather than vacancies during stage III annealing. (author)

  5. k0 and comparator NAA. Influences and interactions

    International Nuclear Information System (INIS)

    De Corte, F.

    2000-01-01

    A discussion is held on mutual influences and interactions between k 0 - and (relative) comparator-type NAA. Examples are given concerning: (1) the application of comparator-type NAA in the quality control/quality assurance of the IRMM-530 Al-0.1%Au neutron flux monitor developed for use in k 0 -NAA, (2) the utilization of the k 0 -method of calibration as a tool for the quality assurance of comparator-type NAA (3) the introduction of corrections for detection efficiency and true-coincidence (of primordial importance in k 0 -NAA) in comparator-type NAA, (4) the development of k 0 -type standardization for use in prompt gamma neutron activation analysis, and (5) the renewal of insights in the traceability of k 0 - and comparator-type NAA. (author)

  6. Cross Sections for the Reactions e+e to K+ K- pi+pi-, K+ K- pi0pi0, and K+ K- K+ K- Measured Using Initial-State Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Prencipe, E.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Trieste /Trieste U.; Milanes, D.A.; /INFN, Trieste /Trieste U.; Palano, A.; /INFN, Trieste /Trieste U.; Pappagallo, M.; /INFN, Trieste /Trieste U. /INFN, Bari /Bari U. /Bari U. /INFN, Bari; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; Osipenkov, I.L.; /LBL, Berkeley /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Trieste /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Ferrara /Ferrara U. /Frascati /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Genoa /Genoa U. /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U., Comp. Sci. Dept. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Trieste /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Perugia /Perugia U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Pisa /Princeton U. /INFN, Trieste /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /INFN, Trieste /INFN, Trieste /INFN, Rome /Rome U. /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas U. /Texas U., Dallas /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /INFN, Trieste /Trieste U. /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2011-08-19

    We study the processes e{sup +}e{sup -} {yields} K{sup +}K{sup -}{pi}{sup +}{pi}-{gamma}, K{sup +}K{sup -}{pi}{sup 0}{pi}{sup 0}{gamma}, and K{sup +}K{sup -}K{sup +}K{sup -}{gamma}, where the photon is radiated from the initial state. About 84000, 8000, and 4200 fully reconstructed events, respectively, are selected from 454 fb{sup -1} of BABAR data. The invariant mass of the hadronic final state defines the e{sup +}e{sup -} center-of-mass energy, so that the K{sup +}K{sup -}{pi}{sup +}{pi}{sup -}{gamma} data can be compared with direct measurements of the e{sup +}e{sup -} {yields} K{sup +}K{sup -}{pi}{sup +}{pi}{sup -} reaction. No direct measurements exist for the e{sup +}e{sup -} {yields} K{sup +}K{sup -}{pi}{sup 0}{pi}{sup 0} or e{sup +}e{sup -} {yields} K{sup +}K{sup -}K{sup +}K{sup -} reactions, and we present an update of our previous result with doubled statistics. Studying the structure of these events, we find contributions from a number of intermediate states, and extract their cross sections. In particular, we perform a more detailed study of the e{sup +}e{sup -} {yields} {phi}(1020){pi}{pi}{gamma} reaction, and confirm the presence of the Y (2175) resonance in the {phi}(1020)f{sub 0}(980) and K{sup +}K{sup -} f{sub 0}(980) modes. In the charmonium region, we observe the J/{psi} in all three final states and in several intermediate states, as well as the {phi}(2S) in some modes, and measure the corresponding branching fractions.

  7. Impedance and modulus spectroscopy characterization of Tb modified Bi{sub 0.8}A{sub 0.1}Pb{sub 0.1}Fe{sub 0.9}Ti{sub 0.1}O{sub 3} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Thakur, Shweta; Rai, Radheshyam, E-mail: rshyam1273@gmail.com [School of Physics, Shoolini University, Himachal Pradesh (India); Bdikin, Igor [Centre for Mechanical Technology and Automation (TEMA), University of Aveiro (Portugal); Valente, Manuel Almeida [Departamento de Fisica, Universidade de Aveiro (Portugal)

    2016-01-15

    In this paper we present the impedance spectroscopy of ternary solid solutions of BiFeO{sub 3} , TbFeO{sub 3} and PbTiO{sub 3} , prepared by solid-state reaction method. The preliminary structural studies were carried out by X-ray diffraction technique, showing the formation of polycrystalline sample with ABO{sub 3} type of perovskite structure with hexagonal symmetry for Bi{sub 0.8}Tb{sub 0.1}Pb{sub 0.1}Fe{sub 0.9}Ti{sub 0.1}O{sub 3} system at room temperature. Dielectric and impedance study of this ceramic has been characterized in the temperature range 175 - 325 deg C and frequency range 100 Hz - 1 MHz. The maximum ferroelectric transition temperature (T{sub c} ) of this system was in the range 210 - 225 deg C with the dielectric constant having maximum value ∼ 2480 at 1 kHz. The complex impedance graph exhibited one impedance semicircle arc at all reported temperatures, which indicates that the impedance response is a Cole-Cole type relaxation. Single semicircle indicate that the grain effect of the bulk in ceramic. The bulk resistance of the material decreases with increasing temperature showing negative temperature showing a typical semiconducting property, i.e. negative temperature coefficient of resistance (NTCR) behavior. (author)

  8. K0 production in one-prong τ decays

    Science.gov (United States)

    Buskulic, D.; Casper, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Odier, P.; Pietrzyk, B.; Ariztizabal, F.; Chmeissani, M.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Martinez, M.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Teubert, F.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgiopoulos, C.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe-Altarelli, M.; Salomone, S.; Colrain, P.; Have, I. Ten; Knowles, I. G.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Becker, U.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Putzer, A.; Rensch, B.; Schmidt, M.; Stenzel, H.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Konstantinidis, N.; Moutoussi, A.; Nash, J.; Payne, D. G.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Kroha, H.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Park, H.-J.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Martin, E. B.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edwards, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Beddall, A.; Booth, C. N.; Cartwright, S.; Combley, F.; Dawson, I.; Koksal, A.; Rankin, C.; Thompson, L. F.; Böhler, A.; Brandt, S.; Cowan, G.; Feigl, E.; Grupen, C.; Lutters, G.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Hu, H.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.; Aleph Collaboration

    1994-07-01

    From a sample of about 75000 τ decays identified with the ALEPH detector, K0 production in 1-prong hadronic decays is investigated by tagging the KL0 component in a hadronic calorimeter. Results are given for the final states ντh-K0 and ντh-π0K0 where the h- is separated into π and K contributions by means of the dE/ dx measurement in in the central detector. The resulting branching ratios are: ( Bτ → ντπ-K0) = (0.88±0.14±0.09)%, ( Bτ → ντK-K0) = (0.29±0.12±0.03)%, ( Bτ → ντπ-π0K0) = (0.33±0.14±0.07)% aand ( Bτ → ντK-π0K0) = (0.05±0.05±0.01)%. The K ∗ decay rate in the K0π channel agrees with that in the Kπ0 mode: the combined value for the branching ratio is (Bτ → ν τK ∗-) = (1.45±0.13±0.11)% .

  9. Measurement of the time-integrated CP asymmetry in $D^0 \\to K_S^0 K_S^0$ decays with LHCb

    CERN Multimedia

    Tuci, Giulia

    2018-01-01

    CP violation in charm has not yet been observed, although measurements of time-integrated CP asymmetries in $D^0 \\to K^+K^-$ and $D^0 \\to \\pi^+\\pi^- decays$ have reached a remarkable precision, O(0.1%). The $D^0 \\to K_S^0 K_S^0$ decay is a promising discovery channel for CP violation in charm. A prediction based on Standard Model gives an upper limit for the CP asymmetry of 1.1% (C.L. 95%). Further enhancements could result from contributions from physics beyond the Standard Model. We present a measurement of the time-integrated CP asymmetry in prompt $D^0 \\to K_S^0 K_S^0$ decays, performed using data collected with LHCb experiment in 2015 and 2016 at a 13 TeV pp center-of-mass energy (Run-2). This result improves the sensitivity obtained by LHCb in Run-1.

  10. Study of $B_{\\scriptscriptstyle (s)}^0 \\to K_{\\rm \\scriptscriptstyle S}^0 h^{+} h^{\\prime -}$ decays with first observation of $B_{\\scriptscriptstyle s}^0 \\to K_{\\rm \\scriptscriptstyle S}^0 K^{\\pm} \\pi^{\\mp}$ and $B_{\\scriptscriptstyle s}^0 \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^{+} \\pi^{-}$

    CERN Document Server

    INSPIRE-00258707; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Cowie, E; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    A search for charmless three-body decays of $B^0$ and $B_{\\scriptscriptstyle s}^0$ mesons with a $K_{\\rm \\scriptscriptstyle S}^0$ meson in the final state is performed using the $pp$ collision data, corresponding to an integrated luminosity of $1.0\\mathrm{\\,fb}^{-1}$, collected at a centre-of-mass energy of $7\\mathrm{\\,Te\\kern -0.1em V}$ recorded by the LHCb experiment. Branching fractions of the $B_{\\scriptscriptstyle (s)}^0 \\to K_{\\rm \\scriptscriptstyle S}^0 h^{+} h^{\\prime -}$ decay modes ($h^{(\\prime)} = \\pi, K$), relative to the well measured $B^0 \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^{+} \\pi^{-}$ decay, are obtained. First observation of the decay modes $B_s^0 \\to K_{\\rm \\scriptscriptstyle S}^0 K^{\\pm} \\pi^{\\mp}$ and $B_s^0 \\to K_{\\rm \\scriptscriptstyle S}^0 \\pi^{+} \\pi^{-}$ and confirmation of the decay $B^0 \\to K_{\\rm \\scriptscriptstyle S}^0 K^{\\pm} \\pi^{\\mp}$ are reported. The following relative branching fraction measurements or limits are obtained \\begin{eqnarray*} \

  11. Ageing effects on swelling behaviour of compacted GMZ01 bentonite

    Energy Technology Data Exchange (ETDEWEB)

    Ye, W.M., E-mail: ye_tju@tongji.edu.cn [Key Laboratory of Geotechnical and Underground Engineering of Ministry of Education, Tongji University, Shanghai 200092 (China); United Research Center for Urban Environment and Sustainable Development, the Ministry of Education, China, Shanghai 200092 (China); Lai, X.L.; Liu, Y. [Key Laboratory of Geotechnical and Underground Engineering of Ministry of Education, Tongji University, Shanghai 200092 (China); Chen, Y.G. [Key Laboratory of Geotechnical and Underground Engineering of Ministry of Education, Tongji University, Shanghai 200092 (China); United Research Center for Urban Environment and Sustainable Development, the Ministry of Education, China, Shanghai 200092 (China); Cui, Y.J. [Key Laboratory of Geotechnical and Underground Engineering of Ministry of Education, Tongji University, Shanghai 200092 (China); Ecole des Ponts Paris Tech, UR Navier/CERMES (France)

    2013-12-15

    Highlights: • Ageing effects on compacted GMZ01 bentonite are investigated. • Swelling property decreases with ageing and influenced by initial conditions. • Ageing effects are mainly attributed to the bonding effects and the hydration of smectites. - Abstract: Ageing effects on the swelling properties of compacted GMZ01 bentonite are investigated in this paper. Samples were compacted to prescribed dry densities and water contents and kept for ageing under constant volume and K{sub 0} confined conditions for target days of 0, 1, 7, 15, 30 and 90. Then, swelling deformation and swelling pressure tests were performed on the aged samples. Results indicate that both the swelling deformation and swelling pressure decrease with ageing time, with a more significant decrease at the first few days of ageing. Ageing effects are more pronounced for samples with large dry density and high water content. At the same initial dry density and water content, samples aged under constant volume conditions show much smaller decrease of swelling pressure compared to that of samples aged under K{sub 0} confined conditions. The decrease of swelling potential of samples with ageing days is mainly attributed to the bonding effects and the internal redistribution of water within the bentonite, which was confirmed by the changes of microstructure of samples with ageing.

  12. Malé osobnosti veľkých dejín – veľké osobnosti malých dejín IV. Príspevky k hudobnej regionalistike, Slovenské národné múzeum – Hudobné múzeum, Brämerova kúria, Bratislava 30. listopadu – 1. prosince 2017

    Czech Academy of Sciences Publication Activity Database

    Kachlík, Jan

    2018-01-01

    Roč. 55, č. 1 (2018), s. 102-104 ISSN 0018-7003. [Malé osobnosti veľkých dejín – veľké osobnosti malých dejín IV. Príspevky k hudobnej regionalistike. Bratislava, 30.11.2017-01.12.2017] Institutional support: RVO:68378076 Keywords : music ology * conference Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Performing arts studies ( Music ology, Theater science, Dramaturgy)

  13. Thermal design of a metal hydride storage bed, permitting tritium accountancy to 0.1% resolution and repeatability

    International Nuclear Information System (INIS)

    Hemmerich, J.L.

    1995-01-01

    Tritium storage beds at the International Thermonuclear Experimental Reactor are likely to use uranium as a getter material with a total inventory of 150 g T 2 at 75% stoichiometric composition of UT 3 . We propose a storage bed design directly extrapolated from the Joint European Torus uranium beds, which already have a 238 U inventory of 4.284 kg. Three alternative approaches to implement calorimetry for in situ tritium inventory accounting are discussed. The favored solution uses a microporous thermal insulation operating in a hydrogen atmosphere. This design is shown to meet all operational and safety requirements. The accuracy of calorimetric assay to ±0.1 requires only the measurement of a temperature difference to ±0.1 K and stabilization of the ambient reference temperature of 300 to ±0.1 K. 9 refs., 2 figs

  14. Thermal equation of state of (Mg 0.9Fe 0.1) 2SiO 4 olivine

    Science.gov (United States)

    Liu, Wei; Li, Baosheng

    2006-08-01

    In situ synchrotron X-ray diffraction measurements have been carried out on San Carlos olivine (Mg 0.9Fe 0.1) 2SiO 4 up to 8 GPa and 1073 K. Data analysis using the high-temperature Birch-Murnaghan (HTBM) equation of state (EoS) yields the temperature derivative of the bulk modulus (∂ KT/∂ T) P = -0.019 ± 0.002 GPa K -1. The thermal pressure (TH) approach gives αKT = 4.08 ± 0.10 × 10 -3 GPa K -1, from which (∂ KT/∂ T) P = -0.019 ± 0.001 GPa K -1 is derived. Fitting the present data to the Mie-Grüneisen-Debye (MGD) formalism, the Grüneisen parameter at ambient conditions γ0 is constrained to be 1.14 ± 0.02 with fixed volume dependence q = 1. Combining the present data with previous results on iron-bearing olivine and fitting to MGD EoS, we obtain γ0 = 1.11 ± 0.01 and q = 0.54 ± 0.36. In this study the thermoelastic parameters obtained from various approaches are in good agreement with one another and previous results.

  15. Relative K-electron capture probabilities in the decay of 99Rh

    International Nuclear Information System (INIS)

    Mishra, N.R.; Chandrasekhar Rao, M.V.S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

    2000-01-01

    The relative K-electron capture probabilities (P K ) to the 1383.23, 896.98, 618.09, 442.78 and 322.43 keV levels in 99 Ru in the decay of 99 Rh are measured employing the X-γ internal sum-coincidence technique. The measured values P K 1383.23=0.851±0.066, P K 896.98=0.834±0.061, P K 618.09=0.870±0.01, P K 442.78=0.882±0.035 and P K 322.43=0.852±0.061 are found to be in good agreement with the theoretical values. The dependence of P K on EC transition energy is discussed. (author)

  16. New possibilities for efficient laser surface treatment by diode-pumped kW-class lasers

    Czech Academy of Sciences Publication Activity Database

    Brajer, Jan; Švábek, Roman; Rostohar, Danijela; Divoký, Martin; Lucianetti, Antonio; Mocek, Tomáš; Madl, J.; Pitrmuc, Z.

    2015-01-01

    Roč. 2015, Aug (2015), s. 1-3 ISSN 1823-3430 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : amplifier Subject RIV: BH - Optics, Masers, Lasers

  17. Identification and quantitation of vitamins K1 and K3 in cosmetic products for facial skin protection.

    Science.gov (United States)

    De Orsi, D; Giannini, G; Gagliardi, L; Carpani, I; Tonelli, D

    2008-01-01

    A simple and rapid analytical method was developed for the determination of vitamins K1 and K3 in facial anti-rash creams. The procedure is based on an ultrasonic extraction of the cosmetic sample with dimethylacetamide, in the presence of an internal standard, followed by HPLC separation. HPLC was performed using a C18 column and spectrophotometric detection at 333 nm. A linear gradient elution was carried out starting with 50% acetonitrile-methanol (75:25 v/v) and water up to 100% acetonitrile-methanol for 5 min. Linearity was established over the concentration range from 0.2 to 1.0 mg/ml for vitamin K1 and from 0.02 to 0.1 mg/ml for vitamin K3, with LOD values of 100 ng and 20 ng injected, respectively. The accuracy was verified by spiking experiments on model cosmetic samples. The proposed method has been successfully applied for the analysis of commercial samples of creams.

  18. Branching fraction and CP asymmetry of the decays B{sup +}→K{sub S}{sup 0}π{sup +} and B{sup +}→K{sub S}{sup 0}K{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Université, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andrews, J.E. [University of Maryland, College Park, MD (United States); and others

    2013-11-04

    An analysis of B{sup +}→K{sub S}{sup 0}π{sup +} and B{sup +}→K{sub S}{sup 0}K{sup +} decays is performed with the LHCb experiment. The pp collision data used correspond to integrated luminosities of 1 fb{sup −1} and 2 fb{sup −1} collected at centre-of-mass energies of √(s)=7 TeV and √(s)=8 TeV, respectively. The ratio of branching fractions and the direct CP asymmetries are measured to be B(B{sup +}→K{sub S}{sup 0}K{sup +})/B(B{sup +}→K{sub S}{sup 0}π{sup +})=0.064±0.009 (stat.)±0.004 (syst.), A{sup CP}(B{sup +}→K{sub S}{sup 0}π{sup +})=−0.022±0.025 (stat.)±0.010 (syst.) and A{sup CP}(B{sup +}→K{sub S}{sup 0}K{sup +})=−0.21±0.14 (stat.)±0.01 (syst.). The data sample taken at √(s)=7 TeV is used to search for B{sub c}{sup +}→K{sub S}{sup 0}K{sup +} decays and results in the upper limit (f{sub c}⋅B(B{sub c}{sup +}→K{sub S}{sup 0}K{sup +}))/(f{sub u}⋅B(B{sup +}→K{sub S}{sup 0}π{sup +}))<5.8×10{sup −2} at 90% confidence level, where f{sub c} and f{sub u} denote the hadronisation fractions of a b{sup ¯} quark into a B{sub c}{sup +} or a B{sup +} meson, respectively.

  19. Outfall K-018 TRC investigation

    International Nuclear Information System (INIS)

    Skiff, D.P.

    1994-01-01

    During 1993, 7 different samples taken at Reactor Outfall K-018 for Total Residual Chlorine exceeded the permitted requirement for the outfall of < 0.1 mg/L. Following the second exceedance, a Mitigation Action Plan was issued to investigate and identify the cause of the exceedances. The following potential causes were identified: (1) unauthorized/unknown operational discharge; (2) upstream industrial discharge to the Savannah River prior to SRS usage; (3) sanitary waste treatment plant discharge; (4) sampling methodology; (5) naturally occurring river water interference. Of these possibilities, it was determined that naturally occurring river water interference was the most likely cause and an in-depth sampling program, outlined in a Program Action Plan, was initiated to complete the investigation. The investigation determined that oxidized manganese present in the river water prior to usage within K-Area causes a false high reading for Total Residual Chlorine. It is this presence of the manganese interference, not operational discharge, that caused the exceedances at Outfall K-018

  20. 26 CFR 1.168(k)-1 - Additional first year depreciation deduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Additional first year depreciation deduction. 1... Corporations § 1.168(k)-1 Additional first year depreciation deduction. (a) Scope and definitions—(1) Scope. This section provides the rules for determining the 30-percent additional first year depreciation...

  1. Specific heat measurements of TiB2 and 6LiF from 0.5 to 30 K

    International Nuclear Information System (INIS)

    Lang, Brian E.; Donaldson, Marcus H.; Woodfield, Brian F.; Burger, Arnold; Roy, Utupal N.; Lamberti, Vincent; Bell, Zane W.

    2005-01-01

    The specific heats of TiB 2 and 6 LiF have been measured from 0.5 to 30 K as part of a larger project in the construction of a neutron spectrometer. For this application, the measured specific heats were used to extrapolate the specific heats down to 0.1 K with lattice, electronic, and Schottky equations for the respective samples. The resultant specific heat values at 0.1 K for TiB 2 and 6 LiF are 4.08 x 10 -4 ± 0.27 x 10 -4 J/K/mol and 9.19 x 10 -9 ± 0.15 x 10 -9 J/K/mol, respectively

  2. The ratio Φ→K+K-/K0 anti K0

    International Nuclear Information System (INIS)

    Bramon, A.; Lucio, M.J.L.

    2000-01-01

    The ratio Φ→K + K - /K 0 K 0 is discussed and its present experimental value is compared with theoretical expectations. A difference larger than two standard deviations is observed. It is critically examined a number of mechanisms that could account for this discrepancy, which remains unexplained. Measurements at DAΦNE at the level of the per mille accuracy can clarify whether there exist any anomaly

  3. Multilayer Ceramic Regenerator Materials for 4 K Cooling

    International Nuclear Information System (INIS)

    Numazawa, T.; Kamiya, K.; Satoh, T.; Nozawa, H.; Yanagitani, T.

    2006-01-01

    The ceramics oxide magnetic materials have shown excellent properties for use as regenerator materials used in 4 K crycoolers. Currently four kinds of oxide magnetic materials GdVO4, GAP=GdAlO3, GOS=Gd2O2S and Tb2O2S are available for applications for regenerators or thermal anchors from 2 K to 8 K. This paper focused on controlling the heat capacity of the (GdxTb1-x)2O2S system to cover the refrigeration temperatures between 6 K and 8 K. A concept of multilayer regenerator material consisting of multicomponent magnetic materials has been proposed and investigated. Two-layer ceramic material including two kinds of magnetic materials (Gd0.1Tb0.9)2O2S+Tb2O2S was successfully fabricated in the form of regenerator particles with an average diameter of 0.25 mm. Measured heat capacity data showed that it had twin peaks relating to those of (Gd0.1Tb0.9)2O2S and Tb2O2S, and the entire curve became broader and wider. The mechanical properties of strength and hardness of the two-layer ceramic material were the same as other ceramic regenerator materials like GOS. Thus, it is concluded that the multilayer ceramic material is very useful to control the heat capacity of the regenerator particles. The cooling tests using the two-layer ceramic material with HoCu2 and GOS have been done to investigate the 2nd stage regenerator configuration

  4. Na+K+-ATPase activity and K+ channels differently contribute to vascular relaxation in male and female rats.

    Directory of Open Access Journals (Sweden)

    Fernanda Moura Vargas Dias

    Full Text Available Gender associated differences in vascular reactivity regulation might contribute to the low incidence of cardiovascular disease in women. Cardiovascular protection is suggested to depend on female sex hormones' effects on endothelial function and vascular tone regulation. We tested the hypothesis that potassium (K+ channels and Na+K+-ATPase may be involved in the gender-based vascular reactivity differences. Aortic rings from female and male rats were used to examine the involvement of K+ channels and Na+K+-ATPase in vascular reactivity. Acetylcholine (ACh-induced relaxation was analyzed in the presence of L-NAME (100 µM and the following K+ channels blockers: tetraethylammonium (TEA, 2 mM, 4-aminopyridine (4-AP, 5 mM, iberiotoxin (IbTX, 30 nM, apamin (0.5 µM and charybdotoxin (ChTX, 0.1 µM. The ACh-induced relaxation sensitivity was greater in the female group. After incubation with 4-AP the ACh-dependent relaxation was reduced in both groups. However, the dAUC was greater in males, suggesting that the voltage-dependent K+ channel (Kv participates more in males. Inhibition of the three types of Ca2+-activated K+ channels induced a greater reduction in Rmax in females than in males. The functional activity of the Na+K+-ATPase was evaluated by KCl-induced relaxation after L-NAME and OUA incubation. OUA reduced K+-induced relaxation in female and male groups, however, it was greater in males, suggesting a greater Na+K+-ATPase functional activity. L-NAME reduced K+-induced relaxation only in the female group, suggesting that nitric oxide (NO participates more in their functional Na+K+-ATPase activity. These results suggest that the K+ channels involved in the gender-based vascular relaxation differences are the large conductance Ca2+-activated K+ channels (BKCa in females and Kv in males and in the K+-induced relaxation and the Na+K+-ATPase vascular functional activity is greater in males.

  5. Identification for the optimal working parameters of Ti-6Al-4V-0.1Ru alloy in a wide deformation condition range by processing maps based on DMM

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Yu-feng; Long, Shuai; Zhou, Yu-ting; Zhao, Jia; Wang, Tian-yu; Zhou, Jie, E-mail: kkyttyls@vip.qq.com [School of Material Science and Engineering, Chongqing University (China)

    2016-11-15

    The hot deformation behaviours of Ti-6Al-4V-0.1Ru alloy were investigated by isothermal hot compression tests in the temperature range of 1023-1423 K and strain rate range of 0.01-10 s{sup -1}. The β transus was determined to be 1198 K by continuous heating method. The values of deformation activation energy Q at the strain of 0.3 were calculated to be 630.01 kJ/mol in dual-phase field and 331.75 kJ/mol in β-phase field. Moreover, the processing maps at the strain of 0.2, 0.4, 0.6 and 0.8 were developed based on dynamic materials model (DMM). To deeply understand the microstructure evolution mechanism during hot deformation processes and to verify the processing maps, the microstructures at different deformation conditions were observed. The stable microstructures (i.e. globularization, dynamic recovery (DRV) and β dynamic recrystallization (β-DRX)) and instable microstructures (i.e. lamellae kinking and flow localization) were obtained. To make it useful in the design of industrial hot working schedules for this material, a microstructural mechanism map was constructed on the basis of processing maps and microstructure observation. Deformation conditions in the vicinity of 1150 K & 0.01 s{sup -1} where globularization occurs and in the vicinity of 1323 K & 0.01 s{sup -1} where β-DRX occurs are recommended. (author)

  6. Evidence of $CP$ violation in $B^+\\to p\\bar{p}K^+$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    Three-body $B^+\\to p \\overline p K^+$ and $B^+\\to p \\overline p \\pi^+$ decays are studied using a data sample corresponding to an integrated luminosity of 3.0 $fb^{-1}$ collected by the LHCb experiment in proton-proton collisions at center-of-mass energies of $7$ and $8$ TeV. Evidence of $CP$ violation in the $B^+\\to p \\overline p K^+$ decay is found in regions of the phase space, representing the first measurement of this kind for a final state containing baryons. Measurements of the forward-backward asymmetry of the light meson in the $p\\overline p$ rest frame yield $A_{\\mathrm{FB}}(p \\overline p K^+,~m_{p\\overline p}<2.85\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2)=0.495\\pm0.012~(\\mathrm{stat})\\pm0.007~(\\mathrm{syst})$ and $A_{\\mathrm{FB}}(p\\overline p \\pi^+,~m_{p\\overline p}<2.85\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2)=-0.409\\pm0.033~(\\mathrm{stat})\\pm0.006~(\\mathrm{syst})$. In addition, the branching fraction of the decay $B^+\\to\\kern 0.1em\\overline{\\kern -0.1em\\Lambda}(1520)p$ is measured to be $\\mathcal{B}(B^+ \\...

  7. Pressure dependence of resistivity and magnetic properties in a Mn1.9Cr0.1Sb alloy

    Directory of Open Access Journals (Sweden)

    D. V. Maheswar Repaka

    2017-12-01

    Full Text Available We report magnetic-field and hydrostatic pressure dependent electrical resistivity and magnetic properties of a Mn1.9Cr0.1Sb alloy. Upon cooling, the magnetization of Mn1.9Cr0.1Sb exhibits a first-order ferrimagnetic to antiferromagnetic transition at the exchange inversion temperature, TS = 261 K under a 0.1 T magnetic field. Our experimental results show that TS decreases with increasing magnetic field but increase with increasing hydrostatic pressure. The pressure induced transition is accompanied by a large positive baro-resistance of 30.5% for a hydrostatic pressure change of 0.69 GPa. These results show that the lattice parameters as well as the bond distance between Mn-Mn atoms play a crucial role in the magnetic and electronic transport properties of Mn1.9Cr0.1Sb. This sample also exhibits a large inverse magnetocaloric effect with a magnetic entropy change of ΔSm = +6.75 J/kg.K and negative magnetoresistance (44.5% for a field change of 5 T at TS in ambient pressure which may be useful for magnetic cooling and spintronics applications.

  8. The role of Na+/K+-ATPase during chick skeletal myogenesis.

    Directory of Open Access Journals (Sweden)

    Taissa Neustadt Oliveira

    Full Text Available The formation of a vertebrate skeletal muscle fiber involves a series of sequential and interdependent events that occurs during embryogenesis. One of these events is myoblast fusion which has been widely studied, yet not completely understood. It was previously shown that during myoblast fusion there is an increase in the expression of Na+/K+-ATPase. This fact prompted us to search for a role of the enzyme during chick in vitro skeletal myogenesis. Chick myogenic cells were treated with the Na+/K+-ATPase inhibitor ouabain in four different concentrations (0.01-10 μM and analyzed. Our results show that 0.01, 0.1 and 1 μM ouabain did not induce changes in cell viability, whereas 10 μM induced a 45% decrease. We also observed a reduction in the number and thickness of multinucleated myotubes and a decrease in the number of myoblasts after 10 μM ouabain treatment. We tested the involvement of MEK-ERK and p38 signaling pathways in the ouabain-induced effects during myogenesis, since both pathways have been associated with Na+/K+-ATPase. The MEK-ERK inhibitor U0126 alone did not alter cell viability and did not change ouabain effect. The p38 inhibitor SB202190 alone or together with 10 μM ouabain did not alter cell viability. Our results show that the 10 μM ouabain effects in myofiber formation do not involve the MEK-ERK or the p38 signaling pathways, and therefore are probably related to the pump activity function of the Na+/K+-ATPase.

  9. Picosecond green and deep ultraviolet pulses generated by a high-power 100 kHz thin-disk laser

    Czech Academy of Sciences Publication Activity Database

    Novák, Ondřej; Turčičová, Hana; Smrž, Martin; Miura, Taisuke; Endo, Akira; Mocek, Tomáš

    2016-01-01

    Roč. 41, č. 22 (2016), s. 5210-5213 ISSN 0146-9592 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk LO1602; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : lasers * diode-pumped * ultraviolet Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.416, year: 2016

  10. Thermodynamic properties of pentaphenylantimony Ph5Sb over the range from T → 0 K to 400 K

    International Nuclear Information System (INIS)

    Smirnova, N.N.; Letyanina, I.A.; Larina, V.N.; Markin, A.V.; Sharutin, V.V.; Senchurin, V.S.

    2009-01-01

    In the present research, the temperature dependence of the heat capacity C p,m 0 =f(T) of pentaphenylantimony Ph 5 Sb has been measured between T = (6 and 350) K in the precision adiabatic vacuum calorimeter and from T = (327 to 415) K in the differential scanning calorimeter and reported for the first time. The melting of the sample has been observed within the above temperature range. The melting was accompanied by partial compound decomposition. The experimental results have been used to calculate the standard (p 0 = 0.1 MPa) thermodynamic functions C p,m 0 /R, Δ 0 T H m 0 /RT, Δ 0 T S m 0 /R, and Φ m 0 /R=Δ 0 T S m 0 /R-Δ 0 T H m 0 /RT (where R is the universal gas constant) of crystalline Ph 5 Sb over the range from T → 0 K to 400 K. The energy of combustion of the compound under study has been determined in the isothermal combustion calorimeter with a stationary bomb. The standard thermodynamic functions of crystalline Ph 5 Sb formation at T = 298.15 K have been calculated

  11. 17 CFR 249.618 - Form BD-Y2K, information required of broker-dealers pursuant to section 17 of the Securities...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BD-Y2K, information... Exchange Members, Brokers, and Dealers § 249.618 Form BD-Y2K, information required of broker-dealers... FR 37674, July 13, 1998] Editorial Note: For Federal Register citations affecting Form BD-Y2K, see...

  12. 17 CFR 249.619 - Form TA-Y2K, information required of transfer agents pursuant to section 17 of the Securities...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TA-Y2K, information... Certain Exchange Members, Brokers, and Dealers § 249.619 Form TA-Y2K, information required of transfer... affecting Form TA-Y2K, see the List of CFR Sections Affected, which appears in the Finding Aids section of...

  13. Calculation of Unknown Preoperative K Readings in Postrefractive Surgery Patients

    Directory of Open Access Journals (Sweden)

    Nicola Rosa

    2018-01-01

    Full Text Available Purpose. To determine the unknown preoperative K readings (Kpre to be used in history-based methods, for intraocular lens (IOL power calculation in patients who have undergone myopic photorefractive keratectomy (PRK. Methods. A regression formula generated from the left eyes of 174 patients who had undergone PRK for myopia or for myopic astigmatism was compared with other methods in 168 right eyes. The Pearson index and paired t-test were utilized for statistical analysis. Results. The differences between Kpre and those obtained with the other methods were as follows: 0.61 ± 0.94 D (range: −3.94 to 2.05 D, p<0.01 subtracting the effective treatment, 0.01 ± 0.86 D (range: −2.61 to 2.34 D, p=0.82 with Rosa’s formula, −0.02 ± 1.31 D (range: −3.43 to 3.68 D, p=0.82 with the current study formula, and −0.43 ± 1.40 D (range: −3.98 to 3.12 D, p<0.01 utilizing a mean K (Km of 43.5 D. Conclusions. These formulas may permit the utilization of history-based methods, that is, the double-K method in calculating the IOL power following PRK when Kpre are unknown.

  14. Colourings of (k-r,k-trees

    Directory of Open Access Journals (Sweden)

    M. Borowiecki

    2017-01-01

    Full Text Available Trees are generalized to a special kind of higher dimensional complexes known as \\((j,k\\-trees ([L. W. Beineke, R. E. Pippert, On the structure of \\((m,n\\-trees, Proc. 8th S-E Conf. Combinatorics, Graph Theory and Computing, 1977, 75-80], and which are a natural extension of \\(k\\-trees for \\(j=k-1\\. The aim of this paper is to study\\((k-r,k\\-trees ([H. P. Patil, Studies on \\(k\\-trees and some related topics, PhD Thesis, University of Warsaw, Poland, 1984], which are a generalization of \\(k\\-trees (or usual trees when \\(k=1\\. We obtain the chromatic polynomial of \\((k-r,k\\-trees and show that any two \\((k-r,k\\-trees of the same order are chromatically equivalent. However, if \\(r\

  15. Search for the B{sup 0}{sub d,s}→K{sup *0}K{sup 0}{sub S} decays at LHCb

    Energy Technology Data Exchange (ETDEWEB)

    Fontana, Marianna

    2014-12-17

    The search for the previously unobserved B{sup 0}{sub d,s}→K{sup *0}K{sup 0}{sub S} decays is performed at the LHCb experiment, using proton-proton collisions at a centre of mass energy of √(s)=7 TeV. These decays provide a fertile ground in the search of New Physics in CP violation measurements. The data sample was recorded in 2011 and corresponds to an integrated luminosity of 1 fb{sup -1}. The first observation of the B{sub s}{sup 0}→K{sup *0}K{sub S}{sup 0} decay is reported. A measurement of the limit and the branching fraction relative to the B{sup 0}→K{sup 0}{sub S}π{sup +}π{sup -} decay yields the following results: (B(B{sup 0} → K{sup *0}K{sub S}{sup 0}))/(B(B{sup 0} → K{sub S}{sup 0}π{sup +}π{sup -}))<0.12(0.15) at 90% (95%) CL (B(B{sub s}{sup 0} → K{sup *0}K{sub S}{sup 0}))/(B(B{sup 0} → K{sub S}{sup 0}π{sup +}π{sup -}))=0.22±0.06(stat)±0.02(syst)±0.01(f{sub s}/f{sub d}), where the first uncertainty is statistical, the second systematic and the third comes from the uncertainty on the hadronisation fraction.

  16. Study of the Ds+ → K+K-e+νe decay channel with the Babar experiment

    International Nuclear Information System (INIS)

    Serrano, J.

    2008-04-01

    Charm semileptonic decays allow a validation of lattice QCD calculations through the measurement of the hadronic form factors, which characterize the effect of strong interaction in these reactions. The accuracy of such calculations is crucial for the improvement of the test of the standard model in flavour physics. This thesis presents a study of the D s + → K + K - e + ν e channel using 214fb -1 recorded by de Babar experiment. For events with a K + K - mass in the range between 1.01 GeV/c 2 and 1.03 GeV/c 2 , the φ → K + K - is the dominant component. Using the simple pole model to parameterize the q 2 dependence of the form factors -V(q 2 ), A 1 (g 2 ) and A 2 (q 2 )- the following ratios are measured at q 2 = 0: r v = V(0)/A 1 (0) 1.868±0.061±0.079, r 2 = A 2 (0)/A 1 (0) = 0.763±0.072±0.062. The mass pole of the axial-vector form factor is also obtained: m A (2.30 0.18 +0.24 ±0.21) GeV/c 2 . In the same mass range, the semileptonic branching fraction, relative to the D s + → φπ + channel, is measured, and the absolute normalisation of the axial-vector form factor is extracted: A 1 (q 2 = 0) = 0.605 ± 0.012 ± 0.018 ± 0.018. The stated errors refer to the statistical, systematic and errors from external inputs, respectively. An S wave component in the K + K - system, possibly originating from a f 0 , is also studied through its interference with the φ. An S wave component is observed for the first time in this decay channel with a 5σ significance. (author)

  17. K-K-K-Kuninga kõne / Peter Conradi ; tõlkinud Kadri Karro

    Index Scriptorium Estoniae

    Conradi, Peter

    2011-01-01

    The Sunday Timesi ajakirjanik valgustab filmi "Kuninga kõne" (režissöör Tom Hooper, Inglise-Austraalia-USA, 2010) tagamaid. Film räägib kuningas George VI elust ja tema kõnedefektist, kogelemisest. Kuningat aitas Austraalia päritolu kõneterapeut Lionel Logue. Filmi stsenaariumi kirjutas David Seidler

  18. Dalitz plot analysis of D0 hadronic decays D0->K0K-pi+, D0->antiK0K+pi- and D0->antiK0K+K-

    International Nuclear Information System (INIS)

    Palano, Antimo

    2002-01-01

    A Dalitz plot analysis of the D 0 hadronic decays D 0 → K 0 K - π + , D 0 → (bar K) 0 K + π - and D 0 → (bar K) 0 K + K - is presented. This analysis is based on a data sample of 22 fb -1 collected with the BABAR detector at the PEP-II asymmetric-energy B Factory at SLAC running on or near the Υ(4S) resonance. The events are selected from continuum e + e - annihilations using the decay D* + → D 0 π + . Preliminary measurements of the branching fractions of the above hadronic decays are obtained. Preliminary estimates of fractions and phases for resonant and nonresonant contributions to the Dalitz plot are also presented

  19. Pressure dependence of the solubility of light fullerenes in 1-hexanol from 298.15 K to 363.15 K

    DEFF Research Database (Denmark)

    Semenov, Konstantin N.; Regueira Muñiz, Teresa; Fernández, Josefa

    2015-01-01

    The solubility of light fullerenes (C60 and C70) in 1-hexanol was investigated in the range of pressures of 0.1-100 MPa and in the range of temperatures of 298.15-363.15 K. In all of the studied temperatures, solubility increases monotonously with increasing pressure. At ambient pressure, we have...... (monosolvated fullerene C60 and non-solvated C60). The composition of the solid crystallosolvate was determined by thermogravimetric analysis. The solubility diagram of the binary system C70-1-hexanol in the temperature range of 298.15-328.15 K at 0.1 MPa consists of only one branch corresponding...

  20. Structural, magnetic and thermal properties of CaMn0.9957Fe0.01O3-δ

    International Nuclear Information System (INIS)

    Przewoznik, J.; Chmist, J.; Kolwicz-Chodak, L.; Tarnawski, Z.; Kapusta, Cz.; Kolodziejczyk, A.

    2007-01-01

    The polycrystalline CaMn 0.99 57 Fe 0.01 O 3-δ compound was studied using powder X-ray diffraction, 57 Fe Moessbauer spectroscopy, ac susceptometry, dc magnetometry, specific heat and electrical resistivity measurements. X-ray diffraction measurements performed between 70 and 300 K show a thermal expansion anomaly at the Neel temperature. A weak ferromagnetic component and a spin-glass behaviour below Neel temperature are found in magnetic measurements. The Moessbauer spectroscopy measurements performed between 30 and 300 K provided the Neel temperature value of 118 K, the same as obtained from dc magnetisation and close to that derived from the specific heat (119 K). The temperature evolution of the Fe hyperfine field was analysed within a molecular field model and revealed equal strengths of the Fe-Mn and Mn-Mn exchange interactions in this compound

  1. Search for two-photon production of resonances decaying into K anti K and K anti K. pi

    Energy Technology Data Exchange (ETDEWEB)

    Althoff, M; Braunschweig, W; Kirschfink, F J; Martyn, H U; Rosskamp, R; Siebke, H; Wallraff, W; Eisenmann, J; Fischer, H M; Hartmann, H

    1985-11-01

    An analysis of the production of Ksub(s)/sup 0/Ksub(s)/sup 0/ and Ksup(+-)Ksub (s)/sup 0/..pi..sup(-+) by two quasi-real photons is presented. The cross section for ..gamma gamma..->K/sup 0/ anti K/sup 0/, which is given for the ..gamma gamma.. invariant mass range from K anti K threshold to 2.5 GeV, is dominated by the f'(1,525) resonance and an enhancement near the K anti K threshold. Upper limits on the product of the two-photon width times the branching ratio into K anti K pairs are given for THETA(1,700), h(2,030), and zeta(2,220). For exclusive two-photon production of Ksup(+-)Ksub(s)/sup 0/..pi..-+ no significant signal was observed. Upper limits are given on the cross section of ..gamma gamma..->K/sup +/ anti K/sup 0/..pi../sup -/ or K/sup -/K/sup 0/..pi../sup +/ between 1.4 and 3.2 GeV and on the product of the ..gamma gamma.. width times the branching ratio into the Kanti K..pi.. final states for the etasub(c)(2,980) and the iota(1,440), yielding GAMMA(..gamma gamma..->iota(1,440)) . BR(iota(1,440)-> K anti K..pi..) < 2.2keV at 95% C.L.

  2. An Experimental Study of the Decay $D^0 \\to K^- K^- K^+ \\pi^+$

    Energy Technology Data Exchange (ETDEWEB)

    Devmal, Shiral Cleophas [Cincinnati U.

    2000-05-01

    Using data from the E791 experiment at Fermi National Accelerator Laboratory (Fermilab), we have studied the Cabibbo favored, but phase space suppressed decay $D^0 \\to K^-K^- K^+ \\pi^+$ with the normalization channel $D^0 \\to K^- \\pi^- \\pi^+ \\pi^+$. We report the branching ratio of $D^0 \\to K^- K^- K^+ \\pi^+$ relative to the branching ratio of $D^0 \\to K^- \\pi^- \\pi^+ \\pi^+$. This value is (0.54 $\\pm$ 0.13 $\\pm$ 0.07)%. We see a clear signal of $K^-K^+$ resonance in the decay $D^0 \\to K^-K^-K^+\\pi^+$ from which we conclude that about (60 $\\pm$ 30)% of $KKK\\pi$ comes from $D^0 \\to \\phi K^-\\pi^+; \\phi \\to K^-K^+$. We also set the range (0.30% - 0.90%) for the ratio $P_{q\\overline{q}} = P_{NoPop}$ where $P_{q\\bar{q}}$ is the contribution from either $D^0 \\to K^-K^-K^+\\pi^+$ terms that pop an $s\\bar{s}$ or corresponding $D^0 \\to K^- \\pi^- \\pi^+ \\pi^+$ terms that pop either $u\\bar{u}$ or $d\\bar{d}$ pair and $P_{NoPop}$ is the contributions from the $D^0 \\to K^- \\pi^- \\pi^+ \\pi^+$ terms that do not have such corresponding popping.

  3. Hot deformation and processing maps of K310 cold work tool steel

    International Nuclear Information System (INIS)

    Ezatpour, H.R.; Sajjadi, S.A.; Haddad-Sabzevar, M.; Ebrahimi, G.R.

    2012-01-01

    Highlights: ► The steady state stresses are related to strain rate and temperature. ► The study led to n DRX = 3.95 and Q DRX = 219.65 kJ/(mol K) and α = 1.2 × 10 −2 MPa −1 . ► The safe domain occurs in the region of 1000–1100 °C for a strain rate of 0.1 s −1 . - Abstract: Hot working response of cold work tool steel K310 was investigated by means of compression test at temperature range of 900–1100 °C. The equivalent strain rates used in these tests were 0.01, 0.1 and 1 s −1 , respectively in order to obtain the processing and stability maps of the studied material following the Dynamic Material Model. All the zones of flow instability were studied through scanning electron microscopy (SEM). The microstructure of the samples after deformation was then analyzed by light microscopy and the differences were compared together. The steady state stress obtained from the flow curves was related to strain rate (ε . ) and temperature (T) by means of the well known Zener–Holloman equation. A least square analysis of the data led to n = 3.95 and Q DRX = 219.65 kJ/mol and α = 1.2 × 10 −2 MPa −1 . Also, hardness results showed that by increasing strain from peak to steady state strain, hardness was decreased.

  4. Volumetric Behavior of Sodium Saccharin in Water and (0.1, 0.3, and 0.5 m Fructose at (298.15, 303.15, 308.15, and 313.15 K

    Directory of Open Access Journals (Sweden)

    Sanjeevan J. Kharat

    2017-04-01

    Full Text Available In order to get the information regarding the sweetener-water and sweetener-sweetener interactions, densities of sodium saccharin in water and (0.1, 0.3, and 0.5 m fructose have been measured at (298.15, 303.15, 308.15, and 313.15 K by the use of bicapillary pycnometer. From density values, partial molar volumes, expansion coefficient, Hepler’s constant, apparent specific volumes, partial molar volumes of transfer, doublet and triplet interaction coefficients have been calculated. From density study, it has been concluded that strong water-sodium saccharin interactions exist. Sodium saccharin is water structure maker. Strong interactions exist between sodium saccharin and fructose. In presence of fructose, the interactions exist between hydrophilic group (–OH, C=O, and –O– of fructose and sodium ion of sodium saccharin in aqueous solutions of sodium saccharin. All investigated solutions exhibit sweet taste. DOI: http://dx.doi.org/10.17807/orbital.v9i1.921 

  5. K basins sludge removal sludge pretreatment system

    International Nuclear Information System (INIS)

    Chang, H.L.

    1997-01-01

    The Spent Nuclear Fuels Program is in the process of planning activities to remove spent nuclear fuel and other materials from the 100-K Basins as a remediation effort for clean closure. The 105 K- East and K-West Basins store spent fuel, sludge, and debris. Sludge has accumulated in the 1 00 K Basins as a result of fuel oxidation and a slight amount of general debris being deposited, by settling, in the basin water. The ultimate intent in removing the sludge and fuel is to eliminate the environmental risk posed by storing fuel at the K Basins. The task for this project is to disposition specific constituents of sludge (metallic fuel) to produce a product stream through a pretreatment process that will meet the requirements, including a final particle size acceptable to the Tank Waste Remediation System (TWRS). The purpose of this task is to develop a preconceptual design package for the K Basin sludge pretreatment system. The process equipment/system is at a preconceptual stage, as shown in sketch ES-SNF-01 , while a more refined process system and material/energy balances are ongoing (all sketches are shown in Appendix C). Thus, the overall process and 0535 associated equipment have been conservatively selected and sized, respectively, to establish the cost basis and equipment layout as shown in sketches ES- SNF-02 through 08

  6. Dalitz Plot Analysis of the Decay B+ -> K+K+K-

    Energy Technology Data Exchange (ETDEWEB)

    Dvoretskii, Alexei; /SLAC /Caltech

    2006-05-05

    The authors perform an analysis of the three-body charmless decay B{sup {+-}} {yields} K{sup {+-}}K{sup {+-}}K{sup {-+}} using a sample of 226.0 {+-} 2.5 million B{bar B} pairs collected by the BABAR detector and measure the total branching fraction and Cp asymmetry to be {beta} = (35.2 {+-} 0.9 {+-} 1.6) x 10{sup -6} and A{sub CP} = (-1.7 {+-} 2.6 {+-} 1.5)%. They fit the Dalitz plot distribution using an isobar model and report the measured values of magnitudes and phases of the production coefficients. The decay dynamics is dominated by the K{sup +}K{sup -} S-wave, for which we perform a partial-wave analysis in the region m(K{sup +}K{sup -}) < 2 GeV/c{sup 2}. They find no evidence of CP violation for individual components of the isobar model.

  7. Experimental Conditions: SE3_S02_M01_D01 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE3_S02_M01_D01 SE3 Comparison of fruit metabolites among tomato varieties 1 SE3_S0...2 Solanum lycopersicum House Momotaro fruit SE3_S02_M01 6.7mg [MassBase ID] MDLC1_25529 SE3_MS1 LC-FT-ICR-MS

  8. Production properties of K*(892) vector mesons and their spin alignment as measured in the NOMAD experiment

    CERN Document Server

    Chukanov, A; Popov, B; Astier, Pierre; Autiero, D; Baldisseri, Alberto; Baldo-Ceolin, M; Banner, M; Bassompierre, G; Benslama, K; Besson, N; Bird, I; Blumenfeld, B; Bobisut, F; Bouchez, J; Boyd, S; Bueno, A; Bunyatov, S; Camilleri, L L; Cardini, A; Cattaneo, P W; Cavasinni, V; Cervera-Villanueva, A; Challis, R; Collazuol, G; Conforto, G; Conta, C; Contalbrigo, M; Cousins, R; Daniels, D; Degaudenzi, H M; Del Prete, T; De Santo, A; Dignan, T; Di Lella, L; Do Couto e Silva, E; Dumarchez, J; Ellis, M; Feldman, G J; Ferrari, R; Ferrère, D; Flaminio, V; Fraternali, M; Gaillard, J M; Gangler, E; Geiser, A; Geppert, D; Gibin, D; Gninenko, S; Godley, A; Gómez-Cadenas, J J; Gosset, J; Gössling, C; Gouanère, M; Grant, A; Graziani, G; Guglielmi, A M; Hagner, C; Hernando, J; Hubbard, D; Hurst, P; Hyett, N; Iacopini, E; Joseph, C; Juget, F; Kent, N; Kirsanov, M; Klimov, O; Kokkonen, J; Kovzelev, A; Krasnoperov, A V; Lacaprara, S; Lachaud, C; Lakic, B; Lanza, A; La Rotonda, L; Laveder, M; Letessier-Selvon, A A; Lévy, J M; Linssen, Lucie; Ljubicic, A; Long, J; Lupi, A; Lyubushkin, V; Marchionni, A; Martelli, F; Méchain, X; Mendiburu, J P; Meyer, J P; Mezzetto, Mauro; Mishra, S R; Moorhead, G F; Nédélec, P; Nefedov, Yu; Nguyen-Mau, C; Orestano, D; Pastore, F; Peak, L S; Pennacchio, E; Pessard, H; Petti, R; Placci, A; Polesello, G; Pollmann, D; Polyarush, A Yu; Poulsen, C; Rebuffi, L; Renò, R; Rico, J; Riemann, P; Roda, C; Rubbia, André; Salvatore, F; Samoylov, O; Schahmaneche, K; Schmidt, B; Schmidt, T; Sconza, A; Sevior, M; Sillou, D; Soler, F J P; Sozzi, G; Steele, D; Stiegler, U; Stipcevic, M; Stolarczyk, T; Tareb-Reyes, M; Taylor, G N; Tereshchenko, V V; Toropin, A; Touchard, A M; Tovey, Stuart N; Tran, M T; Tsesmelis, E; Ulrichs, J; Vacavant, L; Valdata-Nappi, M; Valuev, V; Vannucci, F; Varvell, K E; Veltri, M; Vercesi, V; Vidal-Sitjes, G; Vieira, J M; Vinogradova, T; Weber, F V; Weisse, T; Wilson, F F; Winton, L J; Yabsley, B D; Zaccone, Henri; Zei, R; Zuber, K; Zuccon, P

    2006-01-01

    First measurements of K*(892) mesons production properties and their spin alignment in nu_mu charged current (CC) and neutral current (NC) interactions are presented. The analysis of the full data sample of the NOMAD experiment is performed in different kinematic regions. For K*+ and K*- mesons produced in nu_mu CC interactions and decaying into K0 pi+/- we have found the following yields per event: (2.6 +/- 0.2 (stat.) +/- 0.2 (syst.))% and (1.6 +/- 0.1 (stat.) +/- 0.1 (syst.))% respectively, while for the K*+ and K*- mesons produced in nu NC interactions the corresponding yields per event are: (2.5 +/- 0.3 (stat.) +/- 0.3 (syst.))% and (1.0 +/- 0.3 (stat.) +/- 0.2 (syst.))%. The results obtained for the rho00 parameter, 0.40 +/- 0.06 (stat) +/- 0.03 (syst) and 0.28 +/- 0.07 (stat) +/- 0.03 (syst) for K*+ and K*- produced in nu_mu CC interactions, are compared to theoretical predictions tuned on LEP measurements in e+e- annihilation at the Z0 pole. For K*+ mesons produced in nu NC interactions the measured r...

  9. Test Results of the LARP HQ02b Magnet at 1.9 K

    OpenAIRE

    Bajas, H; Bajko, M; Bottura, L; Chiuchiolo, A; Dunkel, O; Ferracin, P; Feuvrier, J; Giloux, Chr; Todesco, E; Ravaioli, E; Caspi, S; Dietderich, D; Felice, H; Hafalia, A R; Marchevsky, M

    2015-01-01

    The HQ magnet is a 120 mm aperture, 1-meter-long Nb3Sn quadrupole developed by the LARP collaboration in the framework of the High-Luminosity LHC project. A first series of coils was assembled and tested in 5 assemblies of the HQ01 series. The HQ01e model achieved a maximum gradient of 170 T/m at 4.5 K at LBNL in 2010-2011 and reached 184 T/m at 1.9 K at CERN in 2012. A new series of coils incorporating major design changes was fabricated for the HQ02 series. The first model, HQ02a, was teste...

  10. Acquisition and evaluation of thermodynamic data for morenosite-retgersite equilibria at 0.1 MPa

    Science.gov (United States)

    Chou, I.-Ming; Seal, R.R.

    2003-01-01

    Metal-sulfate salts in mine drainage environments commonly occur as solid solutions containing Fe, Cu, Mg, Zn, Al, Mn, Ni, Co, Cd, and other elements. Thermodynamic data for some of the end-member salts containing Fe, Cu, Zn, and Mg have been collected and evaluated previously, and the present study extends to the system containing Ni. Morenosite (NiSO4-7H2O)-retgersite (NiSO4-6H2O) equilibria were determined along five humidity buffer curves at 0.1 MPa and between 5 and 22??C. Reversals along these humidity-buffer curves yield In K = 17.58-6303.35/T, where K is the equilibrium constant, and T is temperature in K. The derived standard Gibbs free energy of reaction is 8.84 kJ/mol, which agrees very well with the values of 8.90, 8.83, and 8.85 kJ/mol based on the vapor pressure measurements of Schumb (1923), Bonnell and Burridge (1935), and Stout et al. (1966). respectively. This value also agrees reasonably well with the values of 8.65 and 9.56 kJ/mol calculated from the data compiled by Wagman et al. (1982) and DeKock (1982), respectively. The temperature-humidity relationships defined by this study for dehydration equilibria between morenosite and retgersite explain the more common occurrence of retgersite relative to morenosite in nature.

  11. Path representation of su-hat (2){sub k} states I: Operators and particles for k=1,2

    Energy Technology Data Exchange (ETDEWEB)

    Lamy-Poirier, Joel, E-mail: jlamypoirier@perimeterinstitute.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada); Mathieu, Pierre, E-mail: pmathieu@phy.ulaval.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada)

    2011-04-11

    This is the first of two articles devoted to the analysis of the path description of the states in su-hat (2){sub k} WZW models, a representation well suited for constructive derivations of the fermionic characters. In this first article, the cases k=1,2 are treated in detail, emphasizing a different description in each case (operators vs particles). For k=1, we first prove, as a side result, the equivalence of two known path representations for the finitized su-hat (2){sub 1} states by displaying an explicit bijection. An immediate offshoot is the gain of a new and simple weighting for the (Kyoto) path representation that generalizes to level k. The bijection also suggests two operator constructions for the su-hat (2){sub 1} paths, a local and a nonlocal one, both interrelated. These are formal operators that map a path to another path, so that any path can be obtained by successive applications of these operators on a simple reference (ground-state) path. The nonlocal operator description is the starting point for a direct and elementary derivation of the su-hat (2){sub 1} spinon character. The second part presents an extensive study of the su-hat (2){sub 2} paths from their particle point of view, where the particles are defined as the path building blocks. The resulting generating functions appear to provide new (at least superficially) fermionic forms of the characters. In particular, a nice relationship between the sum of the j=0,1 characters at k=2 and the two ones at k=1 is unraveled.

  12. Test of lepton universality using $B^{+}\\rightarrow K^{+}\\ell^{+}\\ell^{-}$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    A measurement of the ratio of the branching fractions of the $B^{+}\\rightarrow K^{+}\\mu^{+}\\mu^{-}$ and $B^{+}\\rightarrow K^{+}e^{+}e^{-}$ decays is presented using proton-proton collision data, corresponding to an integrated luminosity of 3.0 fb$^{-1}$, recorded with the LHCb experiment at center-of-mass energies of 7 and 8 $\\mathrm{\\,Te\\kern -0.1em V}$. The value of the ratio of branching fractions for the dilepton invariant mass squared range $1 < q^{2}<6\\mathrm{\\,Ge\\kern -0.1em V^2\\!/}c^4$ is measured to be $0.745^{+0.090}_{-0.074}\\mathrm{\\,(stat)}\\,\\pm0.036\\mathrm{\\,(syst)}$. This value is the most precise measurement of the ratio of branching fractions to date and is compatible with the SM prediction within $2.6$ standard deviations.

  13. In Vitro Vitamin K 3 Effect on Conjunctival Fibroblast Migration and Proliferation

    OpenAIRE

    Pinilla, I.; Izaguirre, L. B.; Gonzalvo, F. J.; Piazuelo, E.; Garcia-Gonzalez, M. A.; Sanchez-Cano, A. I.; Sopeña, F.

    2014-01-01

    Purpose. To evaluate the dose effect of vitamin K3 on wound healing mechanisms. Methods. Conjunctival fibroblasts were incubated for 24 hours. An artificial wound was made and the cells were incubated with fresh medium plus doses of vitamin K3 to be tested. Wound repair was monitored at 0, 18, 24, and 48 hours. Proliferation was measured in actively dividing cells by [3H]thymidine uptake. Six different groups were tested: group 1/no drugs added, group 2/ethanol 0.1%, group 3/vitamin K3 1 mg/L...

  14. The relative biological effectiveness of 60Co γ-rays, 55 kVp X-rays, 250 kVp X-rays, and 11 MeV electrons at low doses

    International Nuclear Information System (INIS)

    Spadinger, I.; Palcic, B.

    1992-01-01

    The RBE of selected low-LET radiation modalities (55 kVp X- rays, 250 kVp X-rays, 60 Co γ-rays, and 11 MeV electrons) was investigated for survival of two cell lines (V79 and CHO). Detailed measurements were made in the 0 to 3 Gy dose range using an image cytometry device to accurately determine the number of cells assayed at each dose point. Data were also collected in the high dose range (0 to 10 Gy) using conventional counting and plating techniques. RBE values (#+- #1 SE) varied from 1.0±0.07 (V79 cells) and 1.2± 0.05 (CHO cells) at high doses to 1.3±0.07 (V79) and 1.4±0.1 (CHO) at low doses for 55 kVp X-rays, from 1.1±0.05 (V79) and 1.1±0.04 (CHO) at high doses to 1.1±0.06 (V79) and 1.2±0.2 (CHO) at low doses for 250 kVp X-rays, and from 1.1±0.08 (V79) and 1.0±0.04 (CHO) at high doses to 1.0±0.06 (V79) and 0.9±0.1 (CHO) at low doses for 11 MeV electrons. Only the low and high dose RBEs for 55 kVp X-rays relative to 60 Co γ-rays were significantly different. (author)

  15. The beam steering system of the cyclotron U-120K; Sistema razvodki puchkov tsiklotrona U-120K

    Energy Technology Data Exchange (ETDEWEB)

    Borkova, A; Ivan, J; Trejbal, Z; Dmitrievskij, V P; Pavlov, D V; Chesnov, A F; Chesnova, S I

    1991-12-31

    The calculation of the beam transport system of the isochronous cyclotron U-120K is presented. This system realizes the beam transport with given parameters to six distant targets specializing in the production of radioactive isotopes, the biomedicine investigation, the experimental nuclear physics. At chosen parameters of lenses and bending magnets the beam size is {<=} 1x1 cm and the energy resolution in the monoenergetic line is less than 0.1%. 4 refs.; 6 figs.; 1 tab.

  16. Search for B^0 meson decays to \\pi^0 K^0_S K^0_S, \\eta K^0_S K^0_S, and \\eta^{\\prime}K^0_S K^0_S

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2009-05-08

    We describe searches for B{sup 0} meson decays to the charmless final states {pi}{sup 0}K{sub S}{sup 0}K{sub S}{sup 0}, {eta}K{sub S}{sup 0}K{sub S}{sup 0}, and {eta}{prime}K{sub S}{sup 0}K{sub S}{sup 0}. The data sample corresponds to 467 x 10{sup 6} B{bar B} pairs produced in e{sup +}e{sup -} annihilation and collected with the BABAR detector at the SLAC National Accelerator Laboratory. We find no significant signals and determine the 90% confidence level upper limits on the branching fractions, in units of 10{sup -7}, {Beta}(B{sup 0} {yields} {pi}{sup 0}K{sub S}{sup 0}K{sub S}{sup 0}) < 12, {Beta}(B{sup 0} {yields} {eta}K{sub S}{sup 0}K{sub S}{sup 0}) < 10, and {Beta}(B{sup 0} {yields} {eta}{prime}K{sub S}{sup 0}K{sub S}{sup 0}) < 20.

  17. Myostatin inhibits eEF2K-eEF2 by regulating AMPK to suppress protein synthesis.

    Science.gov (United States)

    Deng, Zhao; Luo, Pei; Lai, Wen; Song, Tongxing; Peng, Jian; Wei, Hong-Kui

    2017-12-09

    Growth of skeletal muscle is dependent on the protein synthesis, and the rate of protein synthesis is mainly regulated in the stage of translation initiation and elongation. Myostatin, a member of the transforming growth factor-β (TGF-β) superfamily, is a negative regulator of protein synthesis. C2C12 myotubes was incubated with 0, 0.01, 0.1, 1, 2, 3 μg/mL myostatin recombinant protein, and then we detected the rates of protein synthesis by the method of SUnSET. We found that high concentrations of myostatin (2 and 3 μg/mL) inhibited protein synthesis by blocking mTOR and eEF2K-eEF2 pathway, while low concentration of myostatin (0.01, 0.1 and 1 μg/mL) regulated eEF2K-eEF2 pathway activity to block protein synthesis without affected mTOR pathway, and myostatin inhibited eEF2K-eEF2 pathway through regulating AMPK pathway to suppress protein synthesis. It provided a new mechanism for myostatin regulating protein synthesis and treating muscle atrophy. Copyright © 2017. Published by Elsevier Inc.

  18. Measurement of Ratios of Branching Fractions and CP-Violating Asymmetries of B+/- --> D*K +/- decays

    International Nuclear Information System (INIS)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; Garra Tico, J.; Grauges, E.; Lopez, L.; Palano, A.; Pappagallo, M.; Eigen, G.; Stugu, B.; Sun, L.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, R.N.; Jacobsen, R.G.

    2008-01-01

    The authors report a study of B ± → D*K ± decays with D* decaying to Dπ 0 or Dγ, using 383 x 10 6 B(bar B) pairs collected at the Υ(4S) resonance with the BABAR detector at the SLAC PEP-II B-Factory. The D meson decays under study include a non-CP mode (K ± π # -+#), CP-even modes (K ± K # -+#, π ± π # -+#) and CP-odd modes (K S 0 π 0 , K S 0 φ, K S 0 ω). They measure ratios (R* CP± ) of branching fractions of decays to CP eigenmode states and to flavor-specific states as well as CP asymmetries A* CP± = -0.11 ± 0.09 ± 0.01, R* CP+ = 1.31 ± 0.13 ± 0.04, and A* CP- = 0.06 ± 0.10 ± 0.02, R* CP- = 1.10 ± 0.12 ± 0.04, where the first error is statistical and the second error is systematic. Translating the results into an alternative parameterization, widely used for related measurements, they obtain x* + = 0.11 ± 0.06 ± 0.02 and x* - = 0.00 ± 0.06 ± 0.01. No significant CP-violating charge asymmetry is found in either the flavor-specific mode D → K ± π # -+# or in B ± → D*π ± decays

  19. Test Results of the LARP HQ02b Magnet at 1.9 K

    CERN Document Server

    Bajas, H; Bottura, L; Chiuchiolo, A; Dunkel, O; Ferracin, P; Feuvrier, J; Giloux, Chr; Todesco, E; Ravaioli, E; Caspi, S; Dietderich, D; Felice, H; Hafalia, A R; Marchevsky, M; Sabbi, G L; Wang, X; Salmi, T; Ghosh, A; Schmalzle, J; Wanderer, P; Anerella, M; Ambrosio, G; Bossert, R; Chlachidze, G; Yu, M

    2015-01-01

    The HQ magnet is a 120 mm aperture, 1-meter-long Nb$_{3}$Sn quadrupole developed by the LARP collaboration in the framework of the High-Luminosity LHC project. A first series of coils was assembled and tested in 5 assemblies of the HQ01 series. The HQ01e model achieved a maximum gradient of 170 T/m at 4.5 K at LBNL in 2010-2011 and reached 184 T/m at 1.9 K at CERN in 2012. A new series of coils incorporating major design changes was fabricated for the HQ02 series. The first model, HQ02a, was tested at Fermilab where it reached 98% of the short sample limit at 4.5 K with a gradient of 182 T/m in 2013. However, the full training of the coils at 1.9 K could not be performed due to a current limit of 15 kA. Following this test, the azimuthal coil pre-load was increased by about 30 MPa and an additional current lead was installed at the electrical center of the magnet for quench protection studies. The test name of this magnet changed to HQ02b. In 2014, HQ02b was then shipped to CERN as the first opportunity for f...

  20. 19 CFR 212.01 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Purpose. 212.01 Section 212.01 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions § 212.01 Purpose. (a) The Equal Access to...

  1. Effect of superimposed low frequency oscillations on the static creep behaviour of Al-1 wt%Si and Al-1 wt%Si-0.1 wt%Zr-0.1 wt%Ti alloys

    Energy Technology Data Exchange (ETDEWEB)

    Beshai, M.H.N. [Ain Shams Univ., Cairo (Egypt). Dept. of Physics; Deaf, G.H. [Ain Shams Univ., Cairo (Egypt). Dept. of Physics; Abd El Khalek, A.M. [Ain Shams Univ., Cairo (Egypt). Dept. of Physics; Graiss, G. [Ain Shams Univ., Cairo (Egypt). Dept. of Physics; Kenawy, M.A. [Physics Dept., University Coll. for Women, Ain Shams Univ., Cairo (Egypt)

    1997-05-16

    Torsional oscillations of increasing frequencies with constant torsional strain amplitude, {theta}, of 3.1 x 10{sup -4} were superimposed on wires of Al-1 wt% Si and Al-1 wt% Si-0.1 wt% Zr-0.1 wt% Ti alloys, while being crept under constant stress (52.3 MPa) and different testing temperatures. It was found that increasing the frequency of oscillations resulted in an increase of both transient and steady state creep. In the transient stage, while the exponent n is increasing with frequency v, the parameter {beta} decreases. Zirconium and titanium addition generally reduced the rate of creep. A value of 20 kJ/mol was found for the activation energy of the mechanism operating in the transient and steady state stages which was ascribed as being due to dislocation intersection. (orig.)

  2. Spectroscopy of deep doping levels in Cd{sub 0.99}Mn{sub 0.01}Te:Ga; Spektroskopia glebokich poziomow domieszkowych w Cd{sub 0.99}Mn{sub 0.01}Te:Ga

    Energy Technology Data Exchange (ETDEWEB)

    Szatkowski, J.; Placzek-Popko, E.; Sieranski, K. [Politechnika Wroclawska, Wroclaw (Poland); Bieg, B. [Wyzsza Szkola Morska, Szczecin (Poland)

    1997-12-01

    The investigation results of deep energy levels in Cd{sub 0.99}Mn{sub 0.01}Te (n-type) doped with gallium have been presented. Deep level transient spectroscopy (DLTS) measurements have been carried out in temperature range 80-420 K. The results show five types of electron traps. The activation energy of trapping levels and electron trapping cross-sections have been determined for observed traps. 2 refs, 3 figs, 1 tab.

  3. Structural, magnetic and magnetocaloric properties of La{sub 0.7}Ca{sub 0.2}Sr{sub 0.1}Mn{sub 1−x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1

    Energy Technology Data Exchange (ETDEWEB)

    Dhahri, Ah., E-mail: dhahri.ahmad@outlook.fr [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Jemmali, M. [Laboratoire des Sciences des Matériaux et de l’Environnement, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Taibi, K. [Département SDM, FGMGP/USTHB, 16311 (Algeria); Dhahri, E. [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Hlil, E.K. [Institut Néel, CNRS et Université J. Fourier, BP 166, 38042 Grenoble (France)

    2015-01-05

    Highlights: • The samples crystallize in the rhombohedral structure with the R3{sup ¯}c space group. • Enhancement of T{sub C} for the rhombohedral samples. • The relative cooling power increases with Cr-doping. • All samples exhibit a large magnetocaloric effect. • High values of the magnetoresistance in all samples. - Abstract: Structural, magnetic and magnetocaloric properties of La{sub 0.7}Sr{sub 0.1}Ca{sub 0.2}Mn{sub 1−x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1 have been investigated to shed light on Cr-doping influence. X-ray diffraction studies show that all samples crystallize in the rhombohedral symmetry with R3{sup ¯}c space group. Rietveld refinement structure shows that the insertion of Cr in Mn network modifies the structural parameters such as the volume, Mn–O–Mn angles and the Mn–O bond length. The substitution of Mn by Cr decreases the 2p-3d hybridization between O and Mn ions, reduces the bandwidth and increases the electron–phonon coupling. The investigation of magnetic and magnetocaloric properties reveals that the samples exhibit a paramagnetic(PM)–ferromagnetic (FM) transition with decreasing Curie temperature (T{sub C}) from 294 K to 255 K when Cr doping level increases. The magnetic entropy change (ΔS{sub M}{sup max}) also decreases from 6.20 J kg{sup −1} K{sup −1} for x = 0 to3.80 J kg{sup −1} K{sup −1} for x = 0.1, while the relative cooling power (RCP) increases from 234.5 to 240 J kg{sup −1}, respectively, under a magnetic field of 5 T. These outcomes suggest that Mn-site Cr doping inhibits the enhancement of the magnetocaloric effect in some perovskite manganites. This is explained by the weakening of the ferromagnetic double-exchange interaction between Mn{sup 3+} and Mn{sup 4+} ions.

  4. 21 CFR 1311.01 - Scope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Scope. 1311.01 Section 1311.01 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE REQUIREMENTS FOR ELECTRONIC ORDERS AND PRESCRIPTIONS (Eff. 6.... For the convenience of the user, the revised text is set forth as follows: § 1311.01 Scope. This part...

  5. Acquisition and evaluation of thermodynamic data for bieberite-moorhouseite equilibria at 0.1 MPa

    Science.gov (United States)

    Chou, I.-Ming; Seal, R.R.

    2005-01-01

    Published estimates for the equilibrium relative humidity (RH) at 25 deg;C for the reaction: bieberite (CoSO4??7H2O) = moorhouseite (CoSO4??6H2O) + H2O, range from 69.8 to 74.5%. To evaluate these data, the humidity-buffer technique was used to determine equilibrium constants for this reaction between 14 and 43 ??C at 0.1 MPa. Reversals along five humidity-buffer curves yield In K = 18.03-6509.43/T, where K is the equilibrium constant, and T is temperature in K. The derived standard Gibbs free energy of reaction is 9.43 kJ/mol, which agrees well with several previously reported values based on vapor-pressure measurements. It also agrees well with values calculated from the data derived mostly from calorimetric measurements. Previous studies indicated that the temperature of the invariant point for the assemblage bieberite-moorhouseite-aqueous solution-vapor is near 44.7 ??C, and our extrapolated data predict 91.1% RH at this temperature; the predicted position for the invariant point is in excellent agreement with those reported previously.

  6. The modulation of erythrocyte Na+/K+-ATPase activity by curcumin

    Directory of Open Access Journals (Sweden)

    Prabhakar Singh

    2015-11-01

    Full Text Available Curcumin, an active biphenolic molecule present in turmeric (Curcuma longa, has been reported to elicit plethora of health protective effects. The present study was carried out in vitro, in vivo and in silico to investigate the modulatory effects of curcumin on erythrocyte membrane Na+/K+-ATPase activity. In vitro curcumin (10−5 M to 10−8 M was incubated with human erythrocytes membrane. In vivo curcumin (340 mg/kg b.w. and 170 mg/kg b.w. was supplemented to wistar rats for 21 days. In silico, catalytic unit α of Na+/K+-ATPase (3b8e.pdb protein was used as a receptor for the natural ligand ATP to study curcumin-mediated docking simulation using AutoDock4. The in vitro effect of curcumin on the Na+/K+-ATPase activity in human erythrocytes was biphasic. An inhibitory response was observed at 10−5 M (p < 0.001. An activation of the Na+/K+-ATPase activity was observed at 10−7 and 10−8 M (p < 0.001 and p < 0.01. In vivo, curcumin supplementation to rats increased the Na+/K+-ATPase activity at doses 340 mg/kg b.w. (p < 0.001 as well as at 170 mg/kg b.w., (p < 0.01. AutoDock4 docking simulation study showed that both ligands curcumin and ATP actively interacted with amino acids Glu214, Ser215, Glu216, Thr371, Asn377, Arg378, Met379, Arg438, Val440, Ala444, Lys451 and Asp586 at the catalytic cavity of Na+/K+-ATPase. ATP had more H bonding and hydrophobic interaction with active site amino acid residues compared to curcumin. These finding may explain some of the health beneficial properties of curcumin associated with deregulated Na+/K+-ATPase activity or ions homeostasis.

  7. Production and biochemical characterization of α-glucosidase from Aspergillus niger ITV-01 isolated from sugar cane bagasse.

    Science.gov (United States)

    Del Moral, S; Barradas-Dermitz, D M; Aguilar-Uscanga, M G

    2018-01-01

    Aspergillus niger ITV-01 presents amylolytic activity, identified as α-glucosidase, an enzyme that only produces α-d-glucose from soluble starch and that presents transglucosylase activity on α-d-glucopyranosyl-(1-4)-α-d-glucopyranose (maltose) (200 gL -1 ). Biochemical characterization was performed on A. niger ITV-01 α-glucosidase; its optimum parameters were pH 4.3, temperature 80 °C but stable at 40 °C, with an energy of activation (Ea) 176.25 kJ mol -1 . Using soluble starch as the substrate, K m and V max were 5 mg mL -1 and 1000 U mg -1 , respectively. As α-glucosidase is not a metalloenzyme, calcium and EDTA did not have any effect on its activity. The molecular weight was estimated by SDS-PAGE to be about 75 kDa. It was also active in methanol and ethanol. When ammonium sulfate (AS) and yeast extract (YE) nitrogen sources and calcium effect were evaluated, the greatest activity occurred using YE and calcium, as opposed to AS media where no activity was detected. The results obtained showed that this enzyme has industrial application potential in the processes to produce either ethanol or malto-oligosaccharides from α-d-glucopyranosyl-(1-4)-α-d-glucopyranose (maltose).

  8. The 150 kV cp microfocus X-ray unit

    NARCIS (Netherlands)

    Fontijn, L.A.

    1979-01-01

    Development of microfocus X-ray technique is defined. Advantages on other methods, principle of operation and the material comprising an intense electron source imaged on an X-ray target by means of a double magnetic lense system, are described. Resolution value at 150 kV is the imaging of a 0.1 mm

  9. Quasi-resonant K-K charge transfer

    International Nuclear Information System (INIS)

    Hagmann, S.; Cocke, C.L.; Richard, P.; Skutlartz, A.; Kelbch, S.; Schmidt-Boecking, H.; Schuch, R.

    1983-01-01

    The impact parameter dependence, P(b), of single and double K to K charge transfer have been deduced from the coincidences between K-Auger electrons and scattered particles for F 9+ + Ne and F 9+ + Ne collisions at 10 MeV and 4.4 MeV. The 4.4 MeV single K-K transfer probability exhibits oscillations with b. The P(b) for delta-electron emission is also reported. To obtain more details on the mechanism, K-Auger electron-Ne recoil ion coincidences are measured for both F 8+ and F 9+ projectiles. The relative amounts of recoil ions and of satellite and hypersatellite Auger transitions vary substantially with projectile charge state. 11 references, 11 figures

  10. Effect of sintering temperature on structural and electrical properties of gadolinium doped ceria (Ce0.9Gd0.1O1.95)

    DEFF Research Database (Denmark)

    Jadhav, L. D.; Pawar, S. H.; Chourashiya, M. G.

    2007-01-01

    Gadolinium doped ceria oxide is one of the promising materials as an electrolyte for IT-SOFCs. Ce0.9Gd0.1O1.95 (GDC10) powder was prepared by solid state reaction and sintered at 1473 K, 1573 K, 1673 K and 1773 K All samples were studied using X-ray diffraction, scanning electron micrograph and d...

  11. Absolute linear thermal-expansion measurements on copper and aluminum from 5 to 320 K

    International Nuclear Information System (INIS)

    Kroeger, F.R.; Swenson, C.A.

    1977-01-01

    A linear absolute dilatometer based on a three-terminal parallel-plate capacitor design has been used to obtain thermal expansion data for high-purity copper and aluminum from 5 to 320 K. These data have an absolute accuracy of +- 0.1% above 20 K for copper and above 30 K for aluminum, and agree well with published data at the higher temperatures. The disagreement which exists with other data below 5 K for copper and below 15 K for aluminum is believed to be sample dependent, but the mechanism is not known. The aluminum results in this region depend on the state of annealing of the sample

  12. Spectroscopy of deep doping levels in Cd0.99Mn0.01Te:Ga

    International Nuclear Information System (INIS)

    Szatkowski, J.; Placzek-Popko, E.; Sieranski, K.; Bieg, B.

    1997-01-01

    The investigation results of deep energy levels in Cd 0.99 Mn 0.01 Te (n-type) doped with gallium have been presented. Deep level transient spectroscopy (DLTS) measurements have been carried out in temperature range 80-420 K. The results show five types of electron traps. The activation energy of trapping levels and electron trapping cross-sections have been determined for observed traps. 2 refs, 3 figs, 1 tab

  13. Development of Non-LOCA Safety Analysis Methodology with RETRAN-3D and VIPRE-01/K

    International Nuclear Information System (INIS)

    Kim, Yo-Han; Cheong, Ae-Ju; Yang, Chang-Keun

    2004-01-01

    Korea Electric Power Research Institute has launched a project to develop an in-house non-loss-of-coolant-accident analysis methodology to overcome the hardships caused by the narrow analytical scopes of existing methodologies. Prior to the development, some safety analysis codes were reviewed, and RETRAN-3D and VIPRE-01 were chosen as the base codes. The codes have been modified to improve the analytical capabilities required to analyze the nuclear power plants in Korea. The methodologies of the vendors and the Electric Power Research Institute have been reviewed, and some documents of foreign utilities have been used to compensate for the insufficiencies. For the next step, a draft methodology for pressurized water reactors has been developed and modified to apply to Westinghouse-type plants in Korea. To verify the feasibility of the methodology, some events of Yonggwang Units 1 and 2 have been analyzed from the standpoints of reactor coolant system pressure and the departure from nucleate boiling ratio. The results of the analyses show trends similar to those of the Final Safety Analysis Report

  14. 21 CFR 886.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 886.9 Section 886.9 Food and Drugs FOOD AND DRUG... Provisions § 886.9 Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act...

  15. 21 CFR 874.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 874.9 Section 874.9 Food and Drugs FOOD AND DRUG... Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510(k) of the...

  16. 21 CFR 872.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 872.9 Section 872.9 Food and Drugs FOOD AND DRUG... Provisions § 872.9 Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act...

  17. 21 CFR 870.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 870.9 Section 870.9 Food and Drugs FOOD AND DRUG... Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510(k) of the...

  18. 21 CFR 868.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 868.9 Section 868.9 Food and Drugs FOOD AND DRUG... Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510(k) of the...

  19. 21 CFR 888.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 888.9 Section 888.9 Food and Drugs FOOD AND DRUG... Provisions § 888.9 Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act...

  20. 21 CFR 892.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 892.9 Section 892.9 Food and Drugs FOOD AND DRUG... Provisions § 892.9 Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act...

  1. 21 CFR 882.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 882.9 Section 882.9 Food and Drugs FOOD AND DRUG... Provisions § 882.9 Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act...

  2. 22 CFR 231.01 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 231.01 Section 231.01 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS...

  3. Study of $B^+_c$ decays to the $K^+K^-\\pi^+$ final state and evidence for the decay $B^+_c\\to\\chi_{c0}\\pi^+$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stenzel Martins, Julian; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2016-11-30

    A study of $B_c^+\\to K^+K^-\\pi^+$ decays is performed for the first time using data corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. Evidence for the decay $B_c^+\\to\\chi_{c0}(\\to K^+K^-)\\pi^+$ is reported with a significance of 4.0 standard deviations, resulting in the measurement of $\\frac{\\sigma(B_c^+)}{\\sigma(B^+)}\\times\\mathcal{B}(B_c^+\\to\\chi_{c0}\\pi^+)$ to be $(9.8^{+3.4}_{-3.0}(\\mathrm{stat})\\pm 0.8(\\mathrm{syst}))\\times 10^{-6}$. Here $\\mathcal{B}$ denotes a branching fraction while $\\sigma(B_c^+)$ and $\\sigma(B^+)$ are the production cross-sections for $B_c^+$ and $B^+$ mesons. An indication of $\\overline b c$ weak annihilation is found for the region $m(K^-\\pi^+)<1.834\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, with a significance of 2.4 standard deviations.

  4. Study on the thermoluminescent properties of K2YF5 and K2GdF5 crystals doped with optically active trivalent ions for gamma and neutrons dosimetry

    International Nuclear Information System (INIS)

    Silva, Edna Carla da

    2008-01-01

    In this work, the thermoluminescent (TL) properties of both double potassium yttrium fluoride (K 2 YF 5 ) and double potassium gadolinium fluoride (K 2 GdF 5 ) crystals doped with optically active rare earth ions were investigated from the point of view of gamma and neutron dosimetry. Crystalline platelets with thickness of about 1 mm, synthesized under hydrothermal conditions, were irradiated in order to study TL sensitivity, as well as dose and energy response, reproducibility and fading, in terms of Ce 3+ , Tb 3+ , Dy 3+ , e Pr 3+ concentrations. The K 2 YF 5 crystals doped with 1.0 at por cent Dy 3+ have been found to have an excellent linear TL response to X and gamma photons, in the range of 0.01 to 10 mGy. The TL output is comparable to that of CaS0 4 :Mn dosemeters. The main peak at 130 deg C has been found to have a TL response for 41.1 keV X-ray energy 32 times higher than that for 662 keV gamma rays. This fact points out that the K 2 Y 0.99 Dy 0.01 F 5 crystals have great potential for X-rays diagnostic and/or industrial radiography. On the other hand, the K 2 GdF 5 crystals doped with 5.0 at por cent Dy 3+ have been found to have the better TL response for gamma and fast neutron radiation, among the dopants studied. For gamma fields the TL response was linear for doses ranging from 0.1 to 200 mGy. The TL peak around 200 deg C can be deconvoluted into four individual peaks, all of them with linear behavior. For fast neutron radiation produced by an 241 Am B e source, the TL responses for doses ranging from 0.6 to 12 mSv were also linear and comparable to that of commercial TLD-600, irradiated at same conditions. The TL emission due to neutrons was in the high temperature range, above 200 deg C. These results points out that K 2 Gd 0.95 Dy 0.05 F 5 crystals are good candidates for use in neutron dosimetry applications. (author)

  5. Adventures with the K anti K system

    International Nuclear Information System (INIS)

    Cason, N.M.

    1975-01-01

    The status of the new generation of K anti K experiments is reviewed. The reactions discussed are of the type πN → K anti KN. The general characteristics of the K anti K system which make it interesting and unique, the results of the first generation of experiments, and finally the status of the current experiments and some plans for future analyses

  6. Different DRB1*03:01-DQB1*02:01 haplotypes confer different risk for celiac disease.

    Science.gov (United States)

    Alshiekh, S; Zhao, L P; Lernmark, Å; Geraghty, D E; Naluai, Å T; Agardh, D

    2017-08-01

    Celiac disease is associated with the HLA-DR3-DQA1*05:01-DQB1*02:01 and DR4-DQA1*03:01-DQB1*03:02 haplotypes. In addition, there are currently over 40 non-HLA loci associated with celiac disease. This study extends previous analyses on different HLA haplotypes in celiac disease using next generation targeted sequencing. Included were 143 patients with celiac disease and 135 non-celiac disease controls investigated at median 9.8 years (1.4-18.3 years). PCR-based amplification of HLA and sequencing with Illumina MiSeq technology were used for extended sequencing of the HLA class II haplotypes HLA-DRB1, DRB3, DRB4, DRB5, DQA1 and DQB1, respectively. Odds ratios were computed marginally for every allele and haplotype as the ratio of allelic frequency in patients and controls as ratio of exposure rates (RR), when comparing a null reference with equal exposure rates in cases and controls. Among the extended HLA haplotypes, the strongest risk haplotype for celiac disease was shown for DRB3*01:01:02 in linkage with DQA1*05:01-DQB1*02:01 (RR = 6.34; P-value celiac disease among non-Scandinavians (RR = 7.94; P = .011). The data also revealed 2 distinct celiac disease risk DR3-DQA1*05:01-DQB*02:01 haplotypes distinguished by either the DRB3*01:01:02 or DRB3*02:02:01 alleles, indicating that different DRB1*03:01-DQB1*02:01 haplotypes confer different risk for celiac disease. The associated risk of celiac disease for DR3-DRB3*01:01:02-DQA1*05:01-DQB1*02:01 is predominant among patients of Scandinavian ethnicity. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  7. 40 CFR 191.01 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... wastes at any facility regulated by the Nuclear Regulatory Commission or by Agreement States, to the... storage of spent nuclear fuel or high-level or transuranic wastes at any disposal facility that is... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 191.01 Section 191.01...

  8. K-KIDS: K Dwarfs and Their Companions. First Results from Radial Velocity Survey with CHIRON Spectrograph

    Science.gov (United States)

    Paredes, Leonardo; Henry, Todd; Nusdeo, Daniel; Winters, J.; Dincer, Tolga

    2018-01-01

    We present the K-KIDS project, an effort to survey a large sample of K dwarfs and their companions, the KIDS. We are observing a carefully vetted equatorial sample (DEC = -30 to +30) of more than 1000 K dwarfs within 50 pc to make a comprehensive assessment of stellar, substellar and planetary companions with separations of 0.1 to 10,000 AU.The initial sample of 1048 stars has been compiled using astrometric data from Hipparcos and photometric data from Tycho-2 and 2MASS. Four different imaging and spectroscopic surveys are underway. Here we present the strategy and initial results for our high-precision radial velocity survey for the closest companions using the CHIRON spectrograph on the CTIO/SMARTS 1.5m telescope. Individual measurements with CHIRON at R = 80,000 using ThAr wavelength calibration, indicate that for K dwarf radial velocity standards with V = 5.8, 7.0 and 8.0 yield precisions over 6 weeks of observing of 7.4 m/s, 9.8 m/s and 5.7 m/s. In the first two months, a core sample of 42 K dwarfs, including carefully selected calibration systems as well as previously unobserved stars, was observed every few nights to detect the radial velocity signals of close companions. In our calibration stellar systems, we have confirmed the suitability of CHIRON for our studies, by having found periodic radial velocity perturbations consistent with hot Jupiter and stellar companions previously detected. This set forms the foundation of our one-year survey of 100 K dwarfs with magnitudes as faint as V = 11.5, for which we should detect companions with masses as low as Jupiter.In light of the promising performance and efficiency of the CHIRON spectrograph for a long-term radial velocity survey, we have expanded our initial sample using Gaia Data Release 1 to 1824 K dwarfs within 50 pc. Ultimately, the combination of all four surveys will provide an unprecedented portrait of K dwarfs and their kids.This effort has been supported by the NSF through grant AST-1517413, and

  9. Hypernuclear spectroscopy with the (e, e-prime K+) reaction

    Energy Technology Data Exchange (ETDEWEB)

    Yu Fujii

    2003-06-16

    Experimental conditions of the (e,e'K+) reaction for hypernuclear spectroscopy at Jefferson Lab Hall C are considered. Then two hypernuclear experiments at Hall C, Jlab E89-009 and E01-011 are introduced and compared, and possibility to extract information on hypernuclear states are discussed by referring expected spectra obtained with a DWIA calculation.

  10. Differential branching fraction and angular moments analysis of the decay $B^0 \\to K^+ \\pi^- \\mu^+ \\mu^-$ in the $K^*_{0,2}(1430)^0$ region

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2016-12-15

    Measurements of the differential branching fraction and angular moments of the decay $B^0 \\to K^+ \\pi^- \\mu^+ \\mu^-$ in the $K^*_{0,2}(1430)^0$ in the $K^+\\pi^-$ invariant mass range $1330 < m (K^+ \\pi^-) <1530~ \\text{MeV}/c^2$ are presented. Proton-proton collision data are used, corresponding to an integrated luminosity of 3 fb$^{-1}$ collected by the LHCb experiment. Differential branching fraction measurements are reported in five bins of the invariant mass squared of the dimuon system, $q^2$, between 0.1 and 8.0 $\\text{GeV}^2/c^4$. For the first time, an angular analysis sensitive to the S-, P- and D-wave contributions of this rare decay is performed. The set of 40 normalised angular moments describing the decay is presented for the $q^2$ range $1.1-6.0 \\text{GeV}^2/c^4$.

  11. Study and application of k0-IAEA program on the Dalat Research Reactor

    International Nuclear Information System (INIS)

    Cao Dong Vu; Tran Quang Thien; Nguyen Thi Sy; Ho Manh Dung; Nguyen Nhi Dien

    2011-01-01

    The pneumatic 7-1 and rotary rack (lazy susan) facilities are two main irradiation channels for neutron activation analysis at Dalat research reactor. The experiments for characterizing these two irradiation facilities at June, July and August, 2010 by k 0 -IAEA using Al-0.1% Au, Al-0.1% Lu, 99.98% Ni and 99.8% Zr monitors were done. The neutron spectrum parameters include: (1) Thermal neutron flux (Φ th ); (2) The ratio between thermal neutron flux and epi-thermal neutron flux (f); (3) The α factor describing the neutron flux distribution 1/E 1+α , and (4) The neutron temperature (T n ). This study provides the first database for further studying and applying k 0 -IAEA at Dalat Research Reactor in the future. (author)

  12. Analysis of the differential cross sections for the reaction pp→ppK+K- in view of the K+K- interaction

    International Nuclear Information System (INIS)

    Silarski, M.

    2008-07-01

    Measurements of the pp→ppK + K - reaction, performed with the experiment COSY-11 at the Cooler Synchrotron COSY, show a significant difference between the obtained excitation function and theoretical expectations including pp-FSI. The discrepancy may be assigned to the influence of K + K - or K - p interaction. This interaction should manifest itself in the distributions of the differential cross section. This thesis presents an analysis of event distributions as a function of the invariant masses of two particle subsystems. In particular in the analysis two generalizations of the Dalitz plot proposed by Goldhaber and Nyborg are used. The present Investigations are based on the experimental data determined by the COSY-11 collaboration from two measurements at excess energies of Q=10 MeV and 28 MeV. The experimental distributions are compared to results of Monte Carlo simulations generated with various parameters of the K + K - and K - p interaction. The values of the K + K - scattering length, extracted from two data sets for Q=10 MeV and 28 MeV amount to: a K + K - =(11±8)+i(0±6) fm for Q=10 MeV, and a K + K - =(0.2±0.2)+i(0.0±0.5) fm for Q=28 MeV. Due to the low statistics, the extracted values have large uncertainties and are consistent with very low values of the real and imaginary part of the scattering length. (orig.)

  13. 21 CFR 111.353 - What are the requirements under this subpart K for written procedures?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What are the requirements under this subpart K for written procedures? 111.353 Section 111.353 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN...

  14. 21 CFR 111.375 - Under this subpart K, what records must you make and keep?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Under this subpart K, what records must you make and keep? 111.375 Section 111.375 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN...

  15. Amplitude analysis of the K-K+ system produced in the reactions π-p → K-K+N and π+N → K-K+p at 6 GeV/c

    International Nuclear Information System (INIS)

    Cohen, D.; Ayres, D.S.; Diebold, R.; Kramer, S.L.; Pawlicki, A.J.; Wicklund, A.B.

    1978-06-01

    An amplitude analysis of the K - K + system produced in the reactions π - p → K - K + n and π + n → K - K + p was carried out using data from a high statistics experiment carried out with the Argonne Effective Mass Spectrometer. Combining the results from the two reactions allows the separation of the KantiK production amplitudes into their isospin-zero and one components. An enhancement is deserved in the S-wave amplitude near 1300 MeV which we call the S'. Using various physical arguments, including the t dependence of the amplitudes, six out of eight mathematically-allowed solutions can be eliminated for the magnitudes and phases of the amplitudes and shown that this new S-wave state has isospin zero. Requiring a reasonable behavior for the isospin-one P wave shows that the S' amplitude has a slow phase variation through the peak region

  16. Dalitz plot analysis of the $D^+ \\rightarrow K^- K^+ K^+$ decay with the isobar model

    CERN Document Server

    The LHCb Collaboration

    2016-01-01

    This note presents a study of the $K^-K^+$ S-wave amplitude in doubly Cabibbo-suppressed ${D^+ \\rightarrow K^- K^+ K^+}$ decays performed using $2 \\text{fb}^{-1}$ of data collected by the LHCb detector in $pp$ collisions at $8~\\text{TeV}$ centre-of-mass energy. The Dalitz plot is studied under the assumption of the isobar model for resonance scattering. Models with combinations of resonant states are tested. Fits of comparable quality are obtained for different $K^-K^+$ S-wave parameterizations. The results obtained indicate that a variation of the S-wave phase at both ends of $K^-K^+$ spectrum is needed to describe the data. Further studies beyond the näive isobar model are foreseen to understand the $K^-K^+$ S-wave.

  17. National Land Cover Database 2001 (NLCD01) Imperviousness Layer Tile 3, Southwest United States: IMPV01_3

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the imperviousness layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition. The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp.. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  18. National Land Cover Database 2001 (NLCD01) Imperviousness Layer Tile 4, Southeast United States: IMPV01_4

    Science.gov (United States)

    Wieczorek, Michael; LaMotte, Andrew E.

    2010-01-01

    This 30-meter resolution data set represents the imperviousness layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition. The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp.. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  19. National Land Cover Database 2001 (NLCD01) Imperviousness Layer Tile 2, Northeast United States: IMPV01_2

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the imperviousness layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition. The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp.. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  20. National Land Cover Database 2001 (NLCD01) Imperviousness Layer Tile 1, Northwest United States: IMPV01_1

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the imperviousness layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition. The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp.. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  1. (Liquid + liquid) equilibria measurements for ternary systems (sulfolane + a carboxylic acid + n-heptane) at T = 303.15 K and at 0.1 MPa

    International Nuclear Information System (INIS)

    Cele, N.P.; Bahadur, I.; Redhi, G.G.; Ebenso, E.E.

    2016-01-01

    Highlights: • The (liquid + liquid) equilibrium for (sulfolane + a carboxylic acid + heptane) was measured. • Selectivity values for solvent separation efficiency were calculated. • Separation of carboxylic acids from heptane is feasible by extraction. • Three parameter equations have been fitted to the binodal curve data. • The NRTL and UNIQUAC models were used to correlate the experimental data. - Abstract: In the present work, new (liquid + liquid) equilibrium (LLE) values are reported for ternary systems {sulfolane(1) + acetic acid, or propanoic acid, or butanoic acid, or 2-methylpropanoic acid, or pentanoic acid, or 3-methylbutanoic acid (2) + n-heptane (3)} at T = 303.15 K and at p = 0.1 MPa. The mutual solubility of carboxylic acid in sulfolane is dependent on the length and structure of the alkyl chain of the carboxylic acid; it progressively increases with an increase in the alkyl chain of the carboxylic acid. The single phase homogenous region increases as the alkyl chain of the carboxylic acid increases. The n-heptane is most soluble in the carboxylic acid mixtures with long alkyl chain, that is, (3-methylbutanoic acid + sulfolane) and (pentanoic acid + sulfolane) systems and least soluble in the carboxylic acid with short alkyl chain (acetic acid + sulfolane) system. Carboxylic acid together with many other oxygenates and hydrocarbons are produced by SASOL Company in South Africa using the Fischer–Tropsch process. The details about this process are given in introduction section. The NRTL and UNIQUAC models were used to correlate the experimental tie-lines and to calculate the phase compositions of the ternary systems. It was found that the NRTL model fits the experimental values significantly better than the UNIQUAC model.

  2. Activation of K+ channels and Na+/K+ ATPase prevents aortic endothelial dysfunction in 7-day lead-treated rats

    International Nuclear Information System (INIS)

    Fiorim, Jonaina; Ribeiro Júnior, Rogério Faustino; Azevedo, Bruna Fernades; Simões, Maylla Ronacher; Padilha, Alessandra Simão; Stefanon, Ivanita; Alonso, Maria Jesus; Salaices, Mercedes; Vassallo, Dalton Valentim

    2012-01-01

    Seven day exposure to a low concentration of lead acetate increases nitric oxide bioavailability suggesting a putative role of K + channels affecting vascular reactivity. This could be an adaptive mechanism at the initial stages of toxicity from lead exposure due to oxidative stress. We evaluated whether lead alters the participation of K + channels and Na + /K + -ATPase (NKA) on vascular function. Wistar rats were treated with lead (1st dose 4 μg/100 g, subsequent doses 0.05 μg/100 g, im, 7 days) or vehicle. Lead treatment reduced the contractile response of aortic rings to phenylephrine (PHE) without changing the vasodilator response to acetylcholine (ACh) or sodium nitroprusside (SNP). Furthermore, this treatment increased basal O 2 − production, and apocynin (0.3 μM), superoxide dismutase (150 U/mL) and catalase (1000 U/mL) reduced the response to PHE only in the treated group. Lead also increased aortic functional NKA activity evaluated by K + -induced relaxation curves. Ouabain (100 μM) plus L-NAME (100 μM), aminoguanidine (50 μM) or tetraethylammonium (TEA, 2 mM) reduced the K + -induced relaxation only in lead-treated rats. When aortic rings were precontracted with KCl (60 mM/L) or preincubated with TEA (2 mM), 4-aminopyridine (4-AP, 5 mM), iberiotoxin (IbTX, 30 nM), apamin (0.5 μM) or charybdotoxin (0.1 μM), the ACh-induced relaxation was more reduced in the lead-treated rats. Additionally, 4-AP and IbTX reduced the relaxation elicited by SNP more in the lead-treated rats. Results suggest that lead treatment promoted NKA and K + channels activation and these effects might contribute to the preservation of aortic endothelial function against oxidative stress. -- Highlights: ► Increased free radicals production ► Increased Na + /K + ATPase activity ► Promotes activation of the K + channels and reduced vascular reactivity ► These effects preserve endothelial function against oxidative stress. ► Low concentrations constitute environmental

  3. Photoproduction of the K= K0-(1750)

    International Nuclear Information System (INIS)

    Mitchell, Ryan Edward

    2003-01-01

    While photoproduction has often been advertised as an important environment in which to study light meson spectroscopy, solid experimental results are sparse. In fact, beyond the relatively straightforward photoproduction of the ρ, ω, and ψ mesons, the few results of exclusive photoproduction that do exist are poorly understood, and several, perhaps, have even been misinterpreted. After extensively reviewing the sometimes tenuous history of the exclusive photoproduction of the ''p'(1600),'' the ''ωπ 0 (1250),'' the ''ω(1650),'' and the ''K + K - (1750),'' new results from the E831/FOCUS photoproduction experiment at Fermilab are presented which address the interpretation of the K + K - (1750). This enhancement in low-p T K + K - pairs at a mass near 1750 MeV/c 2 has been observed by several previous photoproduction experiments, but, despite several apparent inconsistencies, it has always been interpreted as the J PC = 1 -- ψ(1680) meson. With nearly two orders of magnitude more events than any previous observation of the K + K - (1750), and based on precise measurements of its mass and width, and its absence from the K*K final state, the FOCUS data can finally render this interpretation implausible. In addition, several steps have been taken towards establishing a new interpretation. Based on limited angular analyses of its decay and the beam energy dependence of its production, they argue that, in the absence of any wild interference scenarios, the K + K - (1750) has J PC ≠ 1 -- , and, in fact, the most likely assignment appears to be 2 ++ . It is hoped that this work can help set the stage for future reevaluations and new insights in photoproduction

  4. Signed star (k,k-domatic number of a graph

    Directory of Open Access Journals (Sweden)

    S. M. Sheikholeslami

    2014-01-01

    Full Text Available Let \\(G\\ be a simple graph without isolated vertices with vertex set \\(V(G\\ and edge set \\(E(G\\ and let \\(k\\ be a positive integer. A function \\(f:E(G\\longrightarrow \\{-1, 1\\}\\ is said to be a signed star \\(k\\-dominating function on \\(G\\ if \\(\\sum_{e\\in E(v}f(e\\ge k\\ for every vertex \\(v\\ of \\(G\\, where \\(E(v=\\{uv\\in E(G\\mid u\\in N(v\\}\\. A set \\(\\{f_1,f_2,\\ldots,f_d\\}\\ of signed star \\(k\\-dominating functions on \\(G\\ with the property that \\(\\sum_{i=1}^df_i(e\\le k\\ for each \\(e\\in E(G\\, is called a signed star \\((k,k\\-dominating family (of functions on \\(G\\. The maximum number of functions in a signed star \\((k,k\\-dominating family on \\(G\\ is the signed star \\((k,k\\-domatic number of \\(G\\, denoted by \\(d^{(k,k}_{SS}(G\\. In this paper we study properties of the signed star \\((k,k\\-domatic number \\(d_{SS}^{(k,k}(G\\. In particular, we present bounds on \\(d_{SS}^{(k,k}(G\\, and we determine the signed \\((k,k\\-domatic number of some regular graphs. Some of our results extend these given by Atapour, Sheikholeslami, Ghameslou and Volkmann [Signed star domatic number of a graph, Discrete Appl. Math. 158 (2010, 213-218] for the signed star domatic number.

  5. CIAE 600 kV ns pulse neutron generator

    International Nuclear Information System (INIS)

    Shen Guanren; Guan Xialing; Chen Hongtao

    2001-01-01

    The overall composition of CIAE 600 kV ns Pulse Neutron Generator (CPNG) are introduced, and its characteristic, main technological performance and application were also given. CPNG consists of high voltage power supply with highest output voltage 600 kV, direct current 15 mA, stability and ripple ≤0.1%, 2214 mm x 1604 mm x 1504 mm stainless steel high voltage electrode, built in head equipment uniform field accelerating tube, ns pulsed installation, turbomolecular vacuum pump system and drift pipes at 0 degree and 45 degree. Its characteristics are: (1) high current beam; (2) high current beam ns pulsed installation made use of low energy for chopper and high energy for buncher; (3) compactly laid out and simple in structure

  6. Cerebral bone subtraction CT angiography using 80 kVp and sinogram-affirmed iterative reconstruction: contrast medium and radiation dose reduction with improvement of image quality

    Energy Technology Data Exchange (ETDEWEB)

    Nagayama, Yasunori [Kumamoto City Hospital, Department of Radiology, Kumamoto (Japan); Kumamoto University, Department of Diagnostic Radiology, Chuo-ku, Kumamoto (Japan); Nakaura, Takeshi; Oda, Seitaro; Kidoh, Masafumi; Utsunomiya, Daisuke; Yamashita, Yasuyuki [Kumamoto University, Department of Diagnostic Radiology, Chuo-ku, Kumamoto (Japan); Tsuji, Akinori; Urata, Joji; Furusawa, Mitsuhiro; Yuki, Hideaki; Hirarta, Kenichiro [Kumamoto City Hospital, Department of Radiology, Kumamoto (Japan)

    2017-02-15

    The purpose of this study was to evaluate the feasibility of a contrast medium (CM), radiation dose reduction protocol for cerebral bone-subtraction CT angiography (BSCTA) using 80-kVp and sinogram-affirmed iterative reconstruction (SAFIRE). Seventy-five patients who had undergone BSCTA under the 120- (n = 37) or the 80-kVp protocol (n = 38) were included. CM was 370 mgI/kg for the 120-kVp and 296 mgI/kg for the 80-kVp protocol; the 120- and the 80-kVp images were reconstructed with filtered back-projection (FBP) and SAFIRE, respectively. We compared effective dose (ED), CT attenuation, image noise, and contrast-to-noise ratio (CNR) of two protocols. We also scored arterial contrast, sharpness, depiction of small arteries, visibility near skull base/clip, and overall image quality on a four-point scale. ED was 62% lower at 80- than 120-kVp (0.59 ± 0.06 vs 1.56 ± 0.13 mSv, p < 0.01). CT attenuation of the internal carotid artery (ICA) and middle cerebral artery (MCA) was significantly higher on 80- than 120-kVp (ICA: 557.4 ± 105.7 vs 370.0 ± 59.3 Hounsfield units (HU), p < 0.01; MCA: 551.9 ± 107.9 vs 364.6 ± 62.2 HU, p < 0.01). The CNR was also significantly higher on 80- than 120-kVp (ICA: 46.2 ± 10.2 vs 36.9 ± 7.6, p < 0.01; MCA: 45.7 ± 10.0 vs 35.7 ± 9.0, p < 0.01). Visibility near skull base and clip was not significantly different (p = 0.45). The other subjective scores were higher with the 80- than the 120-kVp protocol (p < 0.05). The 80-kVp acquisition with SAFIRE yields better image quality for BSCTA and substantial reduction in the radiation and CM dose compared to the 120-kVp with FBP protocol. (orig.)

  7. Density and viscosity of aqueous solutions of N,N-dimethylethanolamine at p = 0.1 MPa from T = (293.15 to 363.15) K

    Energy Technology Data Exchange (ETDEWEB)

    Bernal-Garcia, J. Manuel [Instituto Mexicano del Petroleo, Mexico D.F. C.P. 07330 (Mexico); Hall, Kenneth R. [Chemical Engineering Department, Texas A and M University, College Station, TX 77843 (United States); Estrada-Baltazar, Alejandro [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico); Iglesias-Silva, Gustavo A. [Departamento de Ingenieria Quimica, Instituto Tecnologico de Celaya, Celaya, Guanajuato, CP 38010 (Mexico)]. E-mail: gais@iqcelaya.itc.mx

    2005-08-15

    This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work.

  8. Density and viscosity of aqueous solutions of N,N-dimethylethanolamine at p = 0.1 MPa from T = (293.15 to 363.15) K

    International Nuclear Information System (INIS)

    Bernal-Garcia, J. Manuel; Hall, Kenneth R.; Estrada-Baltazar, Alejandro; Iglesias-Silva, Gustavo A.

    2005-01-01

    This work presents atmospheric density and viscosity values for (N,N-dimethylethanolamine + water) over the entire composition range from T (293.15 to 363.15) K for density and from T = (313.15 to 353.15) K for viscosity. Density measurements come from a vibrating tube densimeter while we have used three different Cannon-Fenske viscosimeters for the viscosity measurements. Excess molar volumes and viscosity deviations are calculated using a Redlich-Kister type equation. Excess molar volumes present negative deviations from ideality and viscosity deviations are positive at all temperatures and compositions in this work

  9. Effect of heating rates of crystallization behaviour of amorphous Fe/sub 83/01/B/sub 17/ alloy

    International Nuclear Information System (INIS)

    Ashfaq, A.; Shamim, A.

    1993-01-01

    The electric resistivity of amorphous Fe/sub 83/01/B/sub 17/ alloy has been measured to study its crystallization behaviour from room temperature to about 900 K at the constant heating rates of 40, 60 and 80 K/hr. The crystallization temperature was observed to increase with the increase of heating g rate. However amorphous to crystalline path of RT-curve between the maximum and the minimum decreases with heating rate. The Resistivity Temperature (RT) curves exhibit different steps which are shown to correspond to the phase change stages of the alloy. The slope of the rt-curve after the previous step increases with the rise in heating rate and finally passes through a board peak and then rises again. From the peak shift dta of first crystallization stage activation energy was calculated by applying various peak shift equations. The values so obtained were in good agreement with those obtained with DSC measurement for (FeM)/sub 83/01/B/sub 17/ amorphous alloys where M=Mo, Ni, Cr, and V. (author)

  10. An Investigation of the Magnetic Structure and Excitations in K2CoxFe1-xF4

    DEFF Research Database (Denmark)

    Higgins, S.A.; Couley, R.A.; Hagen, M.

    1984-01-01

    Neutron scattering techniques have been used to investigate the magnetic structure of K2CoxF1-xF4 with x=0.2 and x=0.6. The x=0.6 sample exhibits only one magnetic phase transition, at TN=92.2+or-0.1K. The x=0.2 sample has two magnetic phase transitions; below TN=66+or-1K the axial spin components...

  11. Quantum statistical properties of orthonormalized eigenstates of the operator (a-circumflex f (n-circumflex))k

    International Nuclear Information System (INIS)

    Wang Jisuo; Jian Feng; Liu Tangkun

    2002-01-01

    The completeness of the k orthonormalized eigenstates of the operator (a-circumflex f (n-circumflex)) k (k≥3) is investigated. We introduce a new kind of higher-order squeezing and an antibunching. The properties of the Mth-order squeezing and the antibunching effect of the k states are studied. The result shows that these states may form a complete Hilbert space, and the Mth-order (M=(n+1/2)k; n=0,1,...) squeezing effects exist in all of the k states when k is even. There is an antibunching effect in all of the states. An alternative method for constructing the k states is proposed, and the result shows that all of them can be generated by linear superposition of the time-dependent nonlinear coherent states at different instants. (author)

  12. Measurements of Branching Fractions in B -> phi K and B -> phi pi and Search for Direct CP Violation in B sup+- -> phi K sup+-

    CERN Document Server

    Telnov, A

    2003-01-01

    The present measurements of branching fractions in the b -> s(bar s)s penguin-dominated decays B sup + -> phi K sup + and B sup 0 -> phi K sup 0 in a sample of approximately 89 million B(bar B) pairs collected by the BABAR detector at the PEP-II asymmetric-energy B-meson Factory at SLAC. They determine BETA(B sup + -> phi K sup +) = (10.0 sub - sub 0 sub . sub 8 sup + sup 0 sup . sup 9 +- 0.5) x 10 sup - sup 6 and BETA(B sup 0 -> phi K sup 0) = (8.4 sub - sub 1 sub . sub 3 sup + sup 1 sup . sup 5 +- 0.5) x 10 sup - sup 6. Additionally, they measure the CP-violating charge asymmetry ALPHA sub C sub P (B sup+- -> phi K sup+-) = 0.04 +- 0.09 +- 0.01, with a 90% confidence-level interval of [-0.10, 0.18], and set an upper limit on the CKM- and color-suppressed decay B sup + -> phi pi sup + , BETA(B sup + -> phi pi sup +) < 0.41 x 10 sup - sup 6 (at the 90% confidence level).

  13. Power cables with extruded insulation and their accessories for rated voltages from 1 kV (Um = 1,2 kV) up to 30 kV (Um = 36 kV) : Part 2: cables for rated voltages from 6 kV (Um = 7,2 kV) up to 30 kV (Um = 36 kV)

    CERN Document Server

    International Electrotechnical Commission. Geneva

    2005-01-01

    Power cables with extruded insulation and their accessories for rated voltages from 1 kV (Um = 1,2 kV) up to 30 kV (Um = 36 kV) : Part 2: cables for rated voltages from 6 kV (Um = 7,2 kV) up to 30 kV (Um = 36 kV)

  14. Description of the ππ → ππ, ππ → K anti K and K anti KK anti K process in the framework of the N/D method

    International Nuclear Information System (INIS)

    Khenner, V.K.

    1978-01-01

    On the basis of the dispersion model the ππ → ππ, ππ → K anti K and K anti KK anti K processes in the state with I=J=.0 are studied. The processes are considered using the N/D matrix method, permitting to solve precisely the related system of dispersion ratios for the partial amplitudes. It is shown that the discovery of the inelastic channel can be effectively taken into account by the introduction of the CDD (Castillejo-Dality-Dyson) term into the elastic scattering amplitude. It is established, that at a given ππ → ππ amplitude the transition from the complete multichannel problem, considered by the matrix method, to the linear problem leads to the solution, where all arbitrary constants are fixed in the case when zeros of the ππ → K anti K and ππ → ππ amplitudes coincide. In this case the ππ → K anti K amplitude coincides with that obtained by the Omnes-Muskhelishvili method. Other processes, where the interaction in the initial or final state is insignificant, can be also studied by such a method not resulting in the appearance of additional arbitrary parameters. The consideration of the problem of a resonance position in various channels has shown, that the matrix method does not obligatorily result in the appearance of the resonance with the permitted quantum numbers in all the interconnected channels

  15. GPM Level 3 IMERG Monthly 0.1 x 0.1 degree V03

    Data.gov (United States)

    National Aeronautics and Space Administration — This Directory Interchange Format (DIF) describes a collection of fields for the GPM Level 3 IMERG Final Monthly 0.1 x 0.1 degree V03 (GPM_3IMERGM) at the NASA...

  16. Testing the QGSJET01 and QGSJETII-04 models with the help of atmospheric muons

    Science.gov (United States)

    Dedenko, Leonid G.; Lukyashin, Anton V.; Roganova, Tatiana M.; Fedorova, Galina F.

    2017-06-01

    More accurate original calculations of the atmospheric vertical muon energy spectra at energies 102 - 105 GeV have been carried out in terms of the QGSJET01 and QGSJETII-04 models. The Gaisser-Honda approximations of the measured energy spectra of primary protons, helium and nitrogen nuclei have been used. The CORSIKA package has been used to simulate cascades in the standard atmosphere induced by different primary particles with various fixed energies E. Statistics of simulated cascades for secondary particles with energies (0.01 - 1) · E was increased up to 106. It has been shown that predictions of the QGSJET01 and QGSJETII-04 models for these muon fluxes are below the data of the classical experiments L3 + Cosmic, MACRO and LVD by factors of ˜ 1.7-2 at energies above 102 GeV. It has been concluded that these tested models underestimate the production of the most energetic secondary particles, namely, π-mesons and K-mesons, in interactions of primary protons and other primary nuclei with nuclei in the atmosphere by the same factors.

  17. Neutron Diffraction Study On Gamma To Alpha Phase Transition In Ce0.9th0.1 Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Lashley, Jason C1 [Los Alamos National Laboratory; Heffner, Robert H [Los Alamos National Laboratory; Llobet, A [Los Alamos National Laboratory; Darling, T W [U OF NEVADA; Jeong, I K [PUSAN NATL UNIV

    2008-01-01

    Comprehensive neutron diffraction measurements were performed to study the isostructural {gamma} {leftrightarrow} {alpha} phase transition in Ce{sub 0.9}Th{sub 0.1} alloy. Using Rietveld refinements, we obtained lattice and thermal parameters as a function of temperature. From the temperature slope of the thermal parameters, we determined Debye temperatures {Theta}{sup {gamma}}{sub D} = 133(1) K and {Theta}{sup {alpha}}{sub D} = 140(1) K for the {gamma} phase and the {alpha} phase, respectively. This result implies that the vibrational entropy change is not significant at the {gamma} {leftrightarrow} {alpha} transition, contrary to that from elemental Cerium [Phys. Rev. Lett. 92, 105702, 2004].

  18. Temperature stimulates charge carriers in Ce0.90Fe0.1O2 for semiconductor to metal phase

    Science.gov (United States)

    Parveen, Mubeena; Saravanan, G.; Asvini, V.; Ravichandran, K.; Kalaiselvi, D.

    2018-04-01

    Ce0.90Fe0.1O2, cubic structure exhibits interesting electrical property-due to the effects of oxygen vacancies. Electrical response of nanocrystalline Ce0.90Fe0.1O2 material as a function of temperature was investigated using impedance spectroscopy. A change was observed in Nyquist plot for the temperature 903k, which has been analysed in terms of localized and delocalized electrons. An interesting behaviour of temperature stimulate semiconductor to metal like transition was observed in frequency dependent dielectric constant (ɛ') and frequency dependent dielectric loss(tan δ). Frequency dependence on the real and imaginary part of impedence with respect to temperature aids the presences of semiconductor to metal like transition in Ce0.90Fe0.1O2.

  19. 46 CFR 190.01-1 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 190.01-1 Section 190.01-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT Hull Structure § 190.01-1 Application. (a) The provisions of this subpart, with the exception of...

  20. Acetylcholinesterase Reactivators (HI-6, Obidoxime, Trimedoxime, K027, K075, K127, K203, K282: Structural Evaluation of Human Serum Albumin Binding and Absorption Kinetics

    Directory of Open Access Journals (Sweden)

    Filip Zemek

    2013-08-01

    Full Text Available Acetylcholinesterase (AChE reactivators (oximes are compounds predominantly targeting the active site of the enzyme. Toxic effects of organophosphates nerve agents (OPNAs are primarily related to their covalent binding to AChE and butyrylcholinesterase (BChE, critical detoxification enzymes in the blood and in the central nervous system (CNS. After exposure to OPNAs, accumulation of acetylcholine (ACh overstimulates receptors and blocks neuromuscular junction transmission resulting in CNS toxicity. Current efforts at treatments for OPNA exposure are focused on non-quaternary reactivators, monoisonitrosoacetone oximes (MINA, and diacylmonoxime reactivators (DAM. However, so far only quaternary oximes have been approved for use in cases of OPNA intoxication. Five acetylcholinesterase reactivator candidates (K027, K075, K127, K203, K282 are presented here, together with pharmacokinetic data (plasma concentration, human serum albumin binding potency. Pharmacokinetic curves based on intramuscular application of the tested compounds are given, with binding information and an evaluation of structural relationships. Human Serum Albumin (HSA binding studies have not yet been performed on any acetylcholinesterase reactivators, and correlations between structure, concentration curves and binding are vital for further development. HSA bindings of the tested compounds were 1% (HI-6, 7% (obidoxime, 6% (trimedoxime, and 5%, 10%, 4%, 15%, and 12% for K027, K075, K127, K203, and K282, respectively.

  1. Search for the decay B^0 --> K^0_S K^0_S K^0_L

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-06-27

    The authors present the first search for the decay B{sup 0} {yields} K{sub S}{sup 0} K{sub S}{sup 0} K{sub L}{sup 0} using a data sample of 232 million B{bar B} pairs. They find no statistically significant evidence for the non-resonant component of this decay. Our central value for the branching fraction, assuming the tru Dalitz distribution is uniform and excluding the {phi} resonance, is {Beta}(B{sup 0} {yields} K{sub S}{sup 0} K{sub S}{sup 0} K{sub L}{sup 0}) = (2.4{sub -2.5}{sup +2.7} {+-} 0.6) x 10{sup -6} where the errors are statistical and systematic, respectively. They set a single-side Bayesian upper limit of {Beta}(B{sup 0} {yields} K{sub S}{sup 0} K{sub S}{sup 0} K{sub L}{sup 0}) < 6.4 x 10{sup -6} at 90% confidence level using a uniform prior probability for physical values. Assuming the worst-case true Dalitz distribution, where the signal is entirely in the region of lowest efficiency, the 90% confidence level upper limit is {Beta}(B{sup 0} {yields} K{sub S}{sup 0} K{sub S}{sup 0} K{sub L}{sup 0}) < 14 x 10{sup -6}.

  2. 31 CFR 505.01 - Short title.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Short title. 505.01 Section 505.01 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF FOREIGN... CERTAIN MERCHANDISE BETWEEN FOREIGN COUNTRIES § 505.01 Short title. The regulations in this part may be...

  3. Observation of $\\pi^- K^+$ and $\\pi^+ K^-$ atoms

    CERN Document Server

    Adeva, B; The PS212 collaboration; Allkofer, Y.; Amsler, C.; Anania, A.; Aogaki, S.; Benelli, A.; Brekhovskikh, V.; Cechak, T.; Chiba, M.; Chliapnikov, P.; Doskarova, P.; Drijard, D.; Dudarev, A.; Dumitriu, D.; Fluerasu, D.; Gorin, A.; Gorchakov, O.; Gritsay, K.; Guaraldo, C.; Gugiu, M.; Hansroul, M.; Hons, Z.; Horikawa, S.; Iwashita, Y.; Karpukhin, V.; Kluson, J.; Kobayashi, M.; Kruglov, V.; Kruglova, L.; Kulikov, A.; Kulish, E.; Kuptsov, A.; Lamberto, A.; Lanaro, A.; Lednicky, R.; Marinas, C.; Martincik, J.; Nikitin, M.; Okada, K.; Olchevskii, V.; Pentia, M.; Penzo, A.; Plo, M.; Prusa, P.; Rappazzo, G.; Vidal, A.Romero; Ryazantsev, A.; Rykalin, V.; Saborido, J.; Sidorov, A.; Smolik, J.; Takeutchi, F.; Tauscher, L.; Trojek, T.; Trusov, S.; Urban, T.; Vrba, T.; Yazkov, V.; Yoshimura, Y.; Zhabitsky, M.; Zrelov, P.

    2016-01-01

    The observation of hydrogen-like $\\pi K$ atoms, consisting of $\\pi^- K^+$ or $\\pi^+ K^-$ mesons, is presented. The atoms have been produced by 24 GeV/$c$ protons from the CERN PS accelerator, interacting with platinum or nickel foil targets. The breakup (ionisation) of $\\pi K$ atoms in the same targets yields characteristic $\\pi K$ pairs, called ``atomic pairs'', with small relative momenta in the pair centre-of-mass system. The upgraded DIRAC experiment has observed $349\\pm62$ such atomic $\\pi K$ pairs, corresponding to a signal of 5.6 standard deviations.

  4. Superconductivity of k-(BEDT-TTF) sub 2 Cu[N(CN) sub 2]I under pressure

    CERN Document Server

    Kushch, N D; Yagubskii, E B; Ishiguro, T

    2001-01-01

    The insulating state of k-(BEDT-TTF) sub 2 Cu[N(CN) sub 2]I salt appearing at ambient pressure at low temperatures is suppressed by hydrostatic pressure. The resistive measurement showed that in high-quality crystals the emerging metallic state reveals superconductivity. The superconducting state with the transition temperature of about 8 K is stable at pressures higher than 0.1 GPa

  5. Rare decay modes of K*(1420) and K*(892)

    International Nuclear Information System (INIS)

    Jongejans, B.; Blokjijl, R.; Kluyver, J.C.; Massaro, G.G.G.; Voorthuis, H.; Engelen, J.J.; Metzger, W.J.; Pols, C.L.A.; Foster, B.; McDowell, L.; Wells, J.

    1978-01-01

    A 2.5 standard deviation signal is observed for the decay K* - (1420) → K* - (892)π + π - . From this signal a partial width of 13.0 +- 5.0 MeV for the decay mode K*(1420) → K*(892)ππ is deduced under the assumption that the ππ system is in an I = 1 state. For the rare decay mode K*(892) → Kππ no signal is observed. The following upper limits can be given for the decay widths: GAMMAsub(K* - (892) → K - π + π - ) - (892) → anti K 0 π - π 0 ) 0 (892) → anti K 0 π + π - ) < 35 keV. (Auth.)

  6. Magnetocaloric properties of Eu{sub 1−x}La{sub x}TiO{sub 3} (0.01 ≤ x ≤ 0.2) for cryogenic magnetic cooling

    Energy Technology Data Exchange (ETDEWEB)

    Rubi, Km; Midya, A.; Mahendiran, R., E-mail: phyrm@nus.edu.sg [Physics Department, Faculty of Science, National University of Singapore, 2 Science Drive 3, Singapore, Singapore 117551 (Singapore); Maheswar Repaka, D. V.; Ramanujan, R. V. [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore, Singapore 639798 (Singapore)

    2016-06-28

    We report magnetic and magnetocaloric (MCE) properties of polycrystalline Eu{sub 1−x}La{sub x}TiO{sub 3} samples over a wide composition range (0.01 ≤ x ≤ 0.20). It is found that the ground state changes from antiferromagnetic for x = 0.01 (T{sub N} = 5.2 K) to ferromagnetic for x ≥ 0.03 and the ferromagnetic Curie temperature increases from T{sub C} = 5.7 K for x = 0.03 to T{sub C} = 7.9 K for x = 0.20. The x = 0.01 sample shows a large reversible isothermal magnetic entropy change of −ΔS{sub m} = 23 (41.5) J/kg K and adiabatic temperature change of ΔT{sub ad} = 9 (17.2) K around 6.7 K for a field change of μ{sub 0}ΔH = 2 (5) Tesla. Although the peak value of −ΔS{sub m} decreases as La content increases, it is impressive in x = 0.2(−ΔS{sub m} = 31.41 J/kg K at T = 7.5 K for μ{sub 0}ΔH = 5 T). The large value of MCE arises from suppression of the spin entropy associated with the localized moment (J = 7/2) of Eu{sup 2+}:4f{sup 7} ions. This large MCE over a wide compositional range suggests that the Eu{sub 1−x}La{sub x}TiO{sub 3} series could be useful for magnetic cooling below 40 K.

  7. National Land Cover Database 2001 (NLCD01) Tree Canopy Layer Tile 4, Southeast United States: CNPY01_4

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the tree canopy layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition.jpg The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  8. National Land Cover Database 2001 (NLCD01) Tree Canopy Layer Tile 2, Northeast United States: CNPY01_2

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the tree canopy layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition.jpg The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  9. National Land Cover Database 2001 (NLCD01) Tree Canopy Layer Tile 1, Northwest United States: CNPY01_1

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the tree canopy layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition.jpg. The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov

  10. National Land Cover Database 2001 (NLCD01) Tree Canopy Layer Tile 3, Southwest United States: CNPY01_3

    Science.gov (United States)

    LaMotte, Andrew E.; Wieczorek, Michael

    2010-01-01

    This 30-meter resolution data set represents the tree canopy layer for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System, browse graphic: nlcd01-partition.jpg The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004) and http://www.mrlc.gov/mrlc2k.asp. The NLCD 2001 was created by partitioning the United States into mapping-zones. A total of 68 mapping-zones browse graphic: nlcd01-mappingzones.jpg were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping-zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  11. Ch(k) grammars: A characterization of LL(k) languages

    NARCIS (Netherlands)

    Becvar, J.; Nijholt, Antinus; Soisalon-Soininen, E.

    In this paper we introduce the class of so called Ch(k) grammars [pronounced "chain k grammars"]. This class of grammars is properly contained in the class of LR(k) grammars and it properly contains the LL(k) grammars. However, the family of Ch[k) languages coincides with the family of LL(k)

  12. Results from K2K experiment

    International Nuclear Information System (INIS)

    Yanagisawa, Chiaki

    2001-01-01

    The K2K experiment is the first long baseline neutrino oscillation experiment at KEK and at Kamioka, Japan. This is a brief summary of the K2K experiment in the first year of running from June 1999 to June 2000. The major result is that for the first time in human history artificially produced neutrinos by an accelerator are detected at a long distance of 250km from the production points. A brief introduction, the detector performance and the some analysis results are presented. The analysis results are based on the data corresponding to the integrated beam intesnsity of 2.29 x 10 19 pot

  13. Robust k-mer frequency estimation using gapped k-mers.

    Science.gov (United States)

    Ghandi, Mahmoud; Mohammad-Noori, Morteza; Beer, Michael A

    2014-08-01

    Oligomers of fixed length, k, commonly known as k-mers, are often used as fundamental elements in the description of DNA sequence features of diverse biological function, or as intermediate elements in the constuction of more complex descriptors of sequence features such as position weight matrices. k-mers are very useful as general sequence features because they constitute a complete and unbiased feature set, and do not require parameterization based on incomplete knowledge of biological mechanisms. However, a fundamental limitation in the use of k-mers as sequence features is that as k is increased, larger spatial correlations in DNA sequence elements can be described, but the frequency of observing any specific k-mer becomes very small, and rapidly approaches a sparse matrix of binary counts. Thus any statistical learning approach using k-mers will be susceptible to noisy estimation of k-mer frequencies once k becomes large. Because all molecular DNA interactions have limited spatial extent, gapped k-mers often carry the relevant biological signal. Here we use gapped k-mer counts to more robustly estimate the ungapped k-mer frequencies, by deriving an equation for the minimum norm estimate of k-mer frequencies given an observed set of gapped k-mer frequencies. We demonstrate that this approach provides a more accurate estimate of the k-mer frequencies in real biological sequences using a sample of CTCF binding sites in the human genome.

  14. Precipitation hardening of Zn0.1 at.%Ti single crystals deformed on the (0 0 0 1) system

    International Nuclear Information System (INIS)

    Boczkal, G.; Mikulowski, B.

    2004-01-01

    The mechanical properties (the critical resolved shear stress - CRSS, the work-hardening coefficient - θ A ) and a thermodynamic parameter (the activation volume--V*) have been studied in single crystals of Zn0.1 at.%Ti. The sample orientation allowed slip on the (0 0 0 1) system over a large range of strain. The investigations were conducted on samples which were both heat treated and not. The investigations were made using compression and stress relaxation tests in the range of easy glide at temperatures from 77 to 493 K. The single crystals appear to be hardened by precipitates while Ti solubility in Zn is negligible. Two types of the precipitates have been identified by TEM and microanalysis; very small precipitates were located uniformly in the matrix, and large needle-shaped obstacles with size of the order of 0.1 mm on the (0 0 0 1) orientation. The CRSS and the θ A showed a strong dependence on the temperature. The determined values of the CRSS were in the range of 4 MPa for 493 K to 12 MPa for 77 K. The obtained values of the activation volume V* were in the range of (10-110) x 10 -16 cm 3 and it was strongly dependent on the temperature and the stress at the beginning of relaxation. This value is attributed to small precipitates which are barriers for dislocation movement

  15. Measurement of the CKM angle γ using B 0 → DK *0 with D → K S 0 π + π - decays

    Science.gov (United States)

    Aaij, R.; Abellán Beteta, C.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M.-O.; van Beuzekom, M.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bitadze, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borsato, M.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Campora Perez, D.; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Castillo Garcia, L.; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Chen, S.; Cheung, S.-F.; Chobanova, V.; Chrzaszcz, M.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Dean, C.-T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Dijkstra, H.; Dordei, F.; Dorigo, M.; Dosil Suárez, A.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Déléage, N.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Fernandez Albor, V.; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Färber, C.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; García Pardiñas, J.; Garra Tico, J.; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianì, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gotti, C.; Grabalosa Gándara, M.; Graciani Diaz, R.; Granado Cardoso, L. A.; Graugés, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Grünberg, O.; Gushchin, E.; Guz, Yu.; Gys, T.; Göbel, C.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Heß, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Humair, T.; Hussain, N.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Kruse, F.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.-P.; Leflat, A.; Lefrançois, J.; Lefèvre, R.; Lemos Cid, E.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Likhomanenko, T.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, X.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Lucio Martinez, M.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Lyu, X.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Manning, P.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Marks, J.; Martellotti, G.; Martin, M.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; Meadows, B.; Meier, F.; Meissner, M.; Melnychuk, D.; Merk, M.; Michielin, E.; Milanes, D. A.; Minard, M.-N.; Mitzel, D. S.; Molina Rodriguez, J.; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Mordà, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mussini, M.; Muster, B.; Müller, D.; Müller, J.; Müller, K.; Müller, V.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Niess, V.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Osorio Rodrigues, B.; Otalora Goicochea, J. M.; Otto, A.; Owen, P.; Oyanguren, A.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Pappenheimer, C.; Parker, W.; Parkes, C.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Ramos Pernas, M.; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, S.; dos Reis, A. C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Rodriguez Lopez, J. A.; Rodriguez Perez, P.; Rogozhnikov, A.; Roiser, S.; Romanovskiy, V.; Romero Vidal, A.; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Ruiz Valls, P.; Saborido Silva, J. J.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M.-H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Silva Coutinho, R.; Silva de Oliveira, L.; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, E.; Smith, I. T.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefkova, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Tran, M. T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valat, S.; Valenti, G.; Vallier, A.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; van Veghel, M.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voß, C.; de Vries, J. A.; Vázquez Sierra, C.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Wilkinson, M.; Williams, M.; Williams, M. P.; Williams, M.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y.; Xu, Z.; Yang, Z.; Yin, H.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, Y.; Zhelezov, A.; Zheng, Y.; Zhokhov, A.; Zhong, L.; Zhukov, V.; Zucchelli, S.

    2016-08-01

    A model-dependent amplitude analysis of the decay B 0 → D( K S 0 π + π -) K ∗ 0 is performed using proton-proton collision data corresponding to an integrated luminosity of 3.0 fb-1, recorded at √{s}=7 and 8 TeV by the LHCb experiment. The CP violation observables x ± and y ±, sensitive to the CKM angle γ, are measured to be {x}-=-0.15± 0.14± 0.03± 0.01, {y}-=0.25± 0.15± 0.06± 0.01, {x}+=0.05± 0.24± 0.04± 0.01, {y}+=-{0.65}_{-0.23}^{+0.24}± 0.08± 0.01, where the first uncertainties are statistical, the second systematic and the third arise from the uncertainty on the D → K S 0 π + π - amplitude model. These are the most precise measurements of these observables. They correspond to γ = (80 - 22 + 21 ) ° and {r}_{B^0}=0.39± 0.13 , where {r}_{B^0} is the magnitude of the ratio of the suppressed and favoured B 0 → DK + π - decay amplitudes, in a Kπ mass region of ±50 MeV around the K *(892)0 mass and for an absolute value of the cosine of the K *0 decay angle larger than 0.4. [Figure not available: see fulltext.

  16. Secondary and tertiary structure of nucleotide-binding domain of alpha subunit of Na+/K+-ATPase

    Czech Academy of Sciences Publication Activity Database

    Hofbauerová, Kateřina; Kopecký ml., Vladimír; Ettrich, Rüdiger; Ettrichová, Olga; Amler, Evžen

    2002-01-01

    Roč. 67, 4-5 (2002), s. 242-246 ISSN 0006-3525 R&D Projects: GA ČR GA204/01/0254; GA ČR GA204/01/1001 Grant - others:Volkswagen Foundation(DE) I/74 679 Institutional research plan: CEZ:AV0Z5011922 Keywords : Na+/K+- ATPase * ATP binding * molecular modeling Subject RIV: BO - Biophysics Impact factor: 2.372, year: 2002

  17. Heat capacity and thermodynamics of solid and liquid pyridine-3-carboxylic acid (nicotinic acid) over the temperature range 296 K to 531 K

    International Nuclear Information System (INIS)

    Joseph, Abhinav; Bernardes, Carlos E.S.; Minas da Piedade, Manuel E.

    2012-01-01

    Highlights: ► We determined the heat capacity of solid and liquid nicotinic acid by DSC. ► We determined Δ 357.8K 305.6K H m o (NA,crII) by Calvet microcalorimetry. ► We studied the thermodynamics of the cr II → cr I phase transition. ► We determined the Δ f G m o –T diagram of nicotinic acid for T = (296 to 531) K. - Abstract: The molar heat capacity of pyridine-3-carboxylic acid (nicotinic acid) for T = (296 to 531) K was investigated by differential scanning calorimetry (DSC) and Calvet-drop microcalorimetry. The measurements extended up to the liquid range and also covered the interval where a reversible and fast solid-solid (cr II → cr I) phase transition occurs. The molar enthalpies and entropies of that phase transition and of fusion were obtained as T trs = (455.0 ± 0.2) K, Δ trs H m o = (0.90 ± 0.10) kJ ⋅ mol −1 , Δ trs S m o = (1.98 ± 0.22) J ⋅ K −1 ⋅ mol −1 , T fus = (509.91 ± 0.04) K, Δ fus H m o = (28.2 ± 0.1) kJ ⋅ mol −1 , and Δ fus S m o = (55.30 ± 0.16) J ⋅ K −1 ⋅ mol −1 . By combining these experimental results with the previously reported Δ sub H m (NA,cr II) at T = 366.5 K, the corresponding entropy in the gaseous state calculated at the B3LYP/6-31+G(d,p) level of theory, and Δ f H m o (NA),cr II) at T = 298.15 K, it was possible to estimate the standard molar Gibbs energy of formation functions necessary for the construction of the Δ f G m ∘ vs. T diagram illustrating the enantiotropic nature of this system.

  18. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  19. Nucleoli in human early erythroblasts (K2, K1, K1/2 cells).

    Science.gov (United States)

    Smetana, K; Jirásková, I; Klamová, H

    2005-01-01

    Human early erythroid precursors classified according to the nuclear size were studied to provide information on nucleoli in these cells using simple cytochemical procedures for demonstration of RNA and proteins of silver-stained nucleolar organizers. K2 cells with nuclear diameter larger than 13 microm and K1 cells with nuclear diameter larger than 9 microm corresponding to proerythroblasts and macroblasts (large basophilic erythroblasts) mostly possessed large irregularly shaped nucleoli with multiple fibrillar centres representing "active nucleoli". K1/2 cells with nuclear diameter smaller than 9 microm corresponding to small basophilic erythroblasts were usually characterized by the presence of micronucleoli representing "inactive nucleolar types". On the other hand, a few K1/2 cells contained large nucleoli with multiple fibrillar centres similar to those present in K2 cells and thus appeared as "microproerythroblasts". The nucleolar asynchrony expressed by the presence of large irregularly shaped nucleoli with multiple nucleoli (active nucleoli) and ring-shaped nucleoli (resting nucleoli) in one and the same nucleus of K2 or K1 cells was not exceptional and might reflect a larger resistance of these cells to negative factors influencing the erythropoiesis. The intranucleolar translocation of silver-stained nucleolus organized regions was noted in K2 cells and might indicate the premature aging of these cells without further differentiation. More studies, however, are required in this direction.

  20. Observation of a resonance in $B^+ \\to K^+ \\mu^+\\mu^-$ decays at low recoil

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Cowie, E; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    A broad peaking structure is observed in the dimuon spectrum of $B^+ \\to K^+ \\mu^+\\mu^-$ decays in the kinematic region where the kaon has a low recoil against the dimuon system. The structure is consistent with interference between the $B^+ \\to K^+ \\mu^+\\mu^-$ decay and a resonance and has a statistical significance exceeding six standard deviations. The mean and width of the resonance are measured to be $4191^{+9}_{-8}\\mathrm{\\,Me\\kern -0.1em V/}c^2$ and $65^{+22}_{-16}\\mathrm{\\,Me\\kern -0.1em V/}c^2$, respectively, where the uncertainties include statistical and systematic contributions. These measurements are compatible with the properties of the $\\psi(4160)$ meson. First observations of both the decay $B^+ \\to \\psi(4160) K^+$ and the subsequent decay $\\psi(4160) \\to \\mu^+\\mu^-$ are reported. The resonant decay and the interference contribution make up 20% of the yield for dimuon masses above 3770  MeV/c2. This contribution is larger than theoretical estimates.

  1. LHCb: Evidence of CP violation in charmless three-body decays $B^\\pm\\rightarrow K^\\pm\\pi^+\\pi^-$, $B^\\pm\\rightarrow K^\\pm K^+K^-$, $B^\\pm\\rightarrow K^+ K^-\\pi^\\pm$ and $B^\\pm\\rightarrow \\pi^\\pm\\pi^+\\pi^-$

    CERN Multimedia

    Lopes, J H

    2013-01-01

    Evidence of CP violation in charmless three-body decays $B^\\pm\\rightarrow K^\\pm\\pi^+\\pi^-$, $B^\\pm\\rightarrow K^\\pm K^+K^-$, $B^\\pm\\rightarrow K^+ K^-\\pi^\\pm$ and $B^\\pm\\rightarrow \\pi^\\pm\\pi^+\\pi^-$

  2. Detection of planet candidates around K giants. HD 40956, HD 111591, and HD 113996

    Science.gov (United States)

    Jeong, G.; Lee, B.-C.; Han, I.; Omiya, M.; Izumiura, H.; Sato, B.; Harakawa, H.; Kambe, E.; Mkrtichian, D.

    2018-02-01

    Aims: The purpose of this paper is to detect and investigate the nature of long-term radial velocity (RV) variations of K-type giants and to confirm planetary companions around the stars. Methods: We have conducted two planet search programs by precise RV measurement using the 1.8 m telescope at Bohyunsan Optical Astronomy Observatory (BOAO) and the 1.88 m telescope at Okayama Astrophysical Observatory (OAO). The BOAO program searches for planets around 55 early K giants. The OAO program is looking for 190 G-K type giants. Results: In this paper, we report the detection of long-period RV variations of three K giant stars, HD 40956, HD 111591, and HD 113996. We investigated the cause of the observed RV variations and conclude the substellar companions are most likely the cause of the RV variations. The orbital analyses yield P = 578.6 ± 3.3 d, m sin i = 2.7 ± 0.6 MJ, a = 1.4 ± 0.1 AU for HD 40956; P = 1056.4 ± 14.3 d, m sin i = 4.4 ± 0.4 MJ, a = 2.5 ± 0.1 AU for HD 111591; P = 610.2 ± 3.8 d, m sin i = 6.3 ± 1.0 MJ, a = 1.6 ± 0.1 AU for HD 113996. Based on observations made with the BOES at BOAO in Korea and HIDES at OAO in Japan.Tables 3-5 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/610/A3

  3. Supplementation of Lactobacillus plantarum K68 and Fruit-Vegetable Ferment along with High Fat-Fructose Diet Attenuates Metabolic Syndrome in Rats with Insulin Resistance

    Directory of Open Access Journals (Sweden)

    Hui-Yu Huang

    2013-01-01

    Full Text Available Lactobacillus plantarum K68 (isolated from fu-tsai and fruit-vegetable ferment (FVF have been tested for antidiabetic, anti-inflammatory, and antioxidant properties in a rat model of insulin resistance, induced by chronic high fat-fructose diet. Fifty rats were equally assigned into control (CON, high fat-fructose diet (HFFD, HFFD plus K68, HFFD plus FVF, and HFFD plus both K68 and FVF (MIX groups. Respective groups were orally administered with K68 (1×109 CFU/0.5 mL or FVF (180 mg/kg or MIX for 8 weeks. We found that HFFD-induced increased bodyweights were prevented, and progressively increased fasting blood glucose and insulin levels were reversed (P<0.01 by K68 and FVF treatments. Elevated glycated hemoglobin (HbA1c and HOMA-IR values were controlled in supplemented groups. Furthermore, dyslipidemia, characterized by elevated total cholesterol (TC, triglyceride (TG, and low-density lipoproteins (LDLs with HFFD, was significantly (P<0.01 attenuated with MIX. Elevated pro-inflammatory cytokines, interleukin-1β (IL-1β, IL-6, and tumor necrosis factor-α (TNF-α, were controlled (P<0.01 by K68, FVF, and MIX treatments. Moreover, decreased superoxide dismutase (SOD, catalase (CAT, and glutathione peroxidase (GPx activities were substantially (P<0.01 restored by all treatments. Experimental evidences demonstrate that K68 and FVF may be effective alternative medicine to prevent HFFD-induced hyperglycemia, hyperinsulinemia, and hyperlipidemia, possibly associated with anti-inflammatory and antioxidant efficacies.

  4. Observation of $B^0 \\to \\bar{D}^0 K^+ K^-$ and evidence of $B^0_s \\to \\bar{D}^0 K^+ K^-$

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The first observation of the decay $B^{0} \\to \\overline{D}^{0}K^{+}K^{-}$ is reported from an analysis of $0.62 \\ \\mathrm{fb}^{-1}$ of $pp$ collision data collected with the LHCb detector. Its branching fraction is measured relative to that of the topologically similar decay $B^{0} \\to \\overline{D}^{0}\\pi^{+}\\pi^{-}$ to be $\\frac{ {\\cal B}\\left(B^{0} \\to \\overline{D}^{0}K^{+}K^{-}\\right)}{ {\\cal B}\\left(B^{0} \\to \\overline{D}^{0}\\pi^{+}\\pi^{-}\\right)} = 0.056 \\pm 0.011 \\pm 0.007$, where the first uncertainty is statistical and the second is systematic. The significance of the signal is $5.8\\,\\sigma$. Evidence, with $3.8\\,\\sigma$ significance, for $B^{0}_{s} \\to \\overline{D}^{0}K^{+}K^{-}$ decays is also presented. The relative branching fraction is measured to be $\\frac{ {\\cal B}\\left(B^{0}_{s} \\to \\overline{D}^{0}K^{+}K^{-}\\right)}{ {\\cal B}\\left(B^{0} \\to \\overline{D}^{0}K^{+}K^{-}\\right)} = 0.90 \\pm 0.27 \\pm 0.20$. These channels are of interest to study the mechanisms behind hadronic B decays, and ope...

  5. Effect of Sb{sub 2}O{sub 3} on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} ceramics fabricated using nanocrystals seed

    Energy Technology Data Exchange (ETDEWEB)

    Parjansri, P. [Rajamangala University of Technology Krungthep, Physics Division, Faculty of Science and Technology, Bangkok (Thailand); Intatha, U. [Mae Fah Luang University, School of Science, Chiang Rai (Thailand); Guo, R.; Bhalla, A.S. [University of Texas at San Antonio, Department of Electrical and Computer Engineering, Faculty of Engineering, San Antonio, TX (United States); Eitssayeam, S. [Chiang Mai University, Department of Physics and Materials Science, Faculty of Science, Chiang Mai (Thailand); Chiang Mai University, Materials Science Research Center, Faculty of Science, Chiang Mai (Thailand)

    2016-09-15

    This work was to investigate the effects of antimony oxide (Sb{sub 2}O{sub 3}) on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} (BCZT) ceramics and was prepared by adding 1 mol% of BCZT nanocrystals. The seed is nanocrystals of BCZT which was synthesized by the molten salt method. The ceramics powders were prepared by the mixed oxide method using BaCO{sub 3}, CaCO{sub 3}, ZrO{sub 2}, TiO{sub 2} as starting materials, and the BCZT seed was added as nanocrystal for induce phase transition. They were doped with x mol% Sb{sub 2}O{sub 3} (x = 0.0-0.5). Results indicated that all samples show pure perovskite phase. The Sb{sub 2}O{sub 3} enhanced the electrical properties of the ceramic systems. Excellent values of a dielectric constant (ε {sub r}) at room temperature (T{sub r}) were 4086 with sample of x = 0.5, and at Curie temperature (T{sub c}) was 15,485 for samples with x = 0.1. The highest remnant polarization (P{sub r}), piezoelectric charge coefficient (d{sub 33}), piezoelectric voltage coefficient (g{sub 33}), electromechanical coefficient for planar mode (k{sub p}) and thickness mode (k{sub t}) values were 6.3 μC/cm{sup 2}, 346 pC/N, 15.6 x 10{sup -3} Vm/N, 42 and 41 %, respectively, which were obtained for the sample of x = 0.2 mol% Sb. (orig.)

  6. Cytotoxic activity of vitamins K1, K2 and K3 against human oral tumor cell lines.

    Science.gov (United States)

    Okayasu, H; Ishihara, M; Satoh, K; Sakagami, H

    2001-01-01

    Vitamin K1, K2 and K3 were compared for their cytotoxic activity, radical generation and O2- scavenging activity. Among these compounds, vitamin K3 showed the highest cytotoxic activity against human oral tumor cell lines (HSC-2, HSG), human promyelocytic leukemic cell line (HL-60) and human gingival fibroblast (HGF). Vitamin K3 induced internucleosomal DNA fragmentation in HL-60 cells, but not in HSC-2 or HSG cells. The cytotoxic activity of vitamins K2 and K1 was one and two orders lower, respectively, than K3. Vitamin K2, but not vitamin K3, showed tumor-specific cytotoxic action. ESR spectroscopy showed that only vitamin K3 produced radical(s) under alkaline condition and most potently enhanced the radical intensity of sodium ascorbate and scavenged O2- (generated by hypoxanthine-xanthine oxidase reaction system); vitamin K2 was much less active whereas vitamin K1 was inactive. These data suggest that the cytotoxic activity of vitamin K3 is generated by radical-mediated oxidation mechanism and that this vitamin has two opposing actions (that is, antioxidant and prooxidant), depending on the experimental conditions.

  7. $B_K$ from quenched QCD with exact chiral symmetry

    CERN Document Server

    Garron, N; Hölbling, C; Lellouch, L P; Rebbi, C; Garron, Nicolas; Giusti, Leonardo; Hoelbling, Christian; Lellouch, Laurent; Rebbi, Claudio

    2004-01-01

    We present a calculation of the standard model Delta S=2 matrix element relevant to indirect CP violation in K->pipi decays which uses Neuberger's chiral formulation of lattice fermions. The computation is performed in the quenched approximation on a 16^3x32 lattice that has a lattice spacing asim 0.1 fm. The resulting bare matrix element is renormalized non-perturbatively. Our main result is B_K^{RGI}=0.87(8)^{+2+14}_{-1-14}, where the first error is statistical, the second is systematic and the third is an estimate of the uncertainty associated with the quenched approximation and with the fact that our kaons are composed of degenerate s and d quarks with masses sim m_s/2.

  8. National Land Cover Database 2001 (NLCD01)

    Science.gov (United States)

    LaMotte, Andrew E.

    2016-01-01

    This 30-meter data set represents land use and land cover for the conterminous United States for the 2001 time period. The data have been arranged into four tiles to facilitate timely display and manipulation within a Geographic Information System (see http://water.usgs.gov/GIS/browse/nlcd01-partition.jpg). The National Land Cover Data Set for 2001 was produced through a cooperative project conducted by the Multi-Resolution Land Characteristics (MRLC) Consortium. The MRLC Consortium is a partnership of Federal agencies (http://www.mrlc.gov), consisting of the U.S. Geological Survey (USGS), the National Oceanic and Atmospheric Administration (NOAA), the U.S. Environmental Protection Agency (USEPA), the U.S. Department of Agriculture (USDA), the U.S. Forest Service (USFS), the National Park Service (NPS), the U.S. Fish and Wildlife Service (USFWS), the Bureau of Land Management (BLM), and the USDA Natural Resources Conservation Service (NRCS). One of the primary goals of the project is to generate a current, consistent, seamless, and accurate National Land Cover Database (NLCD) circa 2001 for the United States at medium spatial resolution. For a detailed definition and discussion on MRLC and the NLCD 2001 products, refer to Homer and others (2004), (see: http://www.mrlc.gov/mrlc2k.asp). The NLCD 2001 was created by partitioning the United States into mapping zones. A total of 68 mapping zones (see http://water.usgs.gov/GIS/browse/nlcd01-mappingzones.jpg), were delineated within the conterminous United States based on ecoregion and geographical characteristics, edge-matching features, and the size requirement of Landsat mosaics. Mapping zones encompass the whole or parts of several states. Questions about the NLCD mapping zones can be directed to the NLCD 2001 Land Cover Mapping Team at the USGS/EROS, Sioux Falls, SD (605) 594-6151 or mrlc@usgs.gov.

  9. High-power TM01 millimeter wave pulse sensor in circular waveguide

    International Nuclear Information System (INIS)

    Wang Guang-Qiang; Zhu Xiang-Qin; Chen Zai-Gao; Wang Xue-Feng; Zhang Li-Jun

    2015-01-01

    By investigating the interaction of an n-type silicon sample with the TM 01 mode millimeter wave in a circular waveguide, a viable high-power TM 01 millimeter wave sensor is proposed. Based on the hot electron effect, the silicon sample serving as a sensing element (SE) and appropriately mounted on the inner wall of the circular waveguide is devoted to the on-line measurement of a high-power millimeter wave pulse. A three-dimensional parallel finite-difference time-domain method is applied to simulate the wave propagation within the measuring structure. The transverse electric field distribution, the dependences of the frequency response of the voltage standing-wave ratio (VSWR) in the circular waveguide, and the average electric field amplitude within the SE on the electrophysical parameters of the SE are calculated and analyzed in the frequency range of 300–400 GHz. As a result, the optimal dimensions and specific resistance of the SE are obtained, which provide a VSWR of no more than 2.0, a relative sensitivity around 0.0046 kW −1 fluctuating within ± 17.3%, and a maximum enduring power of about 4.3 MW. (paper)

  10. Influence of Cobalt Doping on the Physical Properties of Zn0.9Cd0.1S Nanoparticles

    Directory of Open Access Journals (Sweden)

    Gupta Hari Om

    2009-01-01

    Full Text Available Abstract Zn0.9Cd0.1S nanoparticles doped with 0.005–0.24 M cobalt have been prepared by co-precipitation technique in ice bath at 280 K. For the cobalt concentration >0.18 M, XRD pattern shows unidentified phases along with Zn0.9Cd0.1S sphalerite phase. For low cobalt concentration (≤0.05 M particle size, d XRDis ~3.5 nm, while for high cobalt concentration (>0.05 M particle size decreases abruptly (~2 nm as detected by XRD. However, TEM analysis shows the similar particle size (~3.5 nm irrespective of the cobalt concentration. Local strain in the alloyed nanoparticles with cobalt concentration of 0.18 M increases ~46% in comparison to that of 0.05 M. Direct to indirect energy band-gap transition is obtained when cobalt concentration goes beyond 0.05 M. A red shift in energy band gap is also observed for both the cases. Nanoparticles with low cobalt concentrations were found to have paramagnetic nature with no antiferromagnetic coupling. A negative Curie–Weiss temperature of −75 K with antiferromagnetic coupling was obtained for the high cobalt concentration.

  11. Magnetic properties and magnetocaloric effect in the HoNi1−xCuxIn (x=0, 0.1, 0.3, 0.4) intermetallic compounds

    International Nuclear Information System (INIS)

    Mo, Zhao-Jun; Shen, Jun; Yan, Li-Qin; Tang, Cheng-Chun; He, Xiao-Nan; Zheng, Xinqi; Wu, Jian-Feng; Sun, Ji-Rong; Shen, Bao-Gen

    2014-01-01

    The magnetic properties and magnetocaloric effect (MCE) in HoNi 1−x Cu x In (x=0, 0.1, 0.3, 0.4) compounds have been investigated. With the substitution of Cu for Ni, the Ho magnetic moment will cant from the c-axis, and form a complicated magnetic structure. These compounds exhibit two successive magnetic transitions with the increase in temperature. The large reversible magnetocaloric effects have been observed in HoNi 1−x Cu x In compounds around T ord , with no thermal and magnetic hysteresis loss. The large reversible isothermal magnetic entropy change (−ΔS M ) is 20.2 J/kg K and the refrigeration capacity (RC) reaches 356.7 J/kg for field changes of 5 T for HoNi 0.7 Cu 0.3 In. Especially, the value of −ΔS M (12.5 J/kg K) and the large RC (132 J/kg) are observed for field changes of 2 T for HoNi 0.9 Cu 0.1 In. Additionally, the values of RC are improved to 149 J/K for the field changes of 2 T due to a wide temperature span for the mix of HoNi 0.9 Cu 0.1 In and HoNi 0.7 Cu 0.3 In compounds with the mass ratio of 1:1. These compounds with excellent MCE are expected to have effective applications in magnetic refrigeration around 20 K. - Highlights: • For magnetic-field changes of 2 T, the values of RC are improved to 149 J/K. • MCEs of these compounds show no thermal and magnetic hysteresis. • Compounds show two successive magnetic transitions with the increase in temperature. • With the substitution of Cu for Ni, compounds form a complicated magnetic structure

  12. 33 CFR 66.01-10 - Characteristics.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Characteristics. 66.01-10 Section 66.01-10 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY AIDS TO... Characteristics. The characteristics of a private aid to navigation must conform to those prescribed by the United...

  13. On the Difference Equation xn+1=xnxn-k/(xn-k+1a+bxnxn-k

    Directory of Open Access Journals (Sweden)

    Stevo Stević

    2012-01-01

    Full Text Available We show that the difference equation xn+1=xnxn-k/xn-k+1(a+bxnxn-k,n∈ℕ0, where k∈ℕ, the parameters a, b and initial values x-i, i=0,k̅ are real numbers, can be solved in closed form considerably extending the results in the literature. By using obtained formulae, we investigate asymptotic behavior of well-defined solutions of the equation.

  14. In vitro vitamin K3 effect on conjunctival fibroblast migration and proliferation.

    Science.gov (United States)

    Pinilla, I; Izaguirre, L B; Gonzalvo, F J; Piazuelo, E; Garcia-Gonzalez, M A; Sanchez-Cano, A I; Sopeña, F

    2014-01-01

    To evaluate the dose effect of vitamin K3 on wound healing mechanisms. Conjunctival fibroblasts were incubated for 24 hours. An artificial wound was made and the cells were incubated with fresh medium plus doses of vitamin K3 to be tested. Wound repair was monitored at 0, 18, 24, and 48 hours. Proliferation was measured in actively dividing cells by [(3)H]thymidine uptake. Six different groups were tested: group 1/no drugs added, group 2/ethanol 0.1%, group 3/vitamin K3 1 mg/L, group 4/vitamin K3 2 mg/L, group 5/vitamin K3 4 mg/L, and group 6/vitamin K3 6 mg/L. Each experiment was carried out in triplicate and 4 times. There were no differences among groups at the initial time. In vitro wound repair was slower in groups 4, 5, and 6. There were no differences between control and ethanol groups and between control and vitamin K3 1 mg/L groups. Fibroblast mitogenic activity was statistically decreased in all vitamin K groups; statistical differences were found among vitamin K3 1 mg/mL and higher doses too. In groups 5 and 6, cellular toxicity was presented. Vitamin K3 is able to inhibit fibroblast proliferation. Vitamin K3 2 mg/L or higher doses inhibit wound healing repair, exhibiting cellular toxicity at 4 and 6 mg/L.

  15. In Vitro Vitamin K3 Effect on Conjunctival Fibroblast Migration and Proliferation

    Directory of Open Access Journals (Sweden)

    I. Pinilla

    2014-01-01

    Full Text Available Purpose. To evaluate the dose effect of vitamin K3 on wound healing mechanisms. Methods. Conjunctival fibroblasts were incubated for 24 hours. An artificial wound was made and the cells were incubated with fresh medium plus doses of vitamin K3 to be tested. Wound repair was monitored at 0, 18, 24, and 48 hours. Proliferation was measured in actively dividing cells by [3H]thymidine uptake. Six different groups were tested: group 1/no drugs added, group 2/ethanol 0.1%, group 3/vitamin K3 1 mg/L, group 4/vitamin K3 2 mg/L, group 5/vitamin K3 4 mg/L, and group 6/vitamin K3 6 mg/L. Each experiment was carried out in triplicate and 4 times. Results. There were no differences among groups at the initial time. In vitro wound repair was slower in groups 4, 5, and 6. There were no differences between control and ethanol groups and between control and vitamin K3 1 mg/L groups. Fibroblast mitogenic activity was statistically decreased in all vitamin K groups; statistical differences were found among vitamin K3 1 mg/mL and higher doses too. In groups 5 and 6, cellular toxicity was presented. Conclusions. Vitamin K3 is able to inhibit fibroblast proliferation. Vitamin K3 2 mg/L or higher doses inhibit wound healing repair, exhibiting cellular toxicity at 4 and 6 mg/L.

  16. Study on the thermoluminescent properties of K{sub 2}YF{sub 5} and K{sub 2}GdF{sub 5} crystals doped with optically active trivalent ions for gamma and neutrons dosimetry; Estudo das propriedades termoluminescentes de cristais de K{sub 2}YF{sub 5} e K{sub 2}GdF{sub 5} dopados com ions trivalentes opticamente ativos para dosimetria gama e de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Edna Carla da

    2008-07-01

    In this work, the thermoluminescent (TL) properties of both double potassium yttrium fluoride (K{sub 2}YF{sub 5}) and double potassium gadolinium fluoride (K{sub 2}GdF{sub 5}) crystals doped with optically active rare earth ions were investigated from the point of view of gamma and neutron dosimetry. Crystalline platelets with thickness of about 1 mm, synthesized under hydrothermal conditions, were irradiated in order to study TL sensitivity, as well as dose and energy response, reproducibility and fading, in terms of Ce{sup 3+}, Tb{sup 3+}, Dy{sup 3+}, e Pr{sup 3+} concentrations. The K{sub 2}YF{sub 5} crystals doped with 1.0 at por cent Dy{sup 3+} have been found to have an excellent linear TL response to X and gamma photons, in the range of 0.01 to 10 mGy. The TL output is comparable to that of CaS0{sub 4}:Mn dosemeters. The main peak at 130 deg C has been found to have a TL response for 41.1 keV X-ray energy 32 times higher than that for 662 keV gamma rays. This fact points out that the K{sub 2}Y{sub 0.99}Dy{sub 0.01}F{sub 5} crystals have great potential for X-rays diagnostic and/or industrial radiography. On the other hand, the K{sub 2}GdF{sub 5} crystals doped with 5.0 at por cent Dy{sup 3+} have been found to have the better TL response for gamma and fast neutron radiation, among the dopants studied. For gamma fields the TL response was linear for doses ranging from 0.1 to 200 mGy. The TL peak around 200 deg C can be deconvoluted into four individual peaks, all of them with linear behavior. For fast neutron radiation produced by an {sup 241}Am{sub B}e source, the TL responses for doses ranging from 0.6 to 12 mSv were also linear and comparable to that of commercial TLD-600, irradiated at same conditions. The TL emission due to neutrons was in the high temperature range, above 200 deg C. These results points out that K{sub 2}Gd{sub 0.95}Dy{sub 0.05}F{sub 5} crystals are good candidates for use in neutron dosimetry applications. (author)

  17. K-East and K-West Reactors

    Data.gov (United States)

    Federal Laboratory Consortium — Hanford's "sister reactors", the K-East and the K-West Reactors, were built side-by-side in the early 1950's. The two reactors went operational within four months of...

  18. GPM Level 3 IMERG Half Hourly 0.1 x 0.1 degree V03

    Data.gov (United States)

    National Aeronautics and Space Administration — This Directory Interchange Format (DIF) describes a collection of fields for the GPM Level 3 IMERG Final Half Hourly 0.1 x 0.1 degree V03 (GPM_3IMERGHH) at the NASA...

  19. Densities and volume properties of (water + tert-butanol) over the temperature range of (274.15 to 348.15) K at pressure of 0.1 MPa

    International Nuclear Information System (INIS)

    Egorov, Gennadiy I.; Makarov, Dmitriy M.

    2011-01-01

    The densities of {water (1) + tert-butanol (2)} binary mixture were measured over the temperature range (274.15 to 348.15) K at atmospheric pressure using 'Anton Paar' digital vibrating-tube densimeter. Density measurements were carried out over the whole concentration range at (308.15 to 348.15) K. The following volume parameters were calculated: excess molar volumes and thermal isobaric expansivities of the mixture, partial molar volumes and partial molar thermal isobaric expansivities of the components. Concentration dependences of excess molar volumes were fitted with Redlich-Kister equation. The results of partial molar volume calculations using four equations were compared. It was established that for low alcohol concentrations at T ≤ 208 K the inflection points at x 2 ∼ 0.02 were observed at concentration dependences of specific volume. The concentration dependences of partial molar volumes of both water and tert-butanol had extremes at low alcohol content. The temperature dependence of partial molar volumes of water had some inversion at x 2 ∼ 0.65. The temperature dependence of partial molar volumes of tert-butanol at infinite dilution had minimum at ∼288 K. It was discovered that concentration dependences of thermal isobaric expansivities of the mixture at small alcohol content and low temperatures passed through minimum.

  20. Effective lifetime measurements in the B-s(0) -> K+K-, B-0 -> K+pi(-) and B-s(0) -> pi K-+(-) decays

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M. -O.; Vanbeuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N. H.; Brown, H.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Gomez, M. Calvo; Camboni, A.; Campana, P.; Perez, D. Campora; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Akiba, K. Carvalho; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Esen, S.; Falabella, A.; Faerber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, R. F.; Ferguson, D.; Albor, V. Fernandez; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Torreira, A. Gallas; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gaspar, C.; Gauld, R.; Gavardi, L.; Geraci, A.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani, S.; Gibson, V.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Gotti, C.; Gaendara, M. Grabalosa; Diaz, R. Graciani; Cardoso, L. A. Granado; Graug, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hartmann, T.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hunt, P.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jaton, P.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kaballo, M.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Kelsey, M.; Kenyon, I. R.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; Lathi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Legac, R.; Vanleerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefranois, J.; Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lopez-March, N.; Lowdon, P.; Lu, H.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Benito, C. Marin; Marino, P.; Maerki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin Sanchez, A.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Tostes, D. Martins; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; Mcnab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. -N.; Moggi, N.; Rodriguez, J. Molina; Monteil, S.; Moran, D.; Morandin, M.; Morawski, P.; Mord, A.; Morello, M. J.; Moron, J.; Mountain, R.; Muheim, F.; Mueller, K.; Muresan, R.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, G.; Orlandea, M.; Goicochea, J. M. Otalora; Owen, P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Alvarez, A. Pazos; Pearce, A.; Pellegrino, A.; Altarelli, M. Pepe; Perazzini, S.; Trigo, E. Perez; Perret, P.; Perrin-Terrin, M.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Olloqui, E. Picatoste; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Casasus, M. Plo; Polci, F.; Poluektov, A.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Reichert, S.; Reid, M. M.; dos Reis, A. C.; Ricciardi, S.; Richards, A.; Rihl, M.; Rinnert, K.; Molina, V. Rives; Romero, D. A. Roa; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Perez, P. Rodriguez; Roiser, S.; Romanovsky, V.; Vidal, A. Romero; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, H.; Valls, P. Ruiz; Sabatino, G.; Silva, J. J. Saborido; Sagidova, N.; Sail, P.; Saitta, B.; Guimaraes, V. Salustino; Mayordomo, C. Sanchez; Sedes, B. Sanmartin; Santacesaria, R.; Rios, C. Santamarina; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R. Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Subbiah, V. K.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szilard, D.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M. T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M. Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Regueiro, P. Vazquez; Sierra, C. Vyzquez; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Diaz, M. Vieites; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Voss, H.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiedner, D.; Wilkinson, G.; Williams, M. P.; Williams, M.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.

    2014-01-01

    Measurements of the effective lifetimes in the B-s(0) -> K+K-, B-0 -> K+pi(-) and B-s(0) -> pi K-+(-) decays are presented using 1.0 fb(-1)of pp collision data collected at a centre-of-mass energy of 7 TeV by the LHCb experiment. The analysis uses a data-driven approach to correct for the decay time

  1. Electronic States of High-k Oxides in Gate Stack Structures

    Science.gov (United States)

    Zhu, Chiyu

    In this dissertation, in-situ X-ray and ultraviolet photoemission spectroscopy have been employed to study the interface chemistry and electronic structure of potential high-k gate stack materials. In these gate stack materials, HfO2 and La2O3 are selected as high-k dielectrics, VO2 and ZnO serve as potential channel layer materials. The gate stack structures have been prepared using a reactive electron beam system and a plasma enhanced atomic layer deposition system. Three interrelated issues represent the central themes of the research: 1) the interface band alignment, 2) candidate high-k materials, and 3) band bending, internal electric fields, and charge transfer. 1) The most highlighted issue is the band alignment of specific high-k structures. Band alignment relationships were deduced by analysis of XPS and UPS spectra for three different structures: a) HfO2/VO2/SiO2/Si, b) HfO 2-La2O3/ZnO/SiO2/Si, and c) HfO 2/VO2/ HfO2/SiO2/Si. The valence band offset of HfO2/VO2, ZnO/SiO2 and HfO 2/SiO2 are determined to be 3.4 +/- 0.1, 1.5 +/- 0.1, and 0.7 +/- 0.1 eV. The valence band offset between HfO2-La2O3 and ZnO was almost negligible. Two band alignment models, the electron affinity model and the charge neutrality level model, are discussed. The results show the charge neutrality model is preferred to describe these structures. 2) High-k candidate materials were studied through comparison of pure Hf oxide, pure La oxide, and alloyed Hf-La oxide films. An issue with the application of pure HfO2 is crystallization which may increase the leakage current in gate stack structures. An issue with the application of pure La2O3 is the presence of carbon contamination in the film. Our study shows that the alloyed Hf-La oxide films exhibit an amorphous structure along with reduced carbon contamination. 3) Band bending and internal electric fields in the gate stack structure were observed by XPS and UPS and indicate the charge transfer during the growth and process. The oxygen

  2. Dalitz plot analysis of eta(c) -> K+K-eta and eta(c) -> K+K-pi(0) in two-photon interactions

    NARCIS (Netherlands)

    Lees, J. P.; Poireau, V.; Tisserand, V.; Grauges, E.; Palano, A.; Eigen, G.; Stugu, B.; Brown, D. N.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Schroeder, T.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; So, R. Y.; Khan, A.; Blinov, V. E.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Lankford, A. J.; Mandelkern, M.; Dey, B.; Gary, J. W.; Long, O.; Campagnari, C.; Sevilla, M. Franco; Hong, T. M.; Kovalskyi, D.; Richman, J. D.; West, C. A.; Eisner, A. M.; Lockman, W. S.; Vazquez, W. Panduro; Schumm, B. A.; Seiden, A.; Chao, D. S.; Echenard, B.; Flood, K. T.; Hitlin, D. G.; Miyashita, T. S.; Ongmongkolkul, P.; Andreassen, R.; Huard, Z.; Meadows, B. T.; Pushpawela, B. G.; Sokoloff, M. D.; Sun, L.; Bloom, P. C.; Ford, W. T.; Gaz, A.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Toki, W. H.; Spaan, B.; Bernard, D.; Verderi, M.; Playfer, S.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cibinetto, G.; Fioravanti, E.; Garzia, I.; Luppi, E.; Piemontese, L.; Santoro, V.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Martellotti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Bhuyan, B.; Prasad, V.; Morii, M.; Adametz, A.; Uwer, U.; Lacker, H. M.; Dauncey, P. D.; Mallik, U.; Cochran, J.; Prell, S.; Ahmed, H.; Gritsan, A. V.; Arnaud, N.; Davier, M.; Derkach, D.; Grosdidier, G.; Le Diberder, F.; Lutz, A. M.; Malaescu, B.; Roudeau, P.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Coleman, J. P.; Fry, J. R.; Gabathuler, E.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Di Lodovico, F.; Sacco, R.; Cowan, G.; Bougher, J.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Prencipe, E.; Schubert, K. R.; Barlow, R. J.; Lafferty, G. D.; Cenci, R.; Hamilton, B.; Jawahery, A.; Roberts, D. A.; Cowan, R.; Sciolla, G.; Cheaib, R.; Patel, P. M.; Robertson, S. H.; Neri, N.; Palombo, F.; Cremaldi, L.; Godang, R.; Sonnek, P.; Summers, D. J.; Simard, M.; Taras, P.; De Nardo, G.; Onorato, G.; Sciacca, C.; Martinelli, M.; Raven, G.; Jessop, C. P.; LoSecco, J. M.; Honscheid, K.; Kass, R.; Feltresi, E.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simi, G.; Simonetto, F.; Stroili, R.; Akar, S.; Ben-Haim, E.; Bomben, M.; Bonneaud, G. R.; Briand, H.; Calderini, G.; Chauveau, J.; Leruste, Ph.; Marchiori, G.; Ocariz, J.; Biasini, M.; Manoni, E.; Pacetti, S.; Rossi, A.; Angelini, C.; Batignani, G.; Bettarini, S.; Carpinelli, M.; Casarosa, G.; Cervelli, A.; Chrzaszcz, M.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Oberhof, B.; Paoloni, E.; Perez, A.; Rizzo, G.; Walsh, J. J.; Pegna, D. Lopes; Olsen, J.; Smith, A. J. S.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Li Gioi, L.; Piredda, G.; Buenger, C.; Dittrich, S.; Gruenberg, O.; Hess, M.; Leddig, T.; Voss, C.; Waldi, R.; Adye, T.; Olaiya, E. O.; Wilson, F. F.; Emery, S.; Vasseur, G.; Anulli, F.; Aston, D.; Bard, D. J.; Cartaro, C.; Convery, M. R.; Dorfan, J.; Dubois-Felsmann, G. P.; Dunwoodie, W.; Ebert, M.; Field, R. C.; Fulsom, B. G.; Graham, M. T.; Hast, C.; Innes, W. R.; Kim, P.; Leith, D. W. G. S.; Lewis, P.; Lindemann, D.; Luitz, S.; Luth, V.; Lynch, H. L.; MacFarlane, D. B.; Muller, D. R.; Neal, H.; Perl, M.; Pulliam, T.; Ratcliff, B. N.; Roodman, A.; Salnikov, A. A.; Schindler, R. H.; Snyder, A.; Su, D.; Sullivan, M. K.; Va'vra, J.; Wisniewski, W. J.; Wulsin, H. W.; Purohit, M. V.; White, R. M.; Wilson, J. R.; Randle-Conde, A.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Puccio, E. M. T.; Alam, M. S.; Ernst, J. A.; Gorodeisky, R.; Guttman, N.; Peimer, D. R.; Soffer, A.; Spanier, S. M.; Ritchie, J. L.; Ruland, A. M.; Schwitters, R. F.; Wray, B. C.; Izen, J. M.; Lou, X. C.; Bianchi, F.; De Mori, F.; Filippi, A.; Gamba, D.; Lanceri, L.; Vitale, L.; Martinez-Vidal, F.; Oyanguren, A.; Villanueva-Perez, P.; Albert, J.; Banerjee, Sw.; Beaulieu, A.; Bernlochner, F. U.; Choi, H. H. F.; Kowalewski, R.; Lewczuk, M. J.; Lueck, T.; Nugent, I. M.; Roney, J. M.; Sobie, R. J.; Tasneem, N.; Gershon, T. J.; Harrison, P. F.; Latham, T. E.; Band, H. R.; Dasu, S.; Pan, Y.; Prepost, R.

    2014-01-01

    We study the processes γγ→K+K−η and γγ→K+K−π0 using a data sample of 519  fb−1 recorded with the BABAR detector operating at the SLAC PEP-II asymmetric-energy e+e− collider at center-of-mass energies at and near the Υ(nS) (n=2,3,4) resonances. We observe ηc→K+K−π0 and ηc→K+K−η decays, measure their

  3. Measurement of $CP$ observables in $B^0\\to D K^{*0}$ with $D\\to K^+K^-$

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    The decay $B^0 \\to D K^{*0}$ and the charge conjugate mode are studied using 1.0${\\mathrm fb}^-1$ of $pp$ collision data collected by the LHCb experiment at $\\sqrt{s} = 7TeV$ in 2011. The CP asymmetry between the $B^0 \\to D K^{*0}$ and the $\\bar{B}^0 \\to D \\bar{K }^{*0}$ decay rates, with the neutral D meson in the CP-even final state $K^+K^-$, is found to be \\begin{equation*} {\\cal A}_d^{KK} = -0.45 \\pm 0.23 \\pm 0.02, \\end{equation*} where the first uncertainty is statistical and the second is systematic. In addition, favoured $B^0 \\to D K^{*0}$ decays are reconstructed with the $D$ meson in the non-$CP$ eigenstate $K^+ \\pi^-$. The ratio of the $B$-flavour averaged decay rates in $D$ decays to $CP$ and non-$CP$ eigenstates is measured to be \\begin{equation*} {\\cal R}_d^{KK} = 1.36\\,^{+0.37}_{ -0.32} \\pm 0.07, \\end{equation*} where the ratio of the branching fractions of $D^0 \\to K^- \\pi^+$ to $D^0 \\to K^+ K^-$ decays is included as multiplicative factor. The CP asymmetries measured with two contro...

  4. Copper K-shell emission cross sections for laser–solid experiments

    Energy Technology Data Exchange (ETDEWEB)

    Davies, J. R.; Betti, R.; Nilson, P. M.; Solodov, A. A. [Fusion Science Center for Extreme States of Matter, Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)

    2013-08-15

    Published measurements and models of the cross section for electrons causing K-shell emission from copper are reviewed to find a suitable expression to use when analyzing K{sub α}-emission measurements in laser–solid experiments at peak intensities above 10{sup 18} W/cm{sup 2}. Few measurements exist in the 0.1- to 10-MeV electron energy range currently of interest, leaving a number of possible suitable models that are summarized here with a number of typing errors corrected. Two different limiting forms for the cross section at relativistic energies are used, and existing measurements do not give a clear indication as to which is correct. Comparison with the limiting form of electron stopping power indicates an alternative relativistic form and also that the density-effect correction will be important in copper above 10 MeV. For data analysis relying on relative K{sub α} emission caused by electrons with energy much greater than the K-shell binding energy, the existing uncertainty in cross sections is unimportant, but it will be a source of uncertainty when using absolute values and for electron energies up to ∼6× the binding energy. K-shell emission caused by photons and protons is also briefly reviewed.

  5. Dielectric and magnetic properties of Ba-, La- and Pb-doped Bi0.8Gd0.1M0.1Fe0.9Ti0.1O3 perovskite ceramics

    Directory of Open Access Journals (Sweden)

    Radheshyam Rai

    2014-04-01

    Full Text Available The multiferroic Bi0.8Gd0.1M0.1Fe0.9Ti0.1O3, (where M = Ba (DB, La (DL and Pb (DP has been synthesized by using solid-state reaction technique. Effects of Ba, La and Pb substitution on the structure, electrical and ferroelectric properties of Bi0.8Gd0.1M0.1Fe0.9Ti0.1O3 samples have been studied by performing X-ray diffraction, dielectric and magnetic measurements. The crystal structures of the ceramic samples have a tetragonal phase. The vibrating sample magnetometer (VSM measurement shows a significant change in the magnetic properties of Ba-doped Bi0.8Gd0.1M0.1Fe0.9Ti0.1O3 as compared to La- and Pb-doped ceramics. It is seen that coercive field (HC and remanent magnetization (MR increases with Ba-doped ceramics but decreases for La- and Pb-doped ceramics.

  6. Co-doping induced coexistence of superconductivity and ferromagnetism in Bi{sub 3.9}Co{sub 0.1}O{sub 4}S{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Chuan [Department of Physics, Shanghai University, Shanghai 200444 (China); Feng, Zhenjie, E-mail: fengzhenjie@t.shu.edu.cn [Department of Physics, Shanghai University, Shanghai 200444 (China); Shanghai Key Laboratory of High Temperature Superconductors, Shanghai 200444 (China); Yin, Xunqing; Li, Qing; Kang, Baojuan [Department of Physics, Shanghai University, Shanghai 200444 (China); Lu, Bo [Laboratory for Microstructures, Shanghai University, Shanghai 200444 (China); Jing, Chao; Cao, Shixun [Department of Physics, Shanghai University, Shanghai 200444 (China); Shanghai Key Laboratory of High Temperature Superconductors, Shanghai 200444 (China); Zhang, Jincang [Department of Physics, Shanghai University, Shanghai 200444 (China); Materials Genome Institute, Shanghai University, Shanghai 200444 (China)

    2016-09-15

    Highlights: • Bi{sub 4}O{sub 4}S{sub 3} is a new discovered layered superconductor. Some doping effects, such as Ag, Cu, and Pb, are studied, the superconductivity is suppressed in these doping samples. We doped the Ni magnetic ions to the system, it is interesting that the superconductivity is not suppressed in x = 0.1 sample. Meanwhile, the coexistence of the superconductivity and magnetism is observed in the samples from the M-vs. –H loops. - Abstract: The effects of Co doping on the physical properties of the Bi{sub 4}O{sub 4}S{sub 3} system was studied. We discovered that stable Bi{sub 3.9}Co{sub 0.1}O{sub 4}S{sub 3} compound exhibits both long-range ferromagnetism and enhanced superconductivity with thermodynamic evidences for Tc ∼ 5.5 K. We found that there is an anomalous feature which represents superconducting transition in the hysteretic M-vs.-H loops for Bi{sub 3.9}Co{sub 0.1}O{sub 4}S{sub 3} at T = 3 K.

  7. Study of K. pi. scattering using the reactions K/sup + -/p. -->. K/sup + -/. pi. /sup +/n and K/sup + -/p. -->. K/sup + -/. pi. /sup -/. delta. /sup + +/ at 13 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Estabrooks, P [McGill Univ., Montreal, Quebec (Canada); Carnegie, R K [Carleton Univ., Ottawa, Ontario (Canada); Martin, A D [Durham Univ. (UK); Dunwoodie, W M; Lasinski, T A; Leith, D W.G.S. [Stanford Linear Accelerator Center, Calif. (USA)

    1978-02-27

    An elastic K..pi.. partial-wave analysis is presented. It is based on high-statistics data for the reactions K/sup + -/p ..-->.. K/sup + -/..pi../sup +/n and K/sup + -/p ..-->.. K/sup + -/..pi../sup -/..delta../sup + +/ at 13 GeV obtained in a spectrometer experiment performed at SLAC. For each reaction, a t-dependent parametrization of the production amplitudes provides information on both the K..pi.. mass dependence of the production mechanisms and on K..pi.. scattering. Knowledge of the t-dependence then allows a calculation of the K..pi.. partial-wave amplitudes for K..pi.. masses from 0.7 to 1.9 GeV. The results of such analyses using data for (i) the neutral recoil reactions, (ii) the ..delta../sup + +/ recoil reactions, and (iii) both neutron and ..delta../sup + +/ recoil reactions simultaneously are presented.

  8. Behavior of the magnetocaloric effect in La0.7Ba0.2Ca0.1Mn1-xSnxO3 manganite oxides as promising candidates for magnetic refrigeration

    Science.gov (United States)

    Dhahri, Ja.; Mnefgui, Safa; Ben Hassine, A.; Tahri, Ta.; Oumezzine, M.; Hlil, E. K.

    2018-05-01

    The magnetocaloric effect along with magnetic phase transition in the peroveskite polycrystalline samples La0.7Ba0.2Ca0.1Mn1-xSnxO3 (x = 0 and 0.1) was investigated. The samples were synthesized using conventional solid state reaction at 1400 °C temperature. Magnetization vs. temperature measurements, under a magnetic field of μ0H = 0.05 T, showed a paramagnetic-ferromagnetic transition at Curie temperature, TC, which decreases from 310 K for x = 0-290 K for x = 0.1. A large magnetic entropy change | ΔSM | deduced from isothermal magnetization curves, has been observed in our samples with a peak centered on their respective TC. Interesting values of the relative cooling power (RCP), 237 J kg-1 for x = 0 and 248 J kg-1 x = 0.1, make these samples promising candidates for magnetic refrigeration around room temperature.

  9. K0/K+ ratio in relativistic heavy-ion collisions

    International Nuclear Information System (INIS)

    Ivanov, Yu.B.; Russkikh, V.N.

    1996-11-01

    It is shown that ratio of production yields of K 0 and K + mesons in collisions of isotopically asymmetric nuclei at incident energies ∼ 1 GeV/nucleon is related directly enough to temperature of nuclear matter at the initial stage of the collision. Sensitivity of the K 0 /K + ratio to the temperature variation is analyzed. Ambiguities, associated with interpretation of this quantity as a probe of nuclear temperature, are discussed. It is argued that the K 0 /K + ratio is a fairly model-independent quantity, provided channels with Δ isobars dominate the kaon production. (orig.)

  10. Three Small Planets Transiting the Bright Young Field Star K2-233

    Science.gov (United States)

    David, Trevor J.; Crossfield, Ian J. M.; Benneke, Björn; Petigura, Erik A.; Gonzales, Erica J.; Schlieder, Joshua E.; Yu, Liang; Isaacson, Howard T.; Howard, Andrew W.; Ciardi, David R.; Mamajek, Eric E.; Hillenbrand, Lynne A.; Cody, Ann Marie; Riedel, Adric; Schwengeler, Hans Martin; Tanner, Christopher; Ende, Martin

    2018-05-01

    We report the detection of three small transiting planets around the young K3 dwarf K2-233 (2MASS J15215519‑2013539) from observations during Campaign 15 of the K2 mission. The star is relatively nearby (d = 69 pc) and bright (V = 10.7 mag, K s = 8.4 mag), making the planetary system an attractive target for radial velocity follow-up and atmospheric characterization with the James Webb Space Telescope. The inner two planets are hot super-Earths (R b = 1.40 ± 0.06 {R}\\oplus , R c = 1.34 ± 0.08 {R}\\oplus ), while the outer planet is a warm sub-Neptune (R d = 2.6 ± 0.1 {R}\\oplus ). We estimate the stellar age to be {360}-140+490 Myr based on rotation, activity, and kinematic indicators. The K2-233 system is particularly interesting given recent evidence for inflated radii in planets around similarly aged stars, a trend potentially related to photo-evaporation, core cooling, or both mechanisms.

  11. Experimental determination of the phase boundary between kornelite and pentahydrated ferric sulfate at 0.1MPa

    Science.gov (United States)

    Kong, W.G.; Wang, A.; Chou, I.-Ming

    2011-01-01

    Recent findings of various ferric sulfates on Mars emphasize the importance of understanding the fundamental properties of ferric sulfates at temperatures relevant to that of Martian surface. In this study, the phase boundary between kornelite (Fe2(SO4)3.7H2O) and pentahydrated ferric sulfate (Fe2(SO4)3.5H2O) was experimentally determined using the humidity-buffer technique together with gravimetric measurements and Raman spectroscopy at 0.1MPa in the 36-56??C temperature range. Through the thermodynamic analysis of our experimental data, the enthalpy change (-290.8??0.3kJ/mol) and the Gibbs free energy change (-238.82??0.02kJ/mol) for each water molecule of crystallization in the rehydration of pentahydrated ferric sulfate to kornelite were obtained. ?? 2011 Elsevier B.V.

  12. Determination of vitamins D2, D3, K1 and K3 and some hydroxy metabolites of vitamin D3 in plasma using a continuous clean-up-preconcentration procedure coupled on-line with liquid chromatography-UV detection.

    Science.gov (United States)

    Ortiz Boyer, F; Fernández Romero, J M; Luque de Castro, M D; Quesada, J M

    1999-03-01

    A semi-automatic procedure for the continuous clean-up and concentration of several fat-soluble vitamins prior to their separation by HPLC and UV detection is reported. The procedure is based on the use of a minicolumn packed with aminopropylsilica as sorbent located prior to the chromatographic detection system. The overall process was developed and applied to the main liposoluble vitamins (A, D2, D3, E, K1, K3) and several hydroxy metabolites of vitamin D3 [25-(OH)-D3,24,25-(OH)2-D3 and 1,25-(OH)2-D3]. All the analytes were monitored at a compromise wavelength of 270 nm. Calibration graphs were constructed between 0.01 and 100 ng ml-1 for vitamin D2 and D3 and their hydroxy metabolites, between 0.1 and 100 ng ml-1 for vitamin A, K1 and K3 and between 1 and 100 ng ml-1 for vitamin E, with excellent regression coefficients (> or = 0.9901) in all cases. The precision was established at two concentration levels with acceptable RSDs in all instances (between 3.6 and 8.7%). The method was appropriate for the determination of vitamin D2, D3, K1 and K3 and the 24,25-dihydroxy and 25-hydroxy metabolites of vitamin D3 in human plasma. The method was applied to plasma samples spiked with the target analytes and the recoveries ranged between 78 and 109%.

  13. Measurement of $C\\!P$ violation in the phase space of $B^{\\pm} \\to K^{\\pm} \\pi^{+} \\pi^{-}$ and $B^{\\pm} \\to K^{\\pm} K^{+} K^{-}$ decays

    CERN Document Server

    INSPIRE-00258707; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Di Ruscio, F; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Holtrop, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    The charmless decays $B^{\\pm}\\to K^{\\pm}\\pi^+\\pi^-$ and $B^{\\pm}\\to K^{\\pm}K^+K^-$ are reconstructed using data, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by LHCb in 2011. The inclusive charge asymmetries of these modes are measured as $A_{C\\!P}(B^{\\pm}\\to K^{\\pm}\\pi^+\\pi^-) = 0.032 \\pm 0.008 {\\mathrm{\\,(stat)}} \\pm 0.004 {\\mathrm{\\,(syst)}} \\pm 0.007 (J/\\psi K^{\\pm})$ and $A_{C\\!P}(B^{\\pm}\\to K^{\\pm}K^+K^-) = -0.043 \\pm 0.009 {\\mathrm{\\,(stat)}} \\pm 0.003 {\\mathrm{\\,(syst)}} \\pm 0.007 (J/\\psi K^{\\pm})$, where the third uncertainty is due to the $C\\!P$ asymmetry of the $B^{\\pm}\\to J/\\psi K^{\\pm}$ reference mode. The significance of $A_{C\\!P}(B^{\\pm}\\to K^{\\pm}K^+K^-)$ exceeds three standard deviations and is the first evidence of an inclusive $C\\!P$ asymmetry in charmless three-body $B$ decays. In addition to the inclusive $C\\!P$ asymmetries, larger asymmetries are observed in localised regions of phase space.

  14. Effects of Rh on the thermoelectric performance of the p-type Zr0.5Hf0.5Co1-xRhxSb0.99Sn0.01 half-Heusler alloys

    International Nuclear Information System (INIS)

    Maji, Pramathesh; Takas, Nathan J.; Misra, Dinesh K.; Gabrisch, Heike; Stokes, Kevin; Poudeu, Pierre F.P.

    2010-01-01

    We show that Rh substitution at the Co site in Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 (0≤x≤1) half-Heusler alloys strongly reduces the thermal conductivity with a simultaneous, significant improvement of the power factor of the materials. Thermoelectric properties of hot-pressed pellets of several compositions with various Rh concentrations were investigated in the temperature range from 300 to 775 K. The Rh 'free' composition shows n-type conduction, while Rh substitution at the Co site drives the system to p-type semiconducting behavior. The lattice thermal conductivity of Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 alloys rapidly decreased with increasing Rh concentration and lattice thermal conductivity as low as 3.7 W/m*K was obtained at 300 K for Zr 0.5 Hf 0.5 RhSb 0.99 Sn 0.01 . The drastic reduction of the lattice thermal conductivity is attributed to mass fluctuation induced by the Rh substitution at the Co site, as well as enhanced phonon scattering at grain boundaries due to the small grain size of the synthesized materials. - Graphical abstract: Significant reduction of the lattice thermal conductivity with increasing Rh concentration in the p-type Zr 0.5 Hf 0.5 Co 1-x Rh x Sb 0.99 Sn 0.01 half-Heusler materials prepared by solid state reaction at 1173 K.

  15. Search for the suppressed decays $B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}$ and $B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-02-10

    A search is made for the highly-suppressed B meson decays $B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}$ and $B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}$ using a data sample corresponding to an integrated luminosity of 3.0 $fb^{-1}$ collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of 7 and 8 TeV. No evidence is found for the decays, and upper limits at 90\\% confidence level are determined to be $\\mathcal{B}(B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}) < 1.1\\times 10^{-8}$ and $\\mathcal{B}(B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}) < 4.6\\times 10^{-8}$.

  16. Determination of Impurities in Aluminum Alloy by INAA Single Comparator Method (K0-Standardization Method)

    International Nuclear Information System (INIS)

    Sarheel, A.; Khamis, I.; Somel, N.

    2007-01-01

    Multielement determination by the k0 based INAA using k0-IAEA program has been performed at Syrian Atomic Energy Commission using alloys. Concentrations of Cu, Zn, Fe, Ni, Sn and Ti in addition to aluminum element were determined in an aluminum alloy and Ni, Cr, Mo were determined in dental alloys using INAA k0-standardization method. Al-0.1%Au, Ni and Zn certified reference materials were analyzed to assess the suitability and accuracy of the method. Elements were determined in reference materials and samples after short and long irradiations, according to element half-lives.

  17. K- Popping: Korean Women, K-Pop, and Fandom

    OpenAIRE

    Kim, Jungwon

    2017-01-01

    Korean popular music (hereafter K-pop) can be understood as an inclusive cultural phenomenon. K-pop fandom constitutes a sizeable portion of this phenomenon and is characteristic, to a large degree, of K-pop culture. However, female fans, especially in Korea, are frequently disdained in mainstream Korean culture, and their fandom has been undervalued and derided. Challenging this negative view of female fans, I autoethnographically examine Korean female K-pop fandom, based on my field researc...

  18. Binary and ternary recombination of D3+ ions at 80-130 K: application of laser absorption spectroscopy.

    Science.gov (United States)

    Dohnal, Petr; Hejduk, Michal; Rubovič, Peter; Varju, Jozef; Roučka, Štěpán; Plašil, Radek; Glosík, Juraj

    2012-11-21

    Recombination of D(3)(+) ions with electrons at low temperatures (80-130 K) was studied using spectroscopic determination of D(3)(+) ions density in afterglow plasmas. The use of cavity ring-down absorption spectroscopy enabled an in situ determination of the abundances of the ions in plasma and the translational and the rotational temperatures of the recombining ions. Two near infrared transitions at (5792.70 ± 0.01) cm(-1) and at (5793.90 ± 0.01) cm(-1) were used to probe the number densities of the lowest ortho state and of one higher lying rotational state of the vibrational ground state of D(3)(+) ion. The results show that D(3)(+) recombination with electrons consists of the binary and the third-body (helium) assisted process. The obtained binary recombination rate coefficients are in agreement with a recent theoretical prediction for electron-ion plasma in thermodynamic equilibrium with α(bin)(80 K) = (9.2 ± 2.0) × 10(-8) cm(3) s(-1). The measured helium assisted ternary rate coefficients K(He) are in agreement with our previously measured flowing afterglow data giving a value of K(He)(80 K) = (1.2 ± 0.3) × 10(-25) cm(6) s(-1).

  19. Exchange bias training effect in phase separated polycrystalline Sm_0_._1Ca_0_._7Sr_0_._2MnO_3

    International Nuclear Information System (INIS)

    Markovich, V.; Fita, I.; Wisniewski, A.; Puzniak, R.; Martin, C.; Jung, G.; Gorodetsky, G.

    2016-01-01

    Magnetic properties of antiferromagnetic (AFM) electron doped manganite Sm_0_._1Ca_0_._7Sr_0_._2MnO_3 have been investigated, focusing mainly on the exchange bias (EB) effect and associated training effect. The studied compound exhibits the ground state with heterogeneous spin configuration, consisting of the C-type antiferromagnetic phase with the Néel temperature T_N_-_C ≈ 120 K, the G-AFM phase with the Néel temperature T_N_-_G ≈ 60 K, and ferromagnetic-like phase with a very weak spontaneous magnetic moment. Measurements of hysteresis loops have shown that the exchange bias field monotonously decreases with increasing temperature and vanishes above 40 K, while the coercivity disappears only above 70 K. The temperature variation of the exchange bias field has been successfully described by an exponential decay form. The stability of EB has been evaluated in the studies of the training effect, which has been discussed in the frame of the spin relaxation model, elucidating the important role of the AFM domain rearrangement at the interface. The complex phase separation and possible contributions from different interfaces between coexisting magnetic phases to the EB effect have also been discussed. - Highlights: • Sm_0_._1Ca_0_._7Sr_0_._2MnO_3 exhibits exchange bias (EB) effect at low temperatures T < 40 K. • The EB effect is associated with the phase separation and the presence of FM clusters as well as the G- and C-type AFM phases. • The training effect (TE) has been discussed in the frame of the spin relaxation model. • The TE is relatively small, indicating that AFM moment configuration is almost frozen during the magnetization reversal.

  20. The effective temperatures and colours of G and K stars

    International Nuclear Information System (INIS)

    Bell, R.A.; Gustafsson, B.

    1989-01-01

    Temperature scales are found for G and K dwarf and giant stars, using new tables of synthetic infrared colours as well as the infrared flux ratio method. The temperatures of 95 individual stars are given. The colours are presented for grids of flux constant, line blanketed models. One grid has been published previously, as have some colours for the visible region of the spectrum. The models of this grid are in the range 4000 K eff < 6000 K, 0.75 < log g < 3.00, - 3.0 < [A/H] < 0.0. A grid of dwarf models, with the same temperature and abundance range but with 3.75 < log g < 4.5 is also used. The colours are computed from two series of overlapping synthetic spectra, which have been calculated with a resolution of 0.1 A between 3000 and 12 000 A and 1.0 A between 0.9 and 6.0 μm. (author)

  1. Polarization and CP asymmetries in the decays B→K*ψ, K*ω, and K

    International Nuclear Information System (INIS)

    Kramer, G.; Palmer, W.F.

    1991-11-01

    We calculate branching ratios, polarization and CP asymmetries for the final exclusive states K * ψ, K * ω, K * ρ, make comparisons with experimental data, and suggest further tests of the underlying theoretical framework. (orig.)

  2. Results from Super-Kamiokande and K2K

    Indian Academy of Sciences (India)

    The probability of flavor oscillation (in the simplest, two-component case) is ..... K2K had collected about half of its total planned protons-on-target when the accident at ... [14] Design, construction, and operation of SciFi tracking detector for K2K ...

  3. Tritium release and retention properties of highly neutron-irradiated beryllium pebbles from HIDOBE-01 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Chakin, V., E-mail: vladimir.chakin@kit.edu [Karlsruhe Institute of Technology, Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Rolli, R.; Moeslang, A.; Klimenkov, M.; Kolb, M.; Vladimirov, P.; Kurinskiy, P.; Schneider, H.-C. [Karlsruhe Institute of Technology, Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Til, S. van; Magielsen, A.J. [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Zmitko, M. [The European Joint Undertaking for ITER and the Development of Fusion Energy, c/Josep Pla, no. 2, Torres Diagonal Litoral, Edificio B3, 08019 Barcelona (Spain)

    2013-11-15

    The current helium cooled pebble bed (HCPB) tritium breeding blanket concept for fusion reactors includes a bed of 1 mm diameter beryllium pebbles to act as a neutron multiplier. Beryllium pebbles, fabricated by the rotating electrode method, were neutron irradiated in the HFR in Petten within the HIDOBE-01 experiment. This study presents tritium release and retention properties and data on microstructure evolution of beryllium pebbles irradiated at 630, 740, 873, 948 K up to a damage dose of 18 dpa, corresponding to a helium accumulation of about 3000 appm. The measured cumulative released activity from the beryllium pebbles irradiated at 948 K was found to be significantly lower than the calculated value. After irradiation at 873 and 948 K scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses revealed large pores or bubbles in the bulk and oxide films with a thickness of up to 8 μm at the surface of the beryllium pebbles. The radiation-enhanced diffusion of tritium and the formation of open porosity networks accelerate the tritium release from the beryllium pebbles during the high-flux neutron irradiation.

  4. Soil burial method for plastic degradation performed by Pseudomonas PL-01, Bacillus PL-01, and indigenous bacteria

    Science.gov (United States)

    Shovitri, Maya; Nafi'ah, Risyatun; Antika, Titi Rindi; Alami, Nur Hidayatul; Kuswytasari, N. D.; Zulaikha, Enny

    2017-06-01

    Lately, plastic bag is becoming the most important pollutant for environment since it is difficult to be naturally degraded due to it consists of long hydrocarbon polymer chains. Our previous study indicated that our pure isolate Pseudomonas PL-01 and Bacillus PL-01 could degrade about 10% plastic bag. This present study was aimed to find out whether Pseudomonas PL01 and Bacillus PL01 put a positive effect to indigenous bacteria from marginal area in doing plastic degradation with a soil burial method. Beach sand was used as a representative marginal area, and mangrove sediment was used as a comparison. Plastics were submerged into unsterile beach sand with 10% of Pseudomonas PL-01 or Bacillus PL-01 containing liquid minimal salt medium (MSM) separately, while other plastics were submerged into unsterile mangrove sediments. After 4, 8, 12 and 16 weeks, their biofilm formation on their plastic surfaces and plastic degradation were measured. Results indicated that those 2 isolates put positive influent on biofilm formation and plastic degradation for indigenous beach sand bacteria. Bacillus PL-01 put higher influent than Pseudomonas PL-01. Plastic transparent was preferable degraded than black and white plastic bag `kresek'. But anyhow, indigenous mangrove soil bacteria showed the best performance in biofilm formation and plastic degradation, even without Pseudomonas PL-01 or Bacillus PL-01 addition. Fourier Transform Infrared (FTIR) analysis complemented the results; there were attenuated peaks with decreasing peaks transmittances. This FTIR peaks indicated chemical functional group changes happened among the plastic compounds after 16 weeks incubation time.

  5. Structural investigation on K3Gd5(PO4)6 in between 20 K to 1073 K

    International Nuclear Information System (INIS)

    Bevara, Samatha; Achary, S.N.; Tyagi, A.K.; Mishra, K.K.; Ravindran, T.R.; Sinha, A.K.; Sastry, P.U.

    2016-01-01

    Evolution of crystal structure of K 3 Gd 5 (PO 4 ) 6 in the temperature range from 20 K to 1073 K, as observed from combined variable temperature X-ray diffraction (using both synchrotron source and Cu K α lab source) and Raman spectroscopic studies is communicated in the manuscript. The title compound has an open tunnel containing three dimensional structure built by periodic arrangements of (Gd 5 (PO 4 ) 6 ) 3- ions which in turn are formed by PO 4 tetrahedra and GdO n (n = 8 and 9) polyhedra and these tunnels are occupied by K + ions. The XRD patterns in the entire temperature range of study indicated no change in the crystal structural, which is also supported by differential thermal analyses and Raman spectroscopy. Average axial thermal expansion coefficients between 20K and 1073 K are : α a =10.6 x 10 -6 K -1 , α b = 5.5 x 10 -6 K -1 and α c = 16.4 X 10.6 -6 K -1 . (author)

  6. Study of resonance formation in the mass region 1400 - 1500 MeV through the reaction $\\gamma\\gamma \\to K^{0}_{S} K^{\\pm} \\pi^{\\mp}$

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Dela Cruz, B; Cucciarelli, S; De Asmundis, R; Deglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau,; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, 0J K; Kirkby, Jasper; Kittel, W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2007-01-01

    The K^0_SK^+-\\pi-+ final state in two-photon collisions is studied with the L3 detector at LEP at e+e- centre-of-mass energies from 183 to 209 GeV with an integrated luminosity of 664.6 pb-1. The \\eta(1475) and f1(1420) mesons are observed and their contribution is separated by measuring the formation rates as a function of the photon virtuality Q2. The \\eta(1475) is found to be dominant for Q2 <= 0.01GeV2 and its two-photon width is measured to be 0.23+-0.05 (stat.) +-0.05 (sys.) keV. At higher Q2, the f1(1420) is formed and decays to K(892)K. The \\gamma\\gamma coupling and form factor parameters of this state are measured to be \\Gamma\\gamma\\gamma = 3.2+-0.6 (stat.) +-0.7 (sys.) keV and \\Lambda1 = 926+-72 (stat.) +-32 (sys.) MeV, respectively.

  7. 46 CFR 190.01-15 - Special consideration.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Special consideration. 190.01-15 Section 190.01-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT Hull Structure § 190.01-15 Special consideration. (a) Special consideration will...

  8. Solubility and first hydrolysis constants of europium at different ionic strength and 303 K

    International Nuclear Information System (INIS)

    Ramirez-Garcia, J.J.; Jimenez-Reyes, M.; Lopez-Gonzalez, H.; Autonoma Metropolitana-Iztapalapa Univ., Mexico City; Solache-Rios, M.; Fernandez-Ramirez, E.; Centro Interamericano de Recursos del Agua, Toluca; Rojas-Hernandez, A.

    2003-01-01

    The solubility of europium at 0.02M, 0.1M and 0.7M NaClO 4 ionic strength solutions was determined by a radiometric method and pEu s -pC H diagrams were obtained. Hydrolysis constants were also determined at the same ionic strengths by pH titration and the values found were log *β 1 -7.68±0.11, -8.07±0.10 and -8.20±0.11. The log K sp values were -23.5±0.2, -22.7±0.2 and -21.9±0.2 for 0.02M, 0.1M and 0.7M NaClO 4 ionic strengths, respectively, at 303 K under CO 2 -free conditions and the extrapolated value at zero ionic strength was log K sp 0 = -24.15. The working pC H ranges for the calculation of the hydrolysis constants were selected from the pEu s -pC H diagrams in the region where precipitation of europium oxide or hydroxide was less than 20%. Europium removal from aqueous solutions with zeolites was explored. (author)

  9. Disk-type piezoelectric transformer of a Na0.5K0.5NbO3–CuNb2O6 lead-free ceramic for driving T5 fluorescent lamp

    International Nuclear Information System (INIS)

    Yang, Ming-Ru; Chu, Sheng-Yuan; Chan, I.-Hao; Yang, Song-Ling

    2012-01-01

    Highlights: ► CuNb 2 O 6 dopants were doped into NKN ceramics not only improved the density but also exhibited superior piezoelectric characteristic, temperature stability of resonance frequency. ► Lead-free NKN-01CN piezoelectric transformer was simplified as an equivalent circuit and analyzed using MATLAB. ► An 8W T5 fluorescent lamp was successfully driven by the NKN-01CN piezoelectric transformer. - Abstract: Lead-free (Na 0.5 K 0.5 )NbO 3 (NKN) ceramics doped with 1 mol% CuNb 2 O 6 (CN) ceramics were prepared using the conventional mixed oxide method, with a sintering temperature of 1075 °C. Microstructural analyses of the NKN–01CN ceramics were carried out and compared, using X-ray diffraction (XRD). NKN–01CN ceramics sintered at 1075 °C not only exhibited excellent ‘hard’ piezoelectric properties of k p = 40%, k t = 45%, k 33 = 57%, a ferroelectric property of E c = 23 kV/cm, and an extraordinarily high mechanical quality factor (Q m ) of 1933 but also showed excellent stability with temperature (TCF = −154 ppm/°C). The piezoelectric transformer was simplified, using an equivalent circuit, and analyzed, using MATLAB; the simulation data agreed well with the experimental results. An efficiency of 95.7% was achieved for the NKN–01CN piezoelectric transformer with load resistance of 20 kΩ. An 8 W T5 fluorescent lamp was successfully driven by the NKN–01CN piezoelectric transformer.

  10. Search for CP violation using triple product asymmetries in $\\Lambda^{0}_{b}\\to pK^{-}\\pi^{+}\\pi^{-}$, $\\Lambda^{0}_{b}\\to pK^{-}K^{+}K^{-}$ and $\\Xi^{0}_{b}\\to pK^{-}K^{-}\\pi^{+}$ decays arXiv

    CERN Document Server

    INSPIRE-00258707; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Albero, A. Alfonso; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A.A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R.B.; Archilli, F.; d'Argent, P.; Arnau Romeu, J.; Artamonov, A.; Artuso, M.; Aslanides, E.; Atzeni, M.; Auriemma, G.; Babuschkin, I.; Bachmann, S.; Back, J.J.; Badalov, A.; Baesso, C.; Baker, S.; Balagura, V.; Baldini, W.; Baranov, A.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Baryshnikov, F.; Batozskaya, V.; Battista, V.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Beiter, A.; Bel, L.J.; Beliy, N.; Bellee, V.; Belloli, N.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Beranek, S.; Berezhnoy, A.; Bernet, R.; Berninghoff, D.; Bertholet, E.; Bertolin, A.; Betancourt, C.; Betti, F.; Bettler, M.O.; van Beuzekom, M.; Bezshyiko, Ia.; Bifani, S.; Billoir, P.; Birnkraut, A.; Bizzeti, A.; Bjørn, M.; Blake, T.; Blanc, F.; Blusk, S.; Bocci, V.; Boettcher, T.; Bondar, A.; Bondar, N.; Bordyuzhin, I.; Borghi, S.; Borisyak, M.; Borsato, M.; Bossu, F.; Boubdir, M.; Bowcock, T.J.V.; Bowen, E.; Bozzi, C.; Braun, S.; Brodzicka, J.; Brundu, D.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Byczynski, W.; Cadeddu, S.; Cai, H.; Calabrese, R.; Calladine, R.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Perez, D.H. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Cattaneo, M.; Cavallero, G.; Cenci, R.; Chamont, D.; Chapman, M.G.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Chen, S.; Cheung, S.F.; Chitic, S.G.; Chobanova, V.; Chrzaszcz, M.; Chubykin, A.; Ciambrone, P.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collins, P.; Colombo, T.; Comerma-Montells, A.; Contu, A.; Coombs, G.; Coquereau, S.; Corti, G.; Corvo, M.; Costa Sobral, C.M.; Couturier, B.; Cowan, G.A.; Craik, D.C.; Crocombe, A.; Cruz Torres, M.; Currie, R.; D'Ambrosio, C.; Da Cunha Marinho, F.; Da Silva, C.L.; Dall'Occo, E.; Dalseno, J.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J.M.; De Paula, L.; De Serio, M.; De Simone, P.; Dean, C.T.; Decamp, D.; Del Buono, L.; Delaney, B.; Dembinski, H.P.; Demmer, M.; Dendek, A.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Nezza, P.; Dijkstra, H.; Dordei, F.; Dorigo, M.; Suárez, A. Dosil; Douglas, L.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Durante, P.; Durham, J.M.; Dutta, D.; Dzhelyadin, R.; Dziewiecki, M.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; Ely, S.; Ene, A.; Esen, S.; Evans, H.M.; Evans, T.; Falabella, A.; Farley, N.; Farry, S.; Fazzini, D.; Federici, L.; Fernandez, G.; Fernandez Declara, P.; Fernandez Prieto, A.; Ferrari, F.; Lopes, L. Ferreira; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fini, R.A.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fontana, M.; Fontanelli, F.; Forty, R.; Franco Lima, V.; Frank, M.; Frei, C.; Fu, J.; Funk, W.; Furfaro, E.; Färber, C.; Gabriel, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garcia Martin, L.M.; Pardiñas, J. García; Garra Tico, J.; Garrido, L.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianì, S.; Gibson, V.; Girard, O.G.; Giubega, L.; Gizdov, K.; Gligorov, V.V.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gorelov, I.V.; Gotti, C.; Govorkova, E.; Grabowski, J.P.; Graciani Diaz, R.; Granado Cardoso, L.A.; Graugés, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greim, R.; Griffith, P.; Grillo, L.; Gruber, L.; Gruberg Cazon, B.R.; Grünberg, O.; Gushchin, E.; Guz, Yu.; Gys, T.; Göbel, C.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S.C.; Hamilton, B.; Han, X.; Hancock, T.H.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S.T.; Hasse, C.; Hatch, M.; He, J.; Hecker, M.; Heinicke, K.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; van Herwijnen, E.; Heß, M.; Hicheur, A.; Hill, D.; Hopchev, P.H.; Hu, W.; Huang, W.; Huard, Z.C.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Ibis, P.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; Jiang, F.; John, M.; Johnson, D.; Jones, C.R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Karacson, M.; Kariuki, J.M.; Karodia, S.; Kazeev, N.; Kecke, M.; Keizer, F.; Kelsey, M.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kim, K.E.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Klimkovich, T.; Koliiev, S.; Kolpin, M.; Kopecna, R.; Koppenburg, P.; Kosmyntseva, A.; Kotriakhova, S.; Kozeiha, M.; Kravchuk, L.; Kreps, M.; Kress, F.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A.K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; Leflat, A.; Lefrançois, J.; Lefèvre, R.; Lemaitre, F.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, P.R.; Li, T.; Li, Y.; Li, Z.; Liang, X.; Likhomanenko, T.; Lindner, R.; Lionetto, F.; Lisovskyi, V.; Liu, X.; Loh, D.; Loi, A.; Longstaff, I.; Lopes, J.H.; Lucchesi, D.; Lucio Martinez, M.; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Lyu, X.; Machefert, F.; Maciuc, F.; Macko, V.; Mackowiak, P.; Maddrell-Mander, S.; Maev, O.; Maguire, K.; Maisuzenko, D.; Majewski, M.W.; Malde, S.; Malecki, B.; Malinin, A.; Maltsev, T.; Manca, G.; Mancinelli, G.; Marangotto, D.; Maratas, J.; Marchand, J.F.; Marconi, U.; Marin Benito, C.; Marinangeli, M.; Marino, P.; Marks, J.; Martellotti, G.; Martin, M.; Martinelli, M.; Martinez Santos, D.; Vidal, F. Martinez; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurice, E.; Maurin, B.; Mazurov, A.; McCann, M.; McNab, A.; McNulty, R.; Mead, J.V.; Meadows, B.; Meaux, C.; Meier, F.; Meinert, N.; Melnychuk, D.; Merk, M.; Merli, A.; Michielin, E.; Milanes, D.A.; Millard, E.; Minard, M.N.; Minzoni, L.; Mitzel, D.S.; Mogini, A.; Molina Rodriguez, J.; Mombächer, T.; Monroy, I.A.; Monteil, S.; Morandin, M.; Morello, M.J.; Morgunova, O.; Moron, J.; Morris, A.B.; Mountain, R.; Muheim, F.; Mulder, M.; Müller, D.; Müller, J.; Müller, K.; Müller, V.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, T.D.; Nguyen-Mau, C.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Nogay, A.; O'Hanlon, D.P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Oldeman, R.; Onderwater, C.J.G.; Ossowska, A.; Otalora Goicochea, J.M.; Owen, P.; Oyanguren, A.; Pais, P.R.; Palano, A.; Palutan, M.; Panshin, G.; Papanestis, A.; Pappagallo, M.; Pappalardo, L.L.; Parker, W.; Parkes, C.; Passaleva, G.; Pastore, A.; Patel, M.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Pereima, D.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petrov, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pietrzyk, G.; Pikies, M.; Pinci, D.; Pisani, F.; Pistone, A.; Piucci, A.; Placinta, V.; Playfer, S.; Plo Casasus, M.; Polci, F.; Lener, M. Poli; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Pomery, G.J.; Ponce, S.; Popov, A.; Popov, D.; Poslavskii, S.; Potterat, C.; Price, E.; Prisciandaro, J.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Pullen, H.; Punzi, G.; Qian, W.; Qin, J.; Quagliani, R.; Quintana, B.; Rachwal, B.; Rademacker, J.H.; Rama, M.; Ramos Pernas, M.; Rangel, M.S.; Raniuk, I.; Ratnikov, F.; Raven, G.; Ravonel Salzgeber, M.; Reboud, M.; Redi, F.; Reichert, S.; dos Reis, A.C.; Remon Alepuz, C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Robbe, P.; Robert, A.; Rodrigues, A.B.; Rodrigues, E.; Rodriguez Lopez, J.A.; Rogozhnikov, A.; Roiser, S.; Rollings, A.; Romanovskiy, V.; Romero Vidal, A.; Rotondo, M.; Rudolph, M.S.; Ruf, T.; Ruiz Valls, P.; Ruiz Vidal, J.; Saborido Silva, J.J.; Sadykhov, E.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarpis, G.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D.M.; Savrina, D.; Schael, S.; Schellenberg, M.; Schiller, M.; Schindler, H.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schreiner, H.F.; Schubiger, M.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sepulveda, E.S.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Siddi, B.G.; Silva Coutinho, R.; Silva de Oliveira, L.; Simi, G.; Simone, S.; Skidmore, N.; Skwarnicki, T.; Smith, I.T.; Smith, J.; Smith, M.; Soares Lavra, l.; Sokoloff, M.D.; Soler, F.J.P.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Stagni, F.; Stahl, M.; Stahl, S.; Stefko, P.; Stefkova, S.; Steinkamp, O.; Stemmle, S.; Stenyakin, O.; Stepanova, M.; Stevens, H.; Stone, S.; Storaci, B.; Stracka, S.; Stramaglia, M.E.; Straticiuc, M.; Straumann, U.; Strokov, S.; Sun, J.; Sun, L.; Swientek, K.; Syropoulos, V.; Szumlak, T.; Szymanski, M.; T'Jampens, S.; Tang, Z.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; Thomas, E.; van Tilburg, J.; Tilley, M.J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Aoude, R. Tourinho Jadallah; Tournefier, E.; Traill, M.; Tran, M.T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tully, A.; Tuning, N.; Ukleja, A.; Usachov, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagner, A.; Vagnoni, V.; Valassi, A.; Valat, S.; Valenti, G.; Vazquez Gomez, R.; Regueiro, P. Vazquez; Vecchi, S.; van Veghel, M.; Velthuis, J.J.; Veltri, M.; Veneziano, G.; Venkateswaran, A.; Verlage, T.A.; Vernet, M.; Vesterinen, M.; Viana Barbosa, J.V.; Vieira, D.; Vieites Diaz, M.; Viemann, H.; Vilasis-Cardona, X.; Vitkovskiy, A.; Vitti, M.; Volkov, V.; Vollhardt, A.; Voneki, B.; Vorobyev, A.; Vorobyev, V.; Voß, C.; de Vries, J.A.; Vázquez Sierra, C.; Waldi, R.; Walsh, J.; Wang, J.; Wang, M.; Wang, Y.; Ward, D.R.; Wark, H.M.; Watson, N.K.; Websdale, D.; Weiden, A.; Weisser, C.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Wilkinson, M.; Williams, M.R.J.; Williams, M.; Williams, T.; Wilson, F.F.; Wimberley, J.; Winn, M.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S.A.; Wyllie, K.; Xie, Y.; Xu, M.; Xu, Q.; Xu, Z.; Yang, Z.; Yao, Y.; Yin, H.; Yu, J.; Yuan, X.; Yushchenko, O.; Zarebski, K.A.; Zavertyaev, M.; Zhang, L.; Zhang, Y.; Zhelezov, A.; Zheng, Y.; Zhu, X.; Zhukov, V.; Zonneveld, J.B.; Zucchelli, S.

    A search for $C$P and $P$ violation using triple-product asymmetries is performed with $\\Lambda^{0}_{b}\\to pK^{-}\\pi^{+}\\pi^{-}$, $\\Lambda^{0}_{b}\\to pK^{-}K^{+}K^{-}$ and $\\Xi^{0}_{b}\\to pK^{-}K^{-}\\pi^{+}$ decays. The data sample corresponds to integrated luminosities of 1.0fb$^{-1}$ and 2.0fb$^{-1}$, recorded with the LHCb detector at centre-of-mass energies of 7TeV and 8TeV, respectively. The $CP$- and $P$-violating asymmetries are measured both integrating over all phase space and in specific phase-space regions. No significant deviation from $CP$ or $P$ symmetry is found.

  11. Searches for B0 Decays to eta K0, eta eta,eta' eta', eta phi, and eta'phi

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-07-31

    The authors search for B{sup 0} meson decays into two-body combinations of K{sup 0}, {eta}, {eta}', and {phi} mesons in 324 million B{bar B} pairs collected with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider at SLAC. They measure the following branching fractions (upper limits at 90% confidence level) in units of 10{sup -6}: {Beta}(B{sup 0} {yields} {eta}K{sup 0}) = 1.8{sub -0.6}{sup +0.7} {+-} 0.1 (< 2.9), {Beta}(B{sup 0} {yields} {eta}{eta}) = 1.1{sub -0.4}{sup +0.5} {+-} 0.1(< 1.8), {Beta}(B{sup 0} {yields} {eta}{phi}) = 0.1 {+-} 0.2 {+-} 0.1(< 0.6), {Beta}(B{sup 0} {yields} {eta}'{phi}) = 0.2{sub -0.3}{sup +0.4} {+-} 0.1(< 1.0), and {Beta}(B{sup 0} {yields} {eta}'{eta}') = 1.0{sub -0.6}{sup +0.8} {+-} 0.1 (< 2.4), where the first error is statistical and the second systematic.

  12. The magnetic transition temperature tuned by strain in YMn0.9Ru0.1O3 thin films

    Directory of Open Access Journals (Sweden)

    L. P. Yang

    2018-05-01

    Full Text Available Epitaxial orthorhombic YMn0.9Ru0.1O3 films with different thickness have been grown on (001-SrTiO3 substrates by pulsed laser deposition (PLD. The crystal structure is well investigated by X-ray Diffraction. It is found that the out-of-plane parameter c slowly increases with decreasing thickness of samples because of the tensile strain between the films and substrates along c axis. The lengths of in-plane Mn-O bonds expand with the enhancement of strains, which is proved by Raman scatting. The magnetic measurements reveal that there exist two magnetic transition temperatures TN1 and TN2. The TN1 is close to that of orthorhombic YMnO3 bulk. With decreasing thickness of the films, TN1 keeps almost constant because of the small stain along c-axis. TN2, however, obviously increases from 117 K to 134 K, which could be related to the expansion of in-plane Mn-O bonds. Results show that the magnetic transition temperature of YMn0.9Ru0.1O3 films can be sensitively manipulated by the strain of the films.

  13. Muusika : Kaljuste Madalmaade kooriga USAs. Weekend Guitar Trio Lüneburgis. Petrovi koor Iirimaal ja Norras. Poola kvintett Tallinna Raekojas. Esineb Tatjana Smelova. "improvizz'01" Tartus. "Klassikaraadio" Wagnerit avastamas

    Index Scriptorium Estoniae

    2001-01-01

    Tõnu Kaljuste käis Madalmaade kammerkooriga USAs. Weekend Guitar Trio esineb Lüneburgis. Õigeusu Vaimuliku Muusika Kammerkoor Valeri Petrovi juhatusel käis Iirimaal ja Norras esinemas. Poola keelpillikvintett MultiCamerata esines Tallinna Raekojas. Eestis annab kontserte pianist Tatjana Smelova. 8.-10. nov. toimub Tartus "improvizz'01" . "Klassikaraadio" Wagnerit avastamas

  14. 46 CFR 92.01-15 - Special consideration.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Special consideration. 92.01-15 Section 92.01-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS CONSTRUCTION AND ARRANGEMENT Hull Structure § 92.01-15 Special consideration. (a) Special consideration will be...

  15. In Vitro Inhibition of Klebsiella pneumoniae by Lactobacillus delbrueckii Subsp. delbrueckii LDD01 (DSM 22106): An Innovative Strategy to Possibly Counteract Such Infections in Humans?

    Science.gov (United States)

    Mogna, Luca; Deidda, Francesca; Nicola, Stefania; Amoruso, Angela; Del Piano, Mario; Mogna, Giovanni

    To determine the in vitro antimicrobial activity of selected Lactobacillus strains isolated from the feces of healthy humans against Klebsiella pneumoniae. Klebsiella is ubiquitous in nature and may colonize the skin, the pharynx, or the gastrointestinal tract of humans. Despite the widespread use of antibiotic molecules with a broad spectrum in hospitalized patients, an increased overall load of klebsiellae as well as the subsequent development of multidrug-resistant strains able to synthesize extended-spectrum beta-lactamase have been registered. These strains are particularly virulent, express capsular-type K55, and have a considerable ability to propagate. The 4 strains Lactobacillus paracasei LPC01 (CNCM I-1390), Lactobacillus rhamnosus LR04 (DSM 16605), Bifidobacterium longum B2274 (DSM 24707), and Lactobacillus delbrueckii subsp. delbrueckii LDD01 (DSM 22106) were tested. The analysis was performed using both a disc-diffusion assay and the broth-dilution procedure, also including an evaluation of the supernatants obtained from a fresh broth culture of each bacterium. L. delbrueckii subsp. delbrueckii LDD01 demonstrated the best inhibitory results among all the tested strains. The antibacterial activity of the supernatant was retained even after treatment with α-amylase and neutralization with NaOH 1N, thus suggesting the protein structure of the inhibitory molecule. In contrast, it was completely lost after treatment with proteinase K. Overall results suggest that the inhibitory effect of L. delbrueckii subsp. delbrueckii LDD01 should be attributed to the production of a bacteriocin. This strain may be prospectively useful for strengthening probiotic formulations and possibly counteract infections by K. pneumoniae in humans.

  16. Thermoluminescence and glow curves analysis of γ-exposed Eu3+ doped K3Y(PO4)2 nanophosphors

    International Nuclear Information System (INIS)

    Gupta, Palvi; Bedyal, A.K.; Kumar, Vinay; Singh, Vivek K.; Khajuria, Y.; Ntwaeaborwa, O.M.; Swart, H.C.

    2016-01-01

    Highlights: • First time, a detailed comparative study of the glow curves and kinetic parameters was made on K 3 Y(PO 4 ) 2 nanophosphor. • Combustion method was employed to synthesize the Eu 3+ doped K 3 Y(PO 4 ) 2 nanophosphor. • The nanophosphor exhibited sublinear response suggesting that it is suitable for TL dosimetry. - Abstract: Eu 3+ doped K 3 Y(PO 4 ) 2 nanophosphor was synthesized by combustion synthesis using urea as a fuel. The crystal structure and particle morphology of the nanophosphor were investigated by using X-ray diffraction and transmission electron microscopy, respectively. A Thermoluminescence (TL) study was carried out after exposing the samples to gamma radiation. The TL glow curves exhibited a prominent peak at 407 K and a small hump at 478 K. The intensity of the peaks increased with the increase in the dose of the gamma rays (0.01–5 kGy). The K 3 Y(PO 4 ) 2 : Eu 3+ (2.5 mol%) nanophosphor exhibited sublinear TL response to γ-radiation over a wide range of gamma doses (0.01–5 kGy). The TLanal program was used to analyze the glow curves of the K 3 Y(PO 4 ) 2 nanophosphor at different doses (0.2–5 kGy) and different heating rates (3–10 K/s). A comparative study was done for kinetic trapping parameters that were determined by the peak shape methods of Chen, Grossweiner and Lushchik. The frequency factors (s) for each glow peak were also calculated. The values of the activation energy (E) obtained by the TLanal program were in good agreement with those obtained by the peak shape methods. The effect of different amount of doses and different heating rates are discussed.

  17. Determining the k in k-means with MapReduce

    OpenAIRE

    Debatty , Thibault; Michiardi , Pietro; Mees , Wim; Thonnard , Olivier

    2014-01-01

    International audience; In this paper we propose a MapReduce implementation of G-means, a variant of k-means that is able to automatically determine k, the number of clusters. We show that our implementation scales to very large datasets and very large values of k, as the computation cost is proportional to nk. Other techniques that run a clustering algorithm with different values of k and choose the value of k that provides the " best " results have a computation cost that is proportional to...

  18. Transport systems of Ventricaria ventricosa: I/V analysis of both membranes in series as a function of [K(+)](o).

    Science.gov (United States)

    Beilby, M J; Bisson, M A

    1999-09-01

    The current-voltage (I/V) profiles of Ventricaria (formerly Valonia) membranes were measured at a range of external potassium concentrations, [K(+)](o), from 0.1 to 100 mm. The conductance-voltage (G/V) characteristics were computed to facilitate better resolution of the profile change with time after exposure to different [K(+)](o). The resistance-voltage (R/V) characteristics were computed to attempt resolution of plasmalemma and tonoplast. Four basic electrophysiological stages emerged: (1) Uniform low resistance between -60 and +60 mV after the cell impalement. (2) High resistance between +50 and +150 for [K(+)](o) from 0.1 to 1.0 mm and hypotonic media. (3) High resistance between -150 and -20 mV for [K(+)](o) of 10 mm (close to natural seawater) and hypertonic media. (4) High resistance between -150 and +170 mV at [K(+)](o) of 100 mm. The changes between these states were slow, requiring minutes to hours and sometimes exhibiting spontaneous oscillations of the membrane p.d. (potential difference). Our analysis of the I/V data supports a previous hypothesis, that Ventricaria tonoplast is the more resistive membrane containing a pump, which transports K(+) into the vacuole to regulate turgor. We associate state (1) with the plasmalemma conductance being dominant and the K(+) pump at the tonoplast short-circuited probably by a K(+) channel, state (2) with the K(+) pump "off" or short-circuited at p.d.s more negative than +50 mV, state (3) with the K(+) pump "on, " and state (4) with the pump dominant, but affected by high K(+). A model for the Ventricaria membrane system is proposed.

  19. Maintaining K+ balance on the low-Na+, high-K+ diet

    Science.gov (United States)

    Cornelius, Ryan J.; Wang, Bangchen; Wang-France, Jun

    2016-01-01

    A low-Na+, high-K+ diet (LNaHK) is considered a healthier alternative to the “Western” high-Na+ diet. Because the mechanism for K+ secretion involves Na+ reabsorptive exchange for secreted K+ in the distal nephron, it is not understood how K+ is eliminated with such low Na+ intake. Animals on a LNaHK diet produce an alkaline load, high urinary flows, and markedly elevated plasma ANG II and aldosterone levels to maintain their K+ balance. Recent studies have revealed a potential mechanism involving the actions of alkalosis, urinary flow, elevated ANG II, and aldosterone on two types of K+ channels, renal outer medullary K+ and large-conductance K+ channels, located in principal and intercalated cells. Here, we review these recent advances. PMID:26739887

  20. 21 CFR 1321.01 - DEA mailing addresses.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false DEA mailing addresses. 1321.01 Section 1321.01 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE DEA MAILING ADDRESSES § 1321.01 DEA mailing addresses. The following table provides information regarding mailing addresses to be used...

  1. 46 CFR 72.01-20 - Special consideration.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Special consideration. 72.01-20 Section 72.01-20 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS CONSTRUCTION AND ARRANGEMENT Hull Structure § 72.01-20 Special consideration. (a) Special consideration will be given to the...

  2. Hadronic molecular states from the K anti K* interaction

    Energy Technology Data Exchange (ETDEWEB)

    Lue, Pei-Liang; He, Jun [Chinese Academy of Sciences, Theoretical Physics Division, Institute of Modern Physics, Lanzhou (China); Institute of Modern Physics of CAS and Lanzhou University, Research Center for Hadron and CSR Physics, Lanzhou (China)

    2016-12-15

    In this work, the K anti K* interaction is studied in a quasipotential Bethe-Salpeter equation approach combined with the one-boson-exchange model. With the help of the hidden-gauge Lagrangian, the exchanges of pseudoscalar mesons (π and η) and vector mesons (ρ, ω and φ) are considered to describe the K anti K* interaction. Besides the direct vector-meson exchange which can be related to the Weinberg-Tomozawa term, pseudoscalar-meson exchanges also play important roles in the mechanism of the K anti K* interaction. The poles of scattering amplitude are searched to find the molecular states produced from the K anti K* interaction. In the case of quantum number I{sup G}(J{sup PC}) = 0{sup +}(1{sup ++}), a pole is found with a reasonable cutoff, which can be related to the f{sub 1}(1285) in experiment. Another bound state with 0{sup -}(1{sup +-}) is also produced from the K anti K* interaction, which can be related to the h{sub 1}(1380). In the isovector sector, the interaction is much weaker and a bound state with 1{sup +}(1{sup +}) relevant to the b{sub 1}(1235) is produced but at a larger cutoff. Our results suggest that in the hadronic molecular state picture the f{sub 1}(1285) and b{sub 1}(1235) are the strange partners of the X(3872) and Z{sub c}(3900), respectively. (orig.)

  3. Search for the suppressed decays B+ -> K+K+pi(-) and B+ -> pi(+)pi K-+(-)

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M. H.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A. Jr; Amato, S.; Amerio, S.; Amhis, Y.; BEACH, LA; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J.E.; Appleby, R.B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Romeu, J. Arnau; Artamonov, AY; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Babuschkin, I.; Bachmann, S; Back, Jaap Willem; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Batsukh, B.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Be, L. J.; Bellee, V.; Belloli, N.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M.O.; van Beuzekom, MG; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bitadze, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Boettcher, Thomas; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Bossu, F.; Boubdir, M.; Bowcock, T. J. V.; Bowen, D.E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, R. J.; Cadeddu, S.; Calabrese, J. R.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Perez, D. Campora; Perez, D. H. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, T.F.S.; Chobanova, V.; Chobanova, V.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogonilf, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; COOK, AM; Coquereau, S.; Corti, G.; Corvo, M.; Sobral, C. M. Costa; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A. C.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; Miranda, J. M.; De Paula, L.; De Serio, M.; De Simone, Paolo; Dean, C. -T.; Decamp, D.; Deckenhoffl, M.; Del Buono, L.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Deleage, N.; Easo, S.; Ebert, Martin A.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Ely, SIdi Ould; Esen, S.; Evans, Helen M.; Evans, T.; Falabella, A.; Farley, N.; Farry, S.; Fay, R. F.; Fazzini, D.; FERGUSON, D; Fernandez Albor, V.; Fernandez Prieto, A.; Ferrari, F; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frei, C.; Furfaro, E.; Farber, CR; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Garcia Martin, L. M.; Garcia Pardinas, J.; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E. G; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani', S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gizdov, K.; Gligorov, V. V.; Golubkov, D.; Golutvin, A.; Gorelov, I. V.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Cazon, B. R. Gruberg; Gruenberg, O.; Gushchin, EM; Guz, Yu.; Gys, T.; Gobel, C.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hal, S.; Hamilton, D.B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, Christine J.; Hatch, M.; He, J. J.; Head, T.; Heister, J. A.; Hennessy, K.; Henrard, P.; Henry, Lee; Hernando Morata, J. A.; Van Herwijnen, E.; Hess, M.; Hicheur, A.; HILL, D; Hombach, C.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; John, Jestinah M. Mahachie; Johnson, D; Jones, Jonathan C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Kariuki, J. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T. J.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, N. S.; Klimaszewski, K.; Koliiev, S.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozachuk, A.; Kozeiha, M.; Kravchuk, Vladimir Leonidovich; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; Van Leerdam, J.; Lees, J. -P.; Leflat, A.; Lefrancois, J.; Lefevre, R.; Lemaitre, F.; Lemos Cid, E.; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Lindner, R.; Linn, C.; Lionetto, F.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Lucio Martinez, M.; Luo, Haibin; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Lyu, X. R.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, Kate; Malde, S.; Malinin, A.; Maltsev, T.; Manca, G.; Mancinelli, G.; Manning, P.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, Paolo; Marks, J. D.; Martellotti, G.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, Linda M.; McCarthy, Patrick J.; McNab, A.; McNulty, R.; Meadows, B.; Meier, F.; Melnychuk, D.; Merk, M.; Merli'q, A.; Michielin, E.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Molina Rodriguez, J.; Moreno-Monroy, Ana I.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. -B.; Mountain, R.; Muheim, F.; Mulder, M.; Mussini, M.; Mueller, J.; Mueller, K.; Mueller, Volker; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Oldeman, R.; Onderwater, C. J. G.; Goicochea, J. M. Otalora; Otto, A.; Owen, Randall P.; Oyanguren, A.; Pais, P. R.; Palano, A.; Palombo, F.; Palutan, M.; Papanestis, A.; Pappagallo, M.; Pappalardo, L.; Pappenheimer, C.; Parker, Anthony W.; Parkes, C.; Passaleva, G.; Patel, G. D.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petrov, A. D.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Pomery, G. J.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, P. E.; Price, Daniel J.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, S. W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Ramos Pernas, M.; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, Andreas S.; Dos Reis, A. C.; Remon Alepuz, C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Rodrigues, A. B.; Rodrigues, Eliane R.; Rodriguez Lopez, J. A.; Perez, P. Rodriguez; Rogozhnikov, A.; Roiser, S.; Romanovskiy, V.; Romero Vidal, A.; Ronayne, J. W.; Rotondo, M.; Ruf, Thomas; Ruiz Valls, P.; Saborido Silva, J. J.; Sadykhov, E.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A.; Serra, N.; Gonzalez-Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Coutinho, R. Silva; Silva de Oliveira, L.; Simi, G.; Simone Doolaard, [No Value; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, I. T.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Souza, Thomas G. D’; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, Sherin S.; Stefko, P.; Stefkova, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stone, Ian S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sutcliffe, W.; Swientek, K.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, E.; Tilburg, Jeroen J H C; Tisserand, V.; Tobin, M; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Toriello, F.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tully, A.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valat, S.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vecchi, S.; van Veghel, M.; Veithuis, J. J.; Veltri, M.; Veneziano, G.; Venkateswaran, A.; Vesterinen, M.; Viaud, B.; VIEIRA, DF; Vieites Diaz, M.; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voneki, B.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Vazquez Sierra, C.; Waldi, R.; Wallace, C.; Wallace, R; Ward, D. R.; Wark, H. M.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Williams, Tishan; Wilson, F. Perry; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y; Xing, Zhe; Yang, Z.; Yu, J.; Yuan, X.-L.; Yushchenko, O.; Zangoli, M.; Zarebski, K. A.; Zavertyaev, M.; Zhelezov, A.; Zheng, Y.; Zhokhov, A.; Zhukov, V.; Zucchelli, S.; Collaboration, Lhcb

    2017-01-01

    A search is made for the highly-suppressed B meson decays B+ -> K+K+pi(-) and B+ -> pi(+)pi K-+(-) using a data sample corresponding to an integrated luminosity of 3.0 fb(-1) collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of 7 and 8 TeV. No evidence is found

  4. Analysis of the differential cross sections for the reaction pp{yields}ppK{sup +}K{sup -} in view of the K{sup +}K{sup -} interaction

    Energy Technology Data Exchange (ETDEWEB)

    Silarski, M.

    2008-07-15

    Measurements of the pp{yields}ppK{sup +}K{sup -} reaction, performed with the experiment COSY-11 at the Cooler Synchrotron COSY, show a significant difference between the obtained excitation function and theoretical expectations including pp-FSI. The discrepancy may be assigned to the influence of K{sup +}K{sup -} or K{sup -}p interaction. This interaction should manifest itself in the distributions of the differential cross section. This thesis presents an analysis of event distributions as a function of the invariant masses of two particle subsystems. In particular in the analysis two generalizations of the Dalitz plot proposed by Goldhaber and Nyborg are used. The present Investigations are based on the experimental data determined by the COSY-11 collaboration from two measurements at excess energies of Q=10 MeV and 28 MeV. The experimental distributions are compared to results of Monte Carlo simulations generated with various parameters of the K{sup +}K{sup -} and K{sup -}p interaction. The values of the K{sup +}K{sup -} scattering length, extracted from two data sets for Q=10 MeV and 28 MeV amount to: a{sub K{sup +}}{sub K{sup -}}=(11{+-}8)+i(0{+-}6) fm for Q=10 MeV, and a{sub K{sup +}}{sub K{sup -}}=(0.2{+-}0.2)+i(0.0{+-}0.5) fm for Q=28 MeV. Due to the low statistics, the extracted values have large uncertainties and are consistent with very low values of the real and imaginary part of the scattering length. (orig.)

  5. Antitumor effects of vitamins K1, K2 and K3 on hepatocellular carcinoma in vitro and in vivo.

    Science.gov (United States)

    Hitomi, Misuzu; Yokoyama, Fumi; Kita, Yuko; Nonomura, Takako; Masaki, Tsutomu; Yoshiji, Hitoshi; Inoue, Hideyuki; Kinekawa, Fumihiko; Kurokohchi, Kazutaka; Uchida, Naohito; Watanabe, Seishiro; Kuriyama, Shigeki

    2005-03-01

    A number of studies have shown that various K vitamins, specifically vitamins K2 and K3, possess antitumor activity on various types of rodent- and human-derived neoplastic cell lines. In the present study, we examined the antitumor effects of vitamins K1, K2 and K3 on PLC/PRF/5 human hepatocellular carcinoma (HCC) cells in vitro and in vivo. Furthermore, we examined the mechanisms of antitumor actions of these vitamins in vitro and in vivo. Although vitamin K1 did not inhibit proliferation of PLC/PRF/5 cells at a 90-microM concentration (the highest tested), vitamins K2 and K3 suppressed proliferation of the cells at concentrations of 90 and 9 microM, respectively. By flow cytometric analysis, it was shown that not only vitamin K1, but also vitamin K2 did not induce apoptosis or cell cycle arrest on PLC/PRF/5 cells. In contrast, vitamin K3 induced G1 arrest, but not apoptosis on PLC/PRF/5 cells. Subsequent in vivo study using subcutaneous HCC-bearing athymic nude mice demonstrated that both vitamins K2 and K3 markedly suppressed the growth of HCC tumors to similar extent. Protein expression of cyclin D1 and cyclin-dependent kinase 4 (Cdk4), but not p16INK4a Cdk inhibitor in the tumor was significantly reduced by vitamin K2 or K3 treatment, indicating that vitamins K2 and K3 may induce G1 arrest of cell cycle on PLC/PRF/5 cells in vivo. Taken collectively, vitamins K2 and K3 were able to induce potent antitumor effects on HCC in vitro and in vivo, at least in part, by inducing G1 arrest of the cell cycle. The results indicate that vitamins K2 and K3 may be useful agents for the treatment of patients with HCC.

  6. Observation of the Decay Ξ_{b}^{-}→pK^{-}K^{-}.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baszczyk, M; Batozskaya, V; Batsukh, B; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Bel, L J; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Berezhnoy, A; Bernet, R; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bitadze, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bonivento, W; Bordyuzhin, I; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S-F; Chobanova, V; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Déléage, N; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Griffith, P; Grillo, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hatch, M; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, H; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kecke, M; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Koliiev, S; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Kosmyntseva, A; Kozachuk, A; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, T; Li, Y; Likhomanenko, T; Lindner, R; Linn, C; Lionetto, F; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Manning, P; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Mussini, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palombo, F; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Popov, A; Popov, D; Popovici, B; Poslavskii, S; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schubert, K; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Snoek, H; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stevens, H; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Toriello, F; Tournefier, E; Tourneur, S; Trabelsi, K; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zucchelli, S

    2017-02-17

    Decays of the Ξ_{b}^{-} and Ω_{b}^{-} baryons to the charmless final states ph^{-}h^{'-}, where h^{(')} denotes a kaon or pion, are searched for with the LHCb detector. The analysis is based on a sample of proton-proton collision data collected at center-of-mass energies sqrt[s]=7 and 8 TeV, corresponding to an integrated luminosity of 3  fb^{-1}. The decay Ξ_{b}^{-}→pK^{-}K^{-} is observed with a significance of 8.7 standard deviations, and evidence at the level of 3.4 standard deviations is found for the Ξ_{b}^{-}→pK^{-}π^{-} decay. Results are reported, relative to the B^{-}→K^{+}K^{-}K^{-} normalization channel, for the products of branching fractions and b-hadron production fractions. The branching fractions of Ξ_{b}^{-}→pK^{-}π^{-} and Ξ_{b}^{-}→pπ^{-}π^{-} relative to Ξ_{b}^{-}→pK^{-}K^{-} decays are also measured.

  7. 46 CFR 52.01-10 - Automatic controls.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Automatic controls. 52.01-10 Section 52.01-10 Shipping... Requirements § 52.01-10 Automatic controls. (a) Each main boiler must meet the special requirements for automatic safety controls in § 62.35-20(a)(1) of this chapter. (b) Each automatically controlled auxiliary...

  8. Precise measurement of the $K^{\\pm} \\to \\pi^{\\pm}e^{+}e^{−}$ decay

    CERN Document Server

    Batley, J.R.; Kalmus, G.; Lazzeroni, C.; Munday, D.J.; Slater, M.W.; Wotton, S.A.; Arcidiacono, R.; Bocquet, G.; Cabibbo, N.; Ceccucci, A.; Cundy, D.; Falaleev, V.; Fidecaro, M.; Gatignon, L.; Gonidec, A.; Kubischta, W.; Norton, A.; Maier, A.; Patel, M.; Peters, A.; Balev, S.; Frabetti, P.L.; Goudzovski, E.; Hristov, P.; Kekelidze, V.; Kozhuharov, V.; Litov, L.; Madigozhin, D.; Marinova, E.; Molokanova, N.; Polenkevich, I.; Potrebenikov, Yu.; Stoynev, S.; Zinchenko, A.; Monnier, E.; Swallow, E.; Winston, R.; Rubin, P.; Walker, A.; Baldini, W.; Cotta Ramusino, A.; Dalpiaz, P.; Damiani, C.; Fiorini, M.; Gianoli, A.; Martini, M.; Petrucci, F.; Savrie, M.; Scarpa, M.; Wahl, H.; Bizzeti, A.; Calvetti, M.; Celeghini, E.; Iacopini, E.; Lenti, M.; Martelli, F.; Ruggiero, G.; Veltri, M.; Behler, M.; Eppard, K.; Kleinknecht, K.; Marouelli, P.; Masetti, L.; Moosbrugger, U.; Morales Morales, C.; Renk, B.; Wache, M.; Wanke, R.; Winhart, A.; Coward, D.; Dabrowski, A.; Fonseca Martin, T.; Shieh, M.; Szleper, M.; Velasco, M.; Wood, M.D.; Anzivino, G.; Cenci, P.; Imbergamo, E.; Nappi, A.; Pepe, M.; Petrucci, M.C.; Piccini, M.; Raggi, M.; Valdata-Nappi, M.; Cerri, C.; Fantechi, R.; Collazuol, G.; DiLella, L.; Lamanna, G.; Mannelli, I.; Michetti, A.; Costantini, F.; Doble, N.; Fiorini, L.; Giudici, S.; Pierazzini, G.; Sozzi, M.; Venditti, S.; Bloch-Devaux, B.; Cheshkov, C.; Cheze, J.B.; De Beer, M.; Derre, J.; Marel, G.; Mazzucato, E.; Peyaud, B.; Vallage, B.; Holder, M.; Ziolkowski, M.; Bifani, S.; Biino, C.; Cartiglia, N.; Clemencic, M.; Goy Lopez, S.; Marchetto, F.; Dibon, H.; Jeitler, M.; Markytan, M.; Mikulec, I.; Neuhofer, G.; Widhalm, L.

    2009-01-01

    A sample of 7253 $K^\\pm\\to\\pi^\\pm e^+e^-(\\gamma)$ decay candidates with 1.0% background contamination has been collected by the NA48/2 experiment at the CERN SPS, allowing a precise measurement of the decay properties. The branching ratio in the full kinematic range was measured to be ${\\rm BR}=(3.11\\pm0.12)\\times 10^{-7}$, where the uncertainty includes also the model dependence. The shape of the form factor $W(z)$, where $z=(M_{ee}/M_K)^2$, was parameterized according to several models, and, in particular, the slope $\\delta$ of the linear form factor $W(z)=W_0(1+\\delta z)$ was determined to be $\\delta=2.32\\pm0.18$. A possible CP violating asymmetry of $K^+$ and $K^-$ decay widths was investigated, and a conservative upper limit of $2.1\\times 10^{-2}$ at 90% CL was established.

  9. K25/K27 Characterization for Demonstrating Criticality Incredibility K-25 / K-27 D and D Project

    International Nuclear Information System (INIS)

    Haghighi, Mahmoud H.; Howe, Kathleen E.; Chandler, John R.

    2008-01-01

    The K-25 and K-27 Buildings are currently undergoing decontamination and decommissioning (D and D) as part of a non-time critical removal action. When the enrichment process was shut-down, the process gas equipment and piping was purged to remove UF 6 , but the process gas system was not generally chemically treated to remove solid holdup. Generally, chemical treatment was completed it was not very effective in removing the larger deposits. Because of this, uranium deposits continue to reside throughout the process gas system. There is the potential for unreacted UF 6 to be present, as well. A key part of this project is to locate the remaining significant uranium deposits and manage them appropriately. Since some process gas components in the K-25 and K-27 Buildings contain enriched uranium holdup, it is important to ensure nuclear criticality safety during demolition or subsequent loading and transport of waste. Therefore, a major task in preparation for demolition is to demonstrate that 'criticality is incredible (CI)' in each building area. The U.S. Department of Energy (DOE) and Bechtel Jacobs Company LLC (BJC) are in agreement that proper and thorough characterization of fissile holdup material in the K-25 and K-27 process gas components is a key element in achieving and demonstrating that criticality is incredible, as well as in management of demolition wastes and collection of holdup material. While the classic project scheduling wisdom may indicate that performing all of the data quality objectives (DQO) and planning before the field work starts, the size of the K-25 / K-27 D and D Project combined with the evolving decommissioning plans and re-plans have indicated that a fresh look at what further characterization data are needed to meet the current project requirements. Performing a DQO in the middle of the project allowed a much greater degree of accuracy of the real project data needs than was possible even 22 months ago. The outcome of the DQO work

  10. Mechanisms of astrocytic K(+) clearance and swelling under high extracellular K(+) concentrations.

    Science.gov (United States)

    Murakami, Shingo; Kurachi, Yoshihisa

    2016-03-01

    In response to the elevation of extracellular K(+) concentration ([K(+)]out), astrocytes clear excessive K(+) to maintain conditions necessary for neural activity. K(+) clearance in astrocytes occurs via two processes: K(+) uptake and K(+) spatial buffering. High [K(+)]out also induces swelling in astrocytes, leading to edema and cell death in the brain. Despite the importance of astrocytic K(+) clearance and swelling, the underlying mechanisms remain unclear. Here, we report results from a simulation analysis of astrocytic K(+) clearance and swelling. Astrocyte models were constructed by incorporating various mechanisms such as intra/extracellular ion concentrations of Na(+), K(+), and Cl(-), cell volume, and models of Na,K-ATPase, Na-K-Cl cotransporter (NKCC), K-Cl cotransporter, inwardly-rectifying K(+) (KIR) channel, passive Cl(-) current, and aquaporin channel. The simulated response of astrocyte models under the uniform distribution of high [K(+)]out revealed significant contributions of NKCC and Na,K-ATPase to increases of intracellular K(+) and Cl(-) concentrations, and swelling. Moreover, we found that, under the non-uniform distribution of high [K(+)]out, KIR channels localized at synaptic clefts absorbed excess K(+) by depolarizing the equivalent potential of K(+) (E K) above membrane potential, while K(+) released through perivascular KIR channels was enhanced by hyperpolarizing E K and depolarizing membrane potential. Further analysis of simulated drug effects revealed that astrocyte swelling was modulated by blocking each of the ion channels and transporters. Our simulation analysis revealed controversial mechanisms of astrocytic K(+) clearance and swelling resulting from complex interactions among ion channels and transporters.

  11. D K Mishra

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D K Mishra. Articles written in Bulletin of Materials Science. Volume 34 Issue 7 December 2011 pp 1501-1506. Ce-doped LCMO CMR manganites: a consequence of enhanced T c and T IM · D K Mishra D R Sahu P K Mishra S K Singh B K Mohapatra B K Roul · More Details ...

  12. 46 CFR 58.01-10 - Fuel oil.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Fuel oil. 58.01-10 Section 58.01-10 Shipping COAST GUARD... SYSTEMS General Requirements § 58.01-10 Fuel oil. (a) The following limits apply to the use of oil as fuel: (1) Except as otherwise permitted by this section, no fuel oil with a flashpoint of less than 60 °C...

  13. Changes in interstitial K+ and pH during exercise: implications for blood flow regulation

    DEFF Research Database (Denmark)

    Juel, Carsten

    2007-01-01

    that blood flow is affected by changes in K+ as low as 0.1 mmol/L. The vasodilatory effect of K+ can be inhibited with simultaneous barium infusion, indicating that inward rectifier potassium (Kir)channels are involved. Acidosis has a direct effect on blood flow and an indirect effect, mediated by changes...... with the microdialysis technique. Interstitial K+ accumulation is dependent on the intensity and duration of muscle activity and may reach 10 mmol/L during intense exercise, and the concentration in T-tubules may be even higher. Thus, interstitial K+ can reach a level that affects fibre excitability and the development...... of fatigue. It has also been demonstrated with microdialysis that the interstitial decrease in pH during muscle activity is larger than the reduction in blood pH. Ion changes in the interstitium may affect blood flow directly or indirectly. Infusion of K+ into the femoral artery in humans has demonstrated...

  14. Time-dependent Dalitz-Plot Analysis of the Charmless Decay B^0 -> K^0S Pi Pi- at BABAR

    Energy Technology Data Exchange (ETDEWEB)

    Ilic, J

    2009-10-17

    A time-dependent amplitude analysis of B{sup 0} {yields} K{sub S}{sup 0}{pi}{sup +}{pi}{sup -} decays is performed in order to extract the CP violation parameters of f{sub 0}(980)K{sub S}{sup 0} and {rho}{sup 0}(770)K{sub S}{sup 0} and direct CP asymmetries of K*{sup +}(892){pi}{sup -}. The results are obtained from the final BABAR data sample of (465 {+-} 5)10{sup 6} B{bar B} decays, collected with the BABAR detector at the PEP-II asymmetric-energy B factory at SLAC. The time dependent CP asymmetry for f{sub 0}(980)K{sub S}{sup 0} and {rho}{sup 0}(770)K{sub S}{sup 0} are measured to be S(f{sub 0}(980)K{sub S}{sup 0}) = -0.97 {+-} 0.09 {+-} 0.01 {+-} 0.01, and S({rho}{sup 0}(770)K{sub S}{sup 0}) = 0.67 {+-} 0.20 {+-} 0.06 {+-} 0.04, respectively. In decays to K*{sup +}(892){pi}{sup -} the direct CP asymmetry is found to be A{sub CP}(K*{sup {+-}}(892){pi}{sup {-+}}) = -0.18 {+-} 0.10 {+-} 0.04 {+-} 0.00. The relative phases between B{sup 0} {yields} K*{sup +}(892){pi}{sup -} and {bar B}{sup 0} {yields} K*{sup -}(892){pi}{sup +}, relevant for the extraction of the unitarity triangle angle {gamma}, is measured to be {Delta}{phi}(K*(892){pi}) = (34.9 {+-} 23.1 {+-} 7.5 {+-} 4.7){sup o}, where uncertainties are statistical, systematic and model-dependent, respectively. Fit fractions, direct CP asymmetries and the relative phases of different other resonant modes have also been measured. A new method for extracting longitudinal shower development information from longitudinally unsegmented calorimeters is also presented. This method has been implemented as a part of the BABAR final particle identification algorithm. A significant improvement in low momenta muon identification at BABAR is obtained.

  15. Magnetoresistivity of copper irradiated at 4.4 K by spallation neutrons

    International Nuclear Information System (INIS)

    Klabunde, C.E.; Coltman, R.R. Jr.

    1984-01-01

    An experiment assembly containing eight differently prepared copper stabilizer specimens was irradiated in the ANL/IPNS-I Radiation Effects Facility. Magnetoresistivity measurements were made on each sample at zero and nine transverse magnetic field strength values up to 6.5 Tesla at each step over three irradiation (4.4 K) and annealing (300 K) cycles. The total neutron fluence was 4.8 x 10 21 n/m 2 (E > 0.1 MeV). The results show a strong dependence upon sample purity and state of cold-work. The data from this experiment will be added to a growing body of data to be used in the design of composite superconductors for fusion magnets

  16. Study of the decays Λc+→Ξ0K+, Λc+→Σ+K+K-, and Λc+→Ξ-K+π+

    International Nuclear Information System (INIS)

    Avery, P.; Freyberger, A.; Rodriguez, J.; Stephens, R.; Yelton, J.; Cinabro, D.; Henderson, S.; Kinoshita, K.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Ong, B.; Selen, M.; Sadoff, A.J.; Ammar, R.; Ball, S.; Baringer, P.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Nelson, J.K.; Patton, S.; Perticone, D.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Nemati, B.; O'Neill, J.J.; Romero, V.; Severini, H.; Sun, C.R.; Zoeller, M.M.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Malchow, R.; Morrow, F.; Skovpen, Y.; Sung, M.; White, C.; Whitmore, J.; Wilson, P.; Butler, F.; Fu, X.; Kalbfleisch, G.; Lambrecht, M.; Ross, W.R.; Skubic, P.; Snow, J.; Wang, P.L.; Wood, M.; Bortoletto, D.; Brown, D.N.; Fast, J.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Schaffner, S.F.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Kroha, H.; Roberts, S.; Sparks, K.; Thorndike, E.H.; Wang, C.H.; Dominick, J.; Sanghera, S.; Skwarnicki, T.; Stroynowski, R.; Artuso, M.; He, D.; Goldberg, M.; Horwitz, N.; Kennett, R.; Moneti, G.C.; Muheim, F.; Mukhin, Y.; Playfer, S.; Rozen, Y.; Stone, S.; Thulasidas, M.; Vasseur, G.; Zhu, G.; Bartelt, J.; Csorna, S.E.; Egyed, Z.; Jain, V.; Sheldon, P.; Akerib, D.S.; Barish, B.; Chadha, M.; Chan, S.; Cowen, D.F.; Eigen, G.; Miller, J.S.; Urheim, J.; Weinstein, A.J.; Acosta, D.; Athanas, M.; Masek, G.; Paar, H.; Sivertz, M.; Bean, A.; Gronberg, J.; Kutschke, R.; Menary, S.; Morrison, R.J.; Nakanishi, S.; Nelson, H.N.; Nelson, T.K.; Richman, J.D.; Ryd, A.; Tajima, H.; Schmidt, D.; Sperka, D.; Witherell, M.S.; Procario, M.; Yang, S.; Balest, R.; Cho, K.; Daoudi, M.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Besson, D.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Drell, P.S.

    1993-01-01

    We report the measurement of new modes of the charmed baryon Λ c + using data recorded by the CLEO II detector at the Cornell Electron Storage Ring. We find branching ratios, relative to Λ c + →pK - π + , of 0.070±0.011±0.011 for Λ c + →Σ + K+K-, 0.069±0.023±0.016 for Λ c + →Σφ, 0.078±0.013±0.013 for Λ c + →Ξ 0 K+, and 0.053±0.016±0.010 for Λ c + →Ξ *0 K+. These measurements indicate that W-exchange diagrams contribute to Λ c + decay. We have also made a new measurement of the previously found mode Λ c + →Ξ - K+π +

  17. K-AP: Generating specified K clusters by efficient Affinity Propagation

    KAUST Repository

    Zhang, Xiangliang; Wang, Wei; Nø rvå g, Kjetil; Sebag, Michè le

    2010-01-01

    and experimental validation, K-AP was shown to be able to directly generate K clusters as user defined, with a negligible increase of computational cost compared to AP. In the meanwhile, K-AP preserves the clustering quality as AP in terms of the distortion. K

  18. Measurement of the time-dependent $CP$ asymmetry in $B^0 \\to J/\\psi K^0_{\\rm S}$ decays

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2013-01-01

    This Letter reports a measurement of the $CP$ violation observables $S_{J/\\psi K^0_{\\rm S}}$ and $C_{J/\\psi K^0_{\\rm S}}$ in the decay channel $B^0 \\rightarrow J/\\psi K^0_{\\rm S}$ performed with 1.0 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s}=7$ TeV collected by the LHCb experiment. The fit to the data yields $S_{J/\\psi K^0_{\\rm S}}= 0.73 \\pm 0.07 {\\rm (stat)} \\pm 0.04 {\\rm (syst)}$ and $C_{J/\\psi K^0_{\\rm S}}= 0.03 \\pm 0.09 {\\rm (stat)} \\pm 0.01 {\\rm (syst)}$. Both values are consistent with the current world averages and within expectations from the Standard Model.

  19. HLA-A*01:03, HLA-A*24:02, HLA-B*08:01, HLA-B*27:05, HLA-B*35:01, HLA-B*44:02, and HLA-C*07:01 Monochain Transgenic/H-2 Class I Null Mice

    DEFF Research Database (Denmark)

    Boucherma, Rachid; Kridane-Miledi, Hédia; Bouziat, Romain

    2013-01-01

    We have generated a panel of transgenic mice expressing HLA-A*01:03, -A*24:02, -B*08:01, -B*27:05, -B*35:01, -B*44:02, or -C*07:01 as chimeric monochain molecules (i.e., appropriate HLA α1α2 H chain domains fused with a mouse α3 domain and covalently linked to human β2-microglobulin). Whereas...... a quantitative and qualitative restoration of the peripheral CD8(+) T cell repertoire, which exhibited a TCR diversity comparable with C57BL/6 WT mice. Potent epitope-specific, HLA-restricted, IFN-γ-producing CD8(+) T cell responses were generated against known reference T cell epitopes after either peptide...

  20. Excess molar volumes and partial molar volumes for (propionitrile + an alkanol) at T = 298.15 K and p = 0.1 MPa

    International Nuclear Information System (INIS)

    Deenadayalu, N.; Bhujrajh, P.

    2006-01-01

    The excess molar volumes and the partial molar volumes for (propionitrile + an alkanol) at T = 298.15 K and at atmospheric pressure are reported. The hydrogen bonding between the OH133;NC groups are discussed in terms of the chain length of the alkanol. The alkanols studied are (methanol, ethanol, 1-propanol, 2-propanol, 1-butanol, and 1-pentanol). The excess molar volume data was fitted to the Redlich-Kister equation The partial molar volumes were calculated from the Redlich-Kister coefficients

  1. Measurement of CP Asymmetry in B0 --> K+K-K0S Decays

    International Nuclear Information System (INIS)

    Dujmic, D

    2004-01-01

    The authors present preliminary measurements of the CP asymmetry parameters and CP content in B 0 --> K + K - K s 0 decays, with φK s 0 events excluded. In a sample of 227 M B(bar B) pairs collected by the BABAR detector at the PEP-II B Factory at SLAC, they find the CP parameters to be S = -0.42 ± 0.17 ± 0.04 and C = 0.10 ± 0.14 ± 0.06, where the first error is statistical and the second systematic. Extracting the fraction of CP-even final states from angular moments f even = 0.89 ± 0.08 ± 0.06, and setting C = 0, they determine sin 2β = 0.55 ± 0.22 ± 0.04 ± 0.11, where the last error is due to uncertainty on the CP content

  2. 75 FR 6397 - AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

    Science.gov (United States)

    2010-02-09

    ... Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine Logistics USA Inc. a/k/a GWL USA, Inc., and Global... Wine Logistics USA Inc. a/k/a GWL USA, Inc. (``GWL USA''); Anita McNeil; International First Service... FEDERAL MARITIME COMMISSION [Docket No. 10-01] AMC USA, Inc. v. International First Service S.A. a...

  3. Preliminary results for the k0-INAA methodology implementation at the Neutron Activation Analysis Laboratory, LAN-IPEN, using k0-IAEA software

    International Nuclear Information System (INIS)

    Mariano, Davi B.; Figueiredo, Ana Maria G.; Semmler, Renato

    2009-01-01

    The present paper presents the preliminary results obtained in the implementation of the k 0 standardization method at the Neutron Activation Laboratory (LAN) at IPEN, Sao Paulo, Brazil, using the program k 0 -IAEA, provided by The International Atomic Energy Agency (IAEA). This method is an important alternative for the comparative neutron activation analysis, which has been used for several years at LAN-IPEN. This quasiabsolute standardization method presents a great advantage with relation to the comparative method, since it does not require the preparation of accurate individual standards for each analysed element, which is very laborious and time-consuming. The k 0 method allows the determination of almost all elements whose gammaray peaks are present in the gamma spectrum. The analysis of gamma-ray spectra and the calculation of concentration are performed by the k 0 software, thus the analysis time is shortened: the time spent to calculate, for instance, the concentration of 25 elements in 10 samples takes about 5 minutes.The efficiency curve of one of the gamma-ray spectrometers used at LAN was determined by measuring calibrated radioactive sources at the usually utilised counting geometries. The parameters α and f were determined by irradiating a Certified Nuclear Reference Material IRMM-530R Al-0,1% Au alloys and high purity zirconium comparators at the IEA-R1 nuclear reactor of IPEN. In order to evaluate the efficiency of the methodology, the geological reference material basalt JB-1 (GSJ) was analysed. The preliminary results obtained showed promising results in spite of some discrepancies of the data in comparison to certified values. These preliminary results indicate that some improvements in the parameters required for the use of the k 0 -IAEA software should be made so that the k 0 - NAA software can be completely successful. (author)

  4. Activation of K{sup +} channels and Na{sup +}/K{sup +} ATPase prevents aortic endothelial dysfunction in 7-day lead-treated rats

    Energy Technology Data Exchange (ETDEWEB)

    Fiorim, Jonaina, E-mail: nanafiorim@hotmail.com [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Ribeiro Júnior, Rogério Faustino, E-mail: faustino43@oi.com.br [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Azevedo, Bruna Fernades, E-mail: brunafernandes.azevedo@gmail.com [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Simões, Maylla Ronacher, E-mail: yllars@hotmail.com [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Padilha, Alessandra Simão, E-mail: ale_spadilha@yahoo.com.br [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Stefanon, Ivanita, E-mail: ivanita@pq.cnpq.br [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil); Alonso, Maria Jesus, E-mail: mariajesus.alonso@urjc.es [Departamento de Ciencias de la Salud III, Universidad Rey Juan Carlos, Alcorcón (Spain); Salaices, Mercedes, E-mail: mercedes.salaices@uam.es [Departamento de Farmacología, Universidad Autónoma de Madrid, Instituto de Investigación Hospital Universitario La Paz (IdiPaz) (Spain); Vassallo, Dalton Valentim, E-mail: daltonv2@terra.com.br [Department of Physiological Sciences, Federal University of Espirito Santo, Vitoria, ES (Brazil)

    2012-07-01

    Seven day exposure to a low concentration of lead acetate increases nitric oxide bioavailability suggesting a putative role of K{sup +} channels affecting vascular reactivity. This could be an adaptive mechanism at the initial stages of toxicity from lead exposure due to oxidative stress. We evaluated whether lead alters the participation of K{sup +} channels and Na{sup +}/K{sup +}-ATPase (NKA) on vascular function. Wistar rats were treated with lead (1st dose 4 μg/100 g, subsequent doses 0.05 μg/100 g, im, 7 days) or vehicle. Lead treatment reduced the contractile response of aortic rings to phenylephrine (PHE) without changing the vasodilator response to acetylcholine (ACh) or sodium nitroprusside (SNP). Furthermore, this treatment increased basal O{sub 2}{sup −} production, and apocynin (0.3 μM), superoxide dismutase (150 U/mL) and catalase (1000 U/mL) reduced the response to PHE only in the treated group. Lead also increased aortic functional NKA activity evaluated by K{sup +}-induced relaxation curves. Ouabain (100 μM) plus L-NAME (100 μM), aminoguanidine (50 μM) or tetraethylammonium (TEA, 2 mM) reduced the K{sup +}-induced relaxation only in lead-treated rats. When aortic rings were precontracted with KCl (60 mM/L) or preincubated with TEA (2 mM), 4-aminopyridine (4-AP, 5 mM), iberiotoxin (IbTX, 30 nM), apamin (0.5 μM) or charybdotoxin (0.1 μM), the ACh-induced relaxation was more reduced in the lead-treated rats. Additionally, 4-AP and IbTX reduced the relaxation elicited by SNP more in the lead-treated rats. Results suggest that lead treatment promoted NKA and K{sup +} channels activation and these effects might contribute to the preservation of aortic endothelial function against oxidative stress. -- Highlights: ► Increased free radicals production ► Increased Na{sup +}/K{sup +} ATPase activity ► Promotes activation of the K{sup +} channels and reduced vascular reactivity ► These effects preserve endothelial function against oxidative

  5. Automatic magnetic susceptibility measurements between 4 K and 1200 K; Mesure automatique des susceptibilites magnetiques de 4 K a 1200 K

    Energy Technology Data Exchange (ETDEWEB)

    Raphael, G [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1969-07-01

    We give a detailed description of a Faraday magnetic susceptibility balance which operates from 4 K to 1200 K. Some preliminary results on platinum and tantalum illustrate the precision and the sensitivity of the measurements. The apparatus has been designed for measurements on the plutonium compounds which present severe health hazards. (author) [French] Nous decrivons en detail un appareil permettant la mesure des susceptibilites magnetiques de 4 K a 1200 K par la methode de FARADAY. Quelques resultats preliminaires sur le platine et le titane montrent la precision et la sensibilite des mesures, L'appareil a ete adapte aux mesures sur les composes particulierement dangereux du plutonium. (auteur)

  6. Y K Vijay

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Y K Vijay. Articles written in Bulletin of Materials Science. Volume 27 Issue 5 October 2004 pp 417-420 Nuclear Related Materials. Irradiation of large area Mylar membrane and characterization of nuclear track filter · N K Acharya P K Yadav S Wate Y K Vijay F Singh D K Avasthi.

  7. Measurement of $CP$ asymmetry in $D^0\\rightarrow K^-K^+$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-04-10

    A measurement of the time-integrated $CP$ asymmetry in the Cabibbo-suppressed decay $D^0\\rightarrow K^-K^+$ is performed using pp collision data, corresponding to an integrated luminosity of 3fb$^-1$, collected with the LHCb detector at centre-of-mass energies of 7 and 8 TeV. The flavour of the charm meson at production is determined from the charge of the pion in $D^{*+}\\rightarrow D^0 \\pi^+$ and $D^{*-}\\rightarrow \\bar{D^0} \\pi^-$ decays. The time-integrated $CP$ asymmetry $A_{CP}(K^-K^+)$ is obtained assuming negligible $CP$ violation in charm mixing and in Cabibbo-favoured $D^0\\rightarrow K^-\\pi^+$, $D^+\\rightarrow K^-\\pi^+\\pi^+$ and $D^+\\rightarrow \\bar{K^0}\\pi^+$ decays used as calibration channels. It is found to be $A_{CP}(K^-K^+)=(0.14\\pm0.15(stat)\\pm0.10(syst))\\%$. A combination of this result with previous LHCb measurements yields $A_{CP}(K^-K^+)=(0.04\\pm0.12(stat)\\pm0.10(syst))\\%$, $A_{CP}(\\pi^-\\pi^+)=(0.07\\pm0.14(stat)\\pm0.11(syst))\\%$. These are the most precise measurements from a single experi...

  8. THE DOUBLE-DEGENERATE NUCLEUS OF THE PLANETARY NEBULA TS 01: A CLOSE BINARY EVOLUTION SHOWCASE

    International Nuclear Information System (INIS)

    Tovmassian, Gagik; Richer, Michael G.; Yungelson, Lev; Rauch, Thomas; Suleimanov, Valery; Napiwotzki, Ralf; Stasinska, Grazyna; Tomsick, John; Wilms, Joern; Morisset, Christophe; Pena, Miriam

    2010-01-01

    We present a detailed investigation of SBS 1150+599A, a close binary star hosted by the planetary nebula PN G135.9+55.9 (TS 01). The nebula, located in the Galactic halo, is the most oxygen-poor known to date and is the only one known to harbor a double degenerate core. We present XMM-Newton observations of this object, which allowed the detection of the previously invisible component of the binary core, whose existence was inferred so far only from radial velocity (RV) and photometric variations. The parameters of the binary system were deduced from a wealth of information via three independent routes using the spectral energy distribution (from the infrared to X-rays), the light and RV curves, and a detailed model atmosphere fitting of the stellar absorption features of the optical/UV component. We find that the cool component must have a mass of 0.54 ± 0.2 M sun , an average effective temperature, T eff , of 58,000 ± 3000 K, a mean radius of 0.43 ± 0.3 R sun , a gravity, log g = 5.0 ± 0.3, and that it nearly fills its Roche lobe. Its surface elemental abundances are found to be: 12 + log He/H = 10.95 ± 0.04 dex, 12 + log C/H = 7.20 ± 0.3 dex, 12 + log N/H eff = 160-180 kK, a luminosity of about ∼10 4 L sun and a radius slightly larger than that of a white dwarf. It is probably bloated and heated as a result of intense accretion and nuclear burning on its surface in the past. The total mass of the binary system is very close to the Chandrasekhar limit. This makes TS 01 one of the best Type Ia supernova progenitor candidates. We propose two possible scenarios for the evolution of the system up to its present stage.

  9. Bound states, resonances and poles in the low-energy K-barN

    International Nuclear Information System (INIS)

    Landau, R.H.

    1994-01-01

    The locations in the complex energy plane of the dynamic poles of the T matrix for the (K-bar N,Σπ) system are calculated. Investigated are a quark bag model and several potential models, including one which agrees with the strong interaction shift in kaonic hydrogen as well as scattering data. The parameters of the model are fit to K - p scattering and reaction cross sections, branching ratios, and mass spectra from K - p→ Σπππ, Λπππ. The Σ P1322 (1385) and Λ D03 (1520) resonances are found to be predominately elementary bag states with considerable dressing for the Σ P13 . The Λ S01 (1405) appears as a complicated composite systems arising from two poles. The model with certain parameter sets does predict two sign changes in the real part of the K-bar N scattering amplitude near threshold, but they are not quite at the correct energies to produce agreement with the sign of the strong interaction shift of kaonic hydrogen. (author). 10 refs., 10 figs

  10. Modelled microgravity alters the Na+, K+-ATPase activity in rat heart homogenates

    Science.gov (United States)

    Peana, Alessandra T.; Pippia, Proto; Paci, Silvia; Tognacini, Christina; Assaretti, Anna Rita; Meloni, Antonietta M.; Galleri, Grazia; Bernardini, Federico

    2005-08-01

    This study was aimed at establishing whether modeled microgravity conditions, created in a three-dimensional clinostat (Random Positioning Machine, RPM), influence the membrane-associated Na+, K+- and Mg2+- ATPase activities in heart homogenates from rats (ex- posed to RPM for 48 hours). The experimental data indicate that modeled low g significantly decreased the total ATPase (p<0.01) and Na+, K+ -ATPase activities (p<0.05) with no change of the Mg2+-ATPase activity, compared to the respective rat control groups (ground). This Na+, K+- pump inhibition could cause a digital- like effect in response to several modifications of many physiological processes even if this inhibition might also be causally related to the physiological environment induced by RPM. The exact mechanism by which total A TPase and Na+, K+ -A TPase activities decrease in response to RPM conditions remains to be established. We cannot rule out that a reduced intracellular ATP production, previously demonstrated in other cellular systems submitted to modeled microgravity conditions, could be responsible for the effects reported here.

  11. High-precision 41K/39K measurements by MC-ICP-MS indicate terrestrial variability of δ41K

    Science.gov (United States)

    Morgan, Leah; Santiago Ramos, Danielle P.; Davidheiser-Kroll, Brett; Faithfull, John; Lloyd, Nicholas S.; Ellam, Rob M.; Higgins, John A.

    2018-01-01

    Potassium is a major component in continental crust, the fourth-most abundant cation in seawater, and a key element in biological processes. Until recently, difficulties with existing analytical techniques hindered our ability to identify natural isotopic variability of potassium isotopes in terrestrial materials. However, measurement precision has greatly improved and a range of K isotopic compositions has now been demonstrated in natural samples. In this study, we present a new technique for high-precision measurement of K isotopic ratios using high-resolution, cold plasma multi-collector mass spectrometry. We apply this technique to demonstrate natural variability in the ratio of 41K to 39K in a diverse group of geological and biological samples, including silicate and evaporite minerals, seawater, and plant and animal tissues. The total range in 41K/39K ratios is ca. 2.6‰, with a long-term external reproducibility of 0.17‰ (2, N=108). Seawater and seawater-derived evaporite minerals are systematically enriched in 41K compared to silicate minerals by ca. 0.6‰, a result consistent with recent findings1, 2. Although our average bulk-silicate Earth value (-0.54‰) is indistinguishable from previously published values, we find systematic δ41K variability in some high-temperature sample suites, particularly those with evidence for the presence of fluids. The δ41K values of biological samples span a range of ca. 1.2‰ between terrestrial mammals, plants, and marine organisms. Implications of terrestrial K isotope variability for the atomic weight of K and K-based geochronology are discussed. Our results indicate that high-precision measurements of stable K isotopes, made using commercially available mass spectrometers, can provide unique insights into the chemistry of potassium in geological and biological systems. 

  12. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Peleties, F. [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain); Trusler, J.P.M., E-mail: m.trusler@imperial.ac.u [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Vega-Maza, D. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain)

    2010-05-15

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  13. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    International Nuclear Information System (INIS)

    Peleties, F.; Segovia, J.J.; Trusler, J.P.M.; Vega-Maza, D.

    2010-01-01

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  14. Lovkommentar i Karnovs Lovsamling af Lovbekendtgørelse 2014-11-21 nr. 1224 International købelov (CISG: Convention on Contracts for the International Sale of Goods)

    DEFF Research Database (Denmark)

    Lookofsky, Joseph

    2018-01-01

    CISG er en international konvention, som indeholder regler om købsaftaler i international handel. CISG regulerer blandt andet, hvornår en international købsaftale er indgået, købers og sælgers rettigheder, forpligtelser samt misligholdelsesbeføjelser mm. CISG finder anvendelse, dels når såvel...... sælgers som købers hjemland har tiltrådt konventionen, dels når international privatrets regler fører til anvendelsen af en kontraherende stats ret. CISG trådte i kraft 1988-01-01. Den danske ratifikation skete 1989-02-04. CISG er ratificeret af godt 85 andre lande (2017). Som et led i den danske...

  15. Liquid phase PVTx properties of (water + tert-butanol) binary mixtures at temperatures from 278.15 to 323.15 K and pressures from 0.1 to 100 MPa. II. Molar isothermal compressions, molar isobaric expansions, molar thermal pressure coefficients, and internal pressure

    International Nuclear Information System (INIS)

    Egorov, Gennadiy I.; Makarov, Dmitriy M.; Kolker, Arkadiy M.

    2013-01-01

    Highlights: ► Molar isothermal compressions and molar isobaric expansions were evaluated. ► Coefficients of thermal pressure and internal pressure were obtained. ► Concentration dependences of coefficients under study display extremes. ► Temperature and pressure dependences of internal pressure of the mixture were linear. -- Abstract: Molar isothermal compressions, molar isobaric expansions, molar coefficients of thermal pressure, and internal pressure were calculated over the whole concentration range of {water (1) + tert-butanol (2)} mixture at pressures from 0.1 to 100 MPa and temperatures from 278.15 to 323.15 K. It was revealed that the extremes, observed on concentration dependences of molar isothermal compression K T,m and molar isobaric expansion E P,m of the mixture, became more pronounced with pressure growth and temperature lowering. Values of molar thermal pressure coefficients of the mixture sharply rose at compositions with small TBA mole fraction and then decreased practically linearly with the alcohol content increasing. Temperature and pressure dependences of the mixture internal pressure were almost linear, and at low TBA concentrations changed significantly from the dependences of water, tert-butanol and their mixtures at large alcohol content

  16. 46 CFR 1.01-30 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Judicial review. 1.01-30 Section 1.01-30 Shipping COAST... Judicial review. (a) Nothing in this chapter shall be construed to prohibit any party from seeking judicial review of any Commandant's decision or action taken pursuant to the regulations in this part or part 5 of...

  17. 40 CFR 86.1805-01 - Useful life.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 19 2010-07-01 2010-07-01 false Useful life. 86.1805-01 Section 86... Complete Otto-Cycle Heavy-Duty Vehicles § 86.1805-01 Useful life. (a) For light-duty vehicles and light-duty trucks, intermediate useful life is a period of use of 5 years or 50,000 miles, whichever occurs...

  18. Isopiestic determination of the osmotic and activity coefficients of the {yKCl + (1 - y)K2HPO4}(aq) system at T = 298.15 K

    International Nuclear Information System (INIS)

    Popovic, Daniela Z.; Miladinovic, Jelena; Todorovic, Milica D.; Zrilic, Milorad M.; Rard, Joseph A.

    2011-01-01

    Highlights: → Isopiestic measurements were made for {yKCl + (1 - y)K 2 HPO 4 }(aq) at T = 298.15 K. → The resulting osmotic coefficients were represented by three thermodynamic models. → Activity coefficients from Pitzer model with Scatchard mixing terms are recommended. - Abstract: The osmotic coefficients of aqueous mixtures of KCl and K 2 HPO 4 have been measured at T = (298.15 ± 0.01) K by the isopiestic vapor pressure method over the range of ionic strengths from (2.3700 to 11.250) mol . kg -1 using CaCl 2 (aq) as the reference solution. Our new experimental results were modeled with an extended form of Pitzer's ion-interaction model equations, both with the usual mixing terms and with Scatchard's neutral-electrolyte mixing terms, and with the Clegg-Pitzer-Brimblecombe equations based on the mole-fraction-composition scale. There is a dearth of previously published isopiestic data for mixtures containing salts of HPO 4 2- (aq) and, consequently, no previous measurements are available for comparison with the present results. The present study yields Cl - HPO 4 2- mixing parameters for these three models that are needed for modeling the thermodynamic activities of solute components of natural waters and other complex aqueous electrolyte mixtures.

  19. Involvement of PI3K/Akt Signaling Pathway and Its Downstream Intracellular Targets in the Antidepressant-Like Effect of Creatine.

    Science.gov (United States)

    Cunha, Mauricio P; Budni, Josiane; Ludka, Fabiana K; Pazini, Francis L; Rosa, Julia Macedo; Oliveira, Ágatha; Lopes, Mark W; Tasca, Carla I; Leal, Rodrigo B; Rodrigues, Ana Lúcia S

    2016-07-01

    Creatine has been proposed to exert beneficial effects in the management of depression, but the cell signaling pathways implicated in its antidepressant effects are not well established. This study investigated the involvement of PI3K/Akt signaling pathway and its downstream intracellular targets in the antidepressant-like effect of creatine. The acute treatment of mice with creatine (1 mg/kg, po) increased the Akt and P70S6K phosphorylation, and HO-1, GPx and PSD95 immunocontents. The pretreatment of mice with LY294002 (10 nmol/mouse, icv, PI3K inhibitor), wortmannin (0.1 μg/mouse, icv, PI3K inhibitor), ZnPP (10 μg/mouse, icv, HO-1 inhibitor), or rapamycin (0.2 nmol/mouse, icv, mTOR inhibitor) prevented the antidepressant-like effect of creatine (1 mg/kg, po) in the TST. In addition, the administration of subeffective dose of either the selective GSK3 inhibitor AR-A014418 (0.01 μg/mouse, icv), the nonselective GSK3 inhibitor lithium chloride (10 mg/kg, po), or the HO-1 inductor CoPP (0.01 μg/mouse, icv), in combination with a subeffective dose of creatine (0.01 mg/kg, po) reduced the immobility time in the TST as compared with either drug alone. No treatment caused significant changes in the locomotor activity of mice. These results indicate that the antidepressant-like effect of creatine in the TST depends on the activation of Akt, Nrf2/HO-1, GPx, and mTOR, and GSK3 inhibition.

  20. First observation of $\\pi^{-}K^+$ and $\\pi^{+}K^-$ atoms, their lifetime measurement and $\\pi K$ scattering lengths evaluation

    CERN Document Server

    Afanasyev, Leonid

    2016-01-01

    The Low Energy QCD allows to calculate the ππ and π K scattering lengths with high precision. There are accurate relations between these scattering lengths and π + π − , π − K + , π + K − atoms lifetimes. The experiment on the first observation of π − K + and π + K − atoms is described. The atoms were generated in Nickel and Platinum targets hit by the PS CERN proton beam with momentum of 24 GeV/ c . Moving in the target, part of atoms break up producing characteristic π K pairs (atomic pairs) with small relative momentum Q in their c.m.s. In the experiment, we detected n A = 349 ± 62 (5.6 standard deviations) π − K + and π + K − atomic pairs. The main part of π K pairs are produced in free state. The majority of such particles are generated directly or from short-lived sources as ρ , ω and similar resonances. The electromagnetic interactions in the final state create Coulomb pairs with a known sharp dependence on Q . This effect allows to evaluate the number of these Coulomb pai...

  1. Measurement of the decays B --> phi K and B --> K*

    International Nuclear Information System (INIS)

    Aubert, B.

    2001-01-01

    We have observed the decays B → phi K and phi K* in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are BF(B + → phi K + ) = (7.7 -1.4 +1.6 +/- 0.8) x 10 -6 , BF(B 0 → phi K 0 ) =(8.1 -2.5 +3.1 +/- 0.8) x 10 -6 , BF(B + → phi K* + ) = (9.7 -3.4 +4.2 +/- 1.7) x 10 -6 , and BF(B 0 → phi K* 0 ) = (8.6 -2.4 +2.8 +/- 1.1) x 10 -6 . We also report the upper limit BF(B + → phi pi + ) -6 (90 percent CL)

  2. K$_{-}$ and K$_{-}$ polarizability from kaonic atoms

    CERN Document Server

    Backenstoss, Gerhard; Bergström, I; Bunaciu, T; Egger, J; Hagelberg, R; Hultberg, S; Koch, H; Lynen, Y; Ritter, H G; Schwitter, A; Tauscher, L

    1973-01-01

    The K/sup -/ mass was determined from kaonic atomic X-rays from Au and Ba to be 493.691+or-0.040 MeV. An upper limit for the polarizability of the K/sup -/ was found to be 0.020 fm/sup 3/ at 90% confidence. (18 refs).

  3. Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier

    NARCIS (Netherlands)

    ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.

    1984-01-01

    Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and

  4. Image quality at low tube voltage (70 kV) and sinogram-affirmed iterative reconstruction for computed tomography in infants with congenital heart disease

    International Nuclear Information System (INIS)

    Nakagawa, Motoo; Ozawa, Yoshiyuki; Sakurai, Keita; Shimohira, Masashi; Shibamoto, Yuta; Ohashi, Kazuya; Asano, Miki; Yamaguchi, Sachiko

    2015-01-01

    Lower tube voltage has advantages for CT angiography, such as improved contrast To evaluate the image quality of low-voltage (70 kV) CT for congenital heart disease and the ability of sinogram-affirmed iterative reconstruction to improve image quality. Forty-six children with congenital heart disease (median age: 109 days) were examined using dual-source CT. Scans were performed at 80 kV and 70 kV in 21 and 25 children, respectively. A nonionic iodinated contrast medium (300 mg I/ml) was used for the 80-kV protocol. The contrast medium was diluted to 75% (225 mgI/mL) with saline for the 70-kV protocol. Image noise was measured in the two protocols for each group by extracting the standard deviations of a region of interest placed on the descending aorta. We then determined whether sinogram-affirmed iterative reconstruction reduced the image noise at 70 kV. There was more noise at 70 kV than at 80 kV (29 ± 12 vs 20 ± 4.8; P < 0.01). Sinogram-affirmed iterative reconstruction with grade 4 strength settings improved the noise (20 ± 5.9; P < 0.01) for the 70-kV group. Sinogram-affirmed iterative reconstruction improved the image quality of CT in congenital heart disease. (orig.)

  5. Image quality at low tube voltage (70 kV) and sinogram-affirmed iterative reconstruction for computed tomography in infants with congenital heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Motoo; Ozawa, Yoshiyuki; Sakurai, Keita; Shimohira, Masashi; Shibamoto, Yuta [Nagoya City University Graduate School of Medical Sciences, Department of Radiology, Nagoya (Japan); Ohashi, Kazuya [Nagoya City University Hospital, Division of Central Radiology, Nagoya (Japan); Asano, Miki [Nagoya City University Graduate School of Medical Sciences, Department of Cardiovascular Surgery, Nagoya (Japan); Yamaguchi, Sachiko [Nagoya City University Graduate School of Medical Sciences, Department of Pediatrics and Neonatology, Nagoya (Japan)

    2015-09-15

    Lower tube voltage has advantages for CT angiography, such as improved contrast To evaluate the image quality of low-voltage (70 kV) CT for congenital heart disease and the ability of sinogram-affirmed iterative reconstruction to improve image quality. Forty-six children with congenital heart disease (median age: 109 days) were examined using dual-source CT. Scans were performed at 80 kV and 70 kV in 21 and 25 children, respectively. A nonionic iodinated contrast medium (300 mg I/ml) was used for the 80-kV protocol. The contrast medium was diluted to 75% (225 mgI/mL) with saline for the 70-kV protocol. Image noise was measured in the two protocols for each group by extracting the standard deviations of a region of interest placed on the descending aorta. We then determined whether sinogram-affirmed iterative reconstruction reduced the image noise at 70 kV. There was more noise at 70 kV than at 80 kV (29 ± 12 vs 20 ± 4.8; P < 0.01). Sinogram-affirmed iterative reconstruction with grade 4 strength settings improved the noise (20 ± 5.9; P < 0.01) for the 70-kV group. Sinogram-affirmed iterative reconstruction improved the image quality of CT in congenital heart disease. (orig.)

  6. PdTe: a 4.5 K type-II BCS superconductor

    International Nuclear Information System (INIS)

    Tiwari, Brajesh; Goyal, Reena; Jha, Rajveer; Awana, V P S; Dixit, Ambesh

    2015-01-01

    We report on the structure and physical properties of the polycrystalline PdTe superconductor, which is synthesized by the solid state reaction route via the quartz vacuum encapsulation technique at 750 °C. The as synthesized compound is crystallized in hexagonal crystal structure with P63/mmc space group. Both transport and magnetic measurements showed that PdTe is a bulk superconductor below 4.5 K. Isothermal magnetization (MH) and magneto-transport (R(T)H) measurements provided the values of the lower (H c1 ) and upper (H c2 ) critical fields as 250 Oe and 1200 Oe respectively at 2 K, establishing that the compound is clearly a type-II superconductor. The coherence length (ξ 0 ) and Ginzburg–Landau parameter (κ) are estimated from the experimentally determined upper and lower critical fields, and are 449 Å and 1.48 respectively. Thermodynamic heat capacity measurements under different magnetic fields, i.e. C p (T)H, showed a clear transition at 4.5 K (T c ), which shifts gradually to lower temperatures with application of field. The values of Debye temperature (Θ D ) and electronic specific heat coefficient (γ) obtained from C p (T) data are found to be 203 K and 6.01 mJ mol −1 K −2 . The observed specific heat jump (ΔC/γT c ) is 1.33, thus suggesting a possible weak coupling case for the PdTe superconductor. (paper)

  7. Observation of $B^0_s \\to K^{*\\pm}K^\\mp$ and evidence for $B^0_s \\to K^{*-}\\pi^+$ decays

    CERN Document Server

    Aaij, Roel; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    Measurements of the branching fractions of $B^0_{(s)} \\to K^{*\\pm}K^\\mp$ and $B^0_{(s)} \\to K^{*\\pm}\\pi^\\mp$ decays are performed using a data sample corresponding to $1.0 \\ {\\rm fb}^{-1}$ of proton-proton collision data collected with the LHCb detector at a centre-of-mass energy of $7\\mathrm{\\,TeV}$, where the $K^{*\\pm}$ mesons are reconstructed in the $K^0_{\\rm S}\\pi^\\pm$ final state. The first observation of the $B^0_s \\to K^{*\\pm}K^\\mp$ decay and the first evidence for the $B^0_s \\to K^{*-}\\pi^+$ decay are reported with branching fractions \\begin{eqnarray} {\\cal B}\\left(B^0_s \\to K^{*\\pm}K^\\mp\\right) & = & \\left( 12.7\\pm1.9\\pm1.9 \\right) \\times 10^{-6} \\, , \\\\ {\\cal B}\\left(B^0_s \\to K^{*-}\\pi^+\\right) & = & ~\\left( 3.3\\pm1.1\\pm0.5 \\right) \\times 10^{-6} \\, , \\end{eqnarray} where the first uncertainties are statistical and the second are systematic. In addition, an upper limit of ${\\cal B}\\left(B^0 \\to K^{*\\pm}K^\\mp\\right) < 0.4 \\ (0.5) \\times 10^{-6}$ is set at $90\\,\\% \\ (95\\,\\%)$ conf...

  8. Explaining the R_K and R_{K^*} anomalies

    Science.gov (United States)

    Ghosh, Diptimoy

    2017-10-01

    Recent LHCb results on R_{K^*}, the ratio of the branching fractions of B → K^* μ ^+ μ ^- to that of B → K^* e^+ e^-, for the dilepton invariant mass bins q^2 ≡ m_{ℓ ℓ }^2 = [0.045-1.1] GeV^2 and [1.1-6] GeV^2 show approximately 2.5 σ deviations from the corresponding Standard Model prediction in each of the bins. This, when combined with the measurement of R_K (q^2=[1-6] GeV^2), a similar ratio for the decay to a pseudo-scalar meson, highly suggests lepton non-universal new physics in semi-leptonic B meson decays. In this work, we perform a model independent analysis of these potential new physics signals and identify the operators that do the best job in satisfying all these measurements. We show that heavy new physics, giving rise to q^2 independent local 4-Fermi operators of scalar, pseudo-scalar, vector or axial-vector type, is unable to explain all the three measurements simultaneously, in particular R_{K^*} in the bin [0.045-1.1], within their experimental 1σ regions. We point out the possibility to explain R_{K^*} in the low bin by an additional light (≲ 20 {MeV}) vector boson with appropriate coupling strengths to (\\bar{b} s) and (\\bar{e} e).

  9. Absorption of dilute sulfur dioxide in aqueous poly-ethylene glycol 400 solutions at T = 308.15 K and p = 122.60 kPa

    International Nuclear Information System (INIS)

    Zhang Jianbin; Liu Lihua; Huo Tanrui; Liu Zhanying; Zhang Tong; Wei Xionghui

    2011-01-01

    Highlights: → Isothermal (gas + liquid) equilibrium (GLE) data at T = 308.15 K and p = 122.60 kPa. → Solubility of SO 2 in pure PEG 400 presented an extreme maximum of 951 mg . L -1 . → Solubility of SO 2 in w 1 = 0.40 PEGW is an extreme minimum of 190 mg . L -1 . - Abstract: Isothermal (gas + liquid) equilibrium (GLE) data at T = 308.15 K and p = 122.60 kPa are reported for the absorption of dilute SO 2 in various aqueous poly-ethylene glycol 400 (PEG) solutions, in which SO 2 partial pressures are in the range of (0.9 to 92) Pa. Measurements are carried out by a saturation method using a glass absorption apparatus, which was controlled at constant temperatures by a thermostatic circulation bath with a Beckmann thermometer. The GLE data were obtained with uncertainties within 0.02 K for temperature, 0.1 kPa for total pressures, 3% for SO 2 concentration in the gas phase, and 0.6% for SO 2 concentration in the liquid phase. The measurements show that the solubility of dilute SO 2 in the system of {PEG (1) + water (2)} increases with increasing PEG concentration in the mass fraction range of w 1 = (0.40 to 1.00), and the solubility of SO 2 in the system of {PEG (1) + water (2)} presents an extreme minimum at the mass fraction of w 1 = 0.40 of 190 mg . L -1 when SO 2 in the gas phase is designed at Φ SO 2 = 5 . 10 -4 . The peculiarity of this work is used to provide important GLE data for the design and operation of the absorption and desorption process in flue gas desulfurization (FGD) with potential industrial application of the solutions containing PEG.

  10. 46 CFR 44.01-13 - Heavy weather plan.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Heavy weather plan. 44.01-13 Section 44.01-13 Shipping... VOYAGES Administration § 44.01-13 Heavy weather plan. (a) Each heavy weather plan under § 44.01-12(b) must... Inspection. Approval of a heavy weather plan is limited to the current hurricane season. (b) The cognizant...

  11. Parallel k-means++

    Energy Technology Data Exchange (ETDEWEB)

    2017-04-04

    A parallelization of the k-means++ seed selection algorithm on three distinct hardware platforms: GPU, multicore CPU, and multithreaded architecture. K-means++ was developed by David Arthur and Sergei Vassilvitskii in 2007 as an extension of the k-means data clustering technique. These algorithms allow people to cluster multidimensional data, by attempting to minimize the mean distance of data points within a cluster. K-means++ improved upon traditional k-means by using a more intelligent approach to selecting the initial seeds for the clustering process. While k-means++ has become a popular alternative to traditional k-means clustering, little work has been done to parallelize this technique. We have developed original C++ code for parallelizing the algorithm on three unique hardware architectures: GPU using NVidia's CUDA/Thrust framework, multicore CPU using OpenMP, and the Cray XMT multithreaded architecture. By parallelizing the process for these platforms, we are able to perform k-means++ clustering much more quickly than it could be done before.

  12. Nuclear topography of beta-like globin gene cluster in IL-3-stimulated human leukemic K-562 cells

    Czech Academy of Sciences Publication Activity Database

    Galiová-Šustáčková, Gabriela; Bártová, Eva; Kozubek, Stanislav

    2004-01-01

    Roč. 33, č. 1 (2004), s. 4-14 ISSN 1079-9796 R&D Projects: GA ČR GA301/01/0186; GA AV ČR KSK5052113; GA AV ČR IAA5004306; GA ČR GA202/04/0907; GA MŠk ME 565 Institutional research plan: CEZ:AV0Z5004920 Keywords : beta-like globin gene cluster * K-562 cells * nuclear topography Subject RIV: BO - Biophysics Impact factor: 2.549, year: 2004

  13. Electromagnetic mass splittings of π, a1, K, K1(1400), and K* (892)

    International Nuclear Information System (INIS)

    Gao, D.; Li, B.A.; Yan, M.

    1997-01-01

    To one-loop order and O(α EM ), the electromagnetic mass splittings of π, a 1 , K, K 1 (1400), and K * (892) are calculated in the framework of U(3) L xU(3) R chiral field theory. The logarithmic divergences emerging in the Feynman integrations of the mesonic loops are factorized by using an intrinsic parameter g of this theory. No other additional parameters or counterterms are introduced to absorb the mesonic loop divergences. When f π , m ρ , and m a are taken as inputs, the parameter g will be determined and all the physical results are finite and fixed. Dashen's theorem is satisfied in the chiral SU(3) limit of this theory and a rather large violation of the theorem is revealed at the order of m s or m K 2 . Mass ratios of light quarks have been determined. A relation for electromagnetic corrections to masses of axial-vector mesons is obtained. It could be regarded as a generalization of Dashen's theorem. Comparing with data, it is found that the nonelectromagnetic mass difference of K * is in agreement with the estimation of Schechter, Subbaraman, and Weigel. copyright 1997 The American Physical Society

  14. Current meter - direction and other data from FIXED PLATFORMS in support of the Brine Disposal project from 1979-10-01 to 1980-01-01 (NODC Accession 8000049)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Current meter - direction and other data were collected from FIXED PLATFORMS from 01 October 1979 to 01 January 1980. Data were collected by the National Data Buoy...

  15. Rapid release of 42K and 86Rb from an occluded state of the Na,K-pump in the presence of ATP or ADP

    International Nuclear Information System (INIS)

    Forbush, B. III

    1987-01-01

    We have measured the time course of release of 42 K and 86 Rb from an occluded state of the Na,K-pump using a rapid filtration apparatus. We have found that at 20 degrees C and in the presence of ATP, 42 K is released with a rate constant of approximately 45 s-1 and 86 Rb with a rate constant of approximately 20 s-1; both ATP and ADP are effective at a low affinity site (Kd approximately 0.3 and 1 mM, respectively) with the rate of deocclusion being only half as great in ADP as in ATP. Mg2+ stimulates 2-fold at low concentrations probably by forming MgATP, and free Mg2+ is strongly inhibitory at high concentrations (Kd approximately 10 mM). Mg2+ also decreases the affinity for ATP, and the data are consistent with mixed type inhibition; from the analysis the dissociation constant is approximately 1 mM for the inhibitory Mg2+ and the Rb+-occluded form without ATP. The rate of 42 K or 86 Rb release increases monotonically with pH while ATPase activity decreases above pH 8, so that deocclusion is not rate-limiting in the overall cycle at high pH. This is reflected by a convergence of the rate of Na,K-ATPase and Na,Rb-ATPase activities at high pH and by a decrease in the observed steady-state level of the occluded 86 Rb intermediate at high pH. K+, Rb+, Na+, and Cs+, but not Li+, increase the rate of 42 K and 86 Rb release at constant ionic strength, presumably at sites other than the transport sites. The spontaneous rate of deocclusion is only approximately 0.1 s-1 at low ionic strength in the absence of nucleotides, and it is increased markedly by all cations tested except Li+. Overall the data are consistent with deocclusion as a rate-limiting step in the Na,K-pump cycle

  16. Relation of bone mineral density with homocysteine and cathepsin K levels in postmenopausal women

    Directory of Open Access Journals (Sweden)

    Madhukar Mittal

    2018-01-01

    Full Text Available Background: Homocysteine (HCY interferes with collagen cross-linking in bones and stimulates osteoclast activity. The activated osteoclasts secrete cathepsin K (CathK, a cysteine protease, in eminent quantity during bone resorption. Hyperhomocysteinemia may effect bone mineral density (BMD through CathK. We, therefore, examined the relation between HCY and BMD along with CathK, 25-hydroxyvit-D (25[OH]D, intact parathyroid hormone (iPTH, and Vitamin B12. Materials and Methods: We recruited a total of 93 postmenopausal women between the age group of 45–60 years, attending the Endocrinology outpatient department at King George's Medical University, Lucknow. BMD was done by DXA scan using Hologic QDR1000 system. Based on the WHO criteria, patients were segregated into three groups as follows; normal bone mass, osteopenia, and osteoporosis. All women underwent routine biochemical laboratory parameters, HCY, Vitamin B12, and CathK levels. Results: Among 93 postmenopausal women, 56% (52 had osteoporosis. Nineteen percent (18 had normal BMD (mean age, 53.22 ± 8.5 years and 23 (25% had osteopenia (mean age 52.86 ± 6.67 years. The mean age in the osteoporetic group was 56.2 ± 6.9 years. The median (interquartile range levels of HCY in the three groups were 14.5 μmol/L (12.2–24.7, 15.05 μmol/L (12.1–19.9 and 13.2 μmol/L (10.3–17.0, respectively. CathK levels were similar in three groups 7.6 ng/ml (7.0–80.5, 8.3 ng/ml (7.3–8.5, and 8.6 ng/ml (7.2–8.9. Both HCY and CathK were found positively associated with serum phosphorus (r = 0.584, P < 2.01 and r = 0.249, P < 0.05, respectively. Levels of HCY positively correlate with PTH (r = 0.303, P < 0.01 and inversely with Vitamin B12 (r = −0.248, P < 0.05. No significant association was seen between CathK level and 25(OH D, iPTH, serum calcium. Conclusion: Low bone mass by DXA is a significant problem in postmenopausal females. HCY and CathK do not reliably correlate with bone loss in

  17. CCQM-K11.2 determination of glucose in human serum and CCQM-K12.2 determination of creatinine in human serum

    Science.gov (United States)

    Wise, Stephen A.; Phinney, Karen W.; Duewer, David L.; Sniegoski, Lorna T.; Welch, Michael J.; Pritchett, Jeanita; Pabello, Guiomar; Avila Calderon, Marco A.; Balderas, Miryan; Qinde, Liu; Kooi, Lee Tong; Rego, Eliane; Garrido, Bruno; Allegri, Gabriella; de La Cruz, Marcia; Barrabin, Juliana; Monteiro, Tânia; Lee, Hwashim; Kim, Byungjoo; Delatour, Vincent; Peignaux, Maryline; Kawaguchi, Migaku; Bei, Xu; Can, Quan; Nammoonnoy, Jintana; Schild, Katrin; Ohlendorf, Rüdiger; Henrion, Andre; Ceyhan Gören, Ahmet; Yılmaz, Hasibe; Bilsel, Mine; Konopelko, L.; Krylov, A.; Lopushanskaya, E.

    2018-01-01

    Glucose and creatinine are two of the most frequently measured substances in human blood/serum for assessing the health status of individuals. Because of their clinical significance, CCQM-K11 glucose in human serum and CCQM-K12 creatinine in human serum were the fourth and fifth key comparisons (KCs) performed by the Organic Analysis Working Group (OAWG). These KCs were conducted in parallel and were completed in 2001. The initial subsequent KCs for glucose, CCQM-K11.1, and creatinine, CCQM-K12.1, were completed in 2005. Measurements for the next KCs for these two measurands, CCQM-K11.2 and CCQM-K12.2, were completed in 2013. While designed as subsequent KCs, systematic discordances between the participants' and the anchor institution's results in both comparisons lead the OAWG to request reference results from two experienced laboratories that had participated in the 2001 comparisons. Based on the totality of the available information, the OAWG converted both CCQM-K11.2 and CCQM-K12.2 to 'Track C' KCs where the key comparison reference value is estimated by consensus. These comparisons highlighted that carrying out comparisons for complex chemical measurements and expecting to be able to treat them under the approaches used for formal CIPM subsequent comparisons is not an appropriate strategy. The approach used here is a compromise to gain the best value from the comparison; it is not an approach that will be used in the future. Instead, the OAWG will focus on Track A and Track C comparisons that are treated as stand-alone entities. Participation in CCQM-K11.2 demonstrates a laboratory's capabilities to measure a polar (pKow > 2), low molecular mass (100 g/mol to 500 g/mol) metabolite in human serum at relatively high concentrations (0.1 mg/g to 10 mg/g). Participation in CCQM-K12.2 demonstrates capabilities to measure similar classes of metabolites at relatively low concentrations (1 μg/g to 30 μg/g). The capabilities required for the analysis of complex

  18. K2-140b - an eccentric 6.57 d transiting hot Jupiter in Virgo

    Science.gov (United States)

    Giles, H. A. C.; Bayliss, D.; Espinoza, N.; Brahm, R.; Blanco-Cuaresma, S.; Shporer, A.; Armstrong, D.; Lovis, C.; Udry, S.; Bouchy, F.; Marmier, M.; Jordán, A.; Bento, J.; Cameron, A. Collier; Sefako, R.; Cochran, W. D.; Rojas, F.; Rabus, M.; Jenkins, J. S.; Jones, M.; Pantoja, B.; Soto, M.; Jensen-Clem, R.; Duev, D. A.; Salama, M.; Riddle, R.; Baranec, C.; Law, N. M.

    2018-04-01

    We present the discovery of K2-140b, a P = 6.57 d Jupiter-mass (MP = 1.019 ± 0.070MJup) planet transiting a V = 12.5 (G5-spectral type) star in an eccentric orbit (e = 0.120^{+0.056}_{-0.046}) detected using a combination of K2 photometry and ground-based observations. With a radius of 1.095 ± 0.018 RJup, the planet has a bulk density of 0.726 ± 0.062 ρJup. The host star has a [Fe/H] of 0.12 ± 0.045, and from the K2 light curve, we find a rotation period for the star of 16.3 ± 0.1 d. This discovery is the 9th hot Jupiter from K2 and highlights K2's ability to detect transiting giant planets at periods slightly longer than traditional, ground-based surveys. This planet is slightly inflated, but much less than others with similar incident fluxes. These are of interest for investigating the inflation mechanism of hot Jupiters.

  19. Measurement of high temperature elastic moduli of an 18Cr-9Ni-2.95 Cu-0.58 Nb-0.1C (Wt %) austenitic stainless steel

    Science.gov (United States)

    Tripathy, Haraprasanna; Hajra, Raj Narayan; Sudha, C.; Raju, S.; Saibaba, Saroja

    2018-04-01

    The Young's modulus (E) and Shear modulus (G) of an indigenously developed 18Cr-9Ni-0.1C-2.95 Cu-0.58Nb (wt %) austenitic stainless steel has been evaluated in the temperature range 298 K to 1273 K (25 °C to 1000 °C), using Impulse excitation technique (IET). The Bulk modulus (K) and the poison's ratio have been estimated from the measured values of E and G. It is observed that the elastic constants (E, G and K) are found to decrease in a nonlinear fashion with increase in temperature. The Cu precipitation is found to influence the elastic moduli of the steel in the cooling cycle. The observed elastic moduli are fitted to 3rd order polynomial equations in order to describe the temperature dependence of E, G, K moduli in the temperature range 298-1273 K (25 °C to 1000 °C). The room temperature values of E,G and K moduli is found to be 207, 82 and 145 GPa respectively for the present steel.

  20. Cryogenic laboratory (80 K - 4 K)

    International Nuclear Information System (INIS)

    Brad, Sebastian; Steflea, Dumitru

    2002-01-01

    The technology of low temperature at the beginning of this century, developed for the production of oxygen, nitrogen and rare gases, was the basis for setting up the cryogenic technology in all the companies with these activity fields. The cryogenics section of today comprises engineering and construction of cryogenic plants for science, research and development, space technology, nuclear power techniques. Linde has designed and built a reliable small scale Helium liquefier. This fully automatic cryoliquefier operates for purification, liquefaction as well as re-liquefaction of Helium-gas, evaporated in cryostat systems. The basic equipment of the Linde L5 are the liquefier apparatus, transfer line, medium pressure buffer vessel, automatic purifier, compressor with mechanical oil separation unit, oil adsorber, electrical control unit. The accessories of the Linde L5 are the liquid helium storage tank, high-pressure gas supply, helium recovery unit, and cryocomponents. The cycle compressor C 101 designed as a single stage screw compressor supplies the liquefaction process with approx. 10 g/s of helium at a pressure of 10 to 12 bar and a temperature of approx. 300 K. In the first plate heat exchanger E 201 the gas is cooled down to approx. 70 K. Then the He high-pressure flow is divided: about 7 g/s reach the turbine X 201 via valve 203 (turbine entry) and are expanded there to approx. 4.6 bar, the gas cooling down to 64 K. After further cooling in the heat exchanger E 203 to about 16 K, another power-consuming expansion to 1.2 bar takes place. The implied cooling of the gas results in a temperature of 12 K at the outlet of the turbine X 202. This gas is then transferred to the low-pressure side of the heat exchanger E 204. The smaller part of the He high-pressure gas flow (approx. 3 g/s) is cooled down in the heat exchanger E 202 - E 205 to about 7 K. One part of the cold helium gas (approx. 0.17 g/s) is used in the purifier to cool down the feed gas to air

  1. Asymptotically Exact Heuristics for Prime Divisors of the Sequence {a/k + b/k} §k

    NARCIS (Netherlands)

    Moree, P.

    2006-01-01

    Let N a,b (x) count the number of primes p = x with p dividing a k + b k for some k = 1. It is known that N a,b (x) ~ c(a,b)x/log x for some rational number c(a,b) that depends in a rather intricate way on a and b. A simple heuristic formula for N a,b (x) is proposed and it is proved that it is

  2. Magnetic fluctuations near a quantum phase transition in CeCu5.9Au0.1

    DEFF Research Database (Denmark)

    Schröder, A.; Aeppli, G.; Bucher, E.

    1998-01-01

    We present inelastic cold neutron scattering measurements on a single crystal of the heavy-fermion compound CeCu5.9Au0.1, where non-Fermi-liquid behavior near a quantum phase transition was found in the specific heat and resistivity. This compound shows strongly correlated magnetic fluctuations......, most intense at wave vectors Q(1), near(1,0,0), close to the magnetic ordering vector found at higher Au-concentration. The energy dependence can be best described by a modified quasielastic Lorentzian with power alpha = 0.7. Down to the lowest temperature of 0.07 K the relaxation rate Gamma remains...

  3. On the almost sure convergence of weighted sums of random elements in D[0,1

    Directory of Open Access Journals (Sweden)

    R. L. Taylor

    1981-01-01

    Full Text Available Let {wn} be a sequence of positive constants and Wn=w1+…+wn where Wn→∞ and wn/Wn→∞. Let {Wn} be a sequence of independent random elements in D[0,1]. The almost sure convergence of Wn−1∑k=1nwkXk is established under certain integral conditions and growth conditions on the weights {wn}. The results are shown to be substantially stronger than the weighted sums convergence results of Taylor and Daffer (1980 and the strong laws of large numbers of Ranga Rao (1963 and Daffer and Taylor (1979.

  4. K+ and K- potentials in hadronic matter can be observed

    International Nuclear Information System (INIS)

    Sood, Aman D.; Hartnack, Ch.; Aichelin, Joerg

    2011-01-01

    One key question in the analysis of subthreshold kaon production is how to obtain information on the properties of strange mesons in dense nuclear matter. The principal problem for extracting precise information on these properties is, however, that almost all observables depend simultaneously not only on the K - potential but also on several other input quantities which are only vaguely known e.g. life time of Δ and in-medium modification of the cross section. The situation were much better if experiment provides an observable which depends on the K potentials only and which is not spoiled by other little or unknown quantities. Here the aim was to show that the ratio of the K + and K - momentum spectra at small momentum in light systems can be such an observable. In order to study this observable and in order to make sure that it does not depend on other input quantities the K - have been separated into 2 classes (by tracing back K - to its corresponding anti strange partner K + )

  5. HLA-DRB1*03:01 and HLA-DRB1*04:01 modify the presentation and outcome in autoimmune hepatitis type-1.

    Science.gov (United States)

    van Gerven, N M F; de Boer, Y S; Zwiers, A; Verwer, B J; Drenth, J P H; van Hoek, B; van Erpecum, K J; Beuers, U; van Buuren, H R; den Ouden, J W; Verdonk, R C; Koek, G H; Brouwer, J T; Guichelaar, M M J; Vrolijk, J M; Coenraad, M J; Kraal, G; Mulder, C J J; van Nieuwkerk, C M J; Bloemena, E; Verspaget, H W; Kumar, V; Zhernakova, A; Wijmenga, C; Franke, L; Bouma, G

    2015-06-01

    The classical human leukocyte antigen (HLA)-DRB1*03:01 and HLA-DRB1*04:01 alleles are established autoimmune hepatitis (AIH) risk alleles. To study the immune-modifying effect of these alleles, we imputed the genotypes from genome-wide association data in 649 Dutch AIH type-1 patients. We therefore compared the international AIH group (IAIHG) diagnostic scores as well as the underlying clinical characteristics between patients positive and negative for these HLA alleles. Seventy-five percent of the AIH patients were HLA-DRB1*03:01/HLA-DRB1*04:01 positive. HLA-DRB1*03:01/HLA-DRB1*04:01-positive patients had a higher median IAIHG score than HLA-DRB1*03:01/HLA-DRB1*04:01-negative patients (P<0.001). We did not observe associations between HLA alleles and alanine transaminase levels (HLA-DRB1*03:01: P=0.2; HLA-DRB1*04:01; P=0.5); however, HLA-DRB1*03:01 was independently associated with higher immunoglobulin G levels (P=0.04). The HLA-DRB1*04:01 allele was independently associated with presentation at older age (P=0.03) and a female predominance (P=0.04). HLA-DRB1*03:01-positive patients received immunosuppressive medication and liver transplantation. In conclusion, the HLA-DRB1*03:01 and HLA-DRB1*04:01 alleles are both independently associated with the aggregate diagnostic IAIHG score in type-1 AIH patients, but are not essential for AIH development. HLA-DRB1*03:01 is the strongest genetic modifier of disease severity in AIH.

  6. Tritium release from beryllium pebbles after high temperature irradiation up to 3000 appm He in the HIDOBE-01 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Til, S. van, E-mail: vantil@nrg.eu [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Fedorov, A.V.; Stijkel, M.P.; Cobussen, H.L.; Mutnuru, R.K.; Idsert, P. van der [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Zmitko, M. [The European Joint Undertaking for ITER and The Development of Fusion Energy, c/ Josep Pla, no. 2, Torres Diagonal Litoral, Edificio B3, 08019 Barcelona (Spain)

    2013-11-15

    In the HIDOBE (HIgh DOse irradiation of BEryllium) irradiation program, various grades of constrained and unconstrained beryllium pebbles, beryllium pellets and titanium-beryllide samples are irradiated in the High Flux Reactor (HFR) in Petten at four different temperatures (between 698 K and 1023 K) for 649 days [1]. The first of two HIDOBE irradiation experiments, HIDOBE-01, was completed after achieving a DEMO relevant helium production level of 3000 appm and the samples are retrieved for postirradiation examination (PIE). This work shows preliminary results of the out-of-pile tritium release analysis performed on different grades of irradiated beryllium pebbles (different in size). Relationships between irradiation temperature, tritium inventory and microstructural evolution have been observed by light microscopy and scanning electron microscopy.

  7. Amplitude analysis of $D^0\\rightarrow K^+K^-\\pi^+\\pi^-$ and its subsequent use in measuring the CKM phase $\\gamma$ through $B^{\\pm}\\rightarrow D(\\rightarrow K^+K^-\\pi^+\\pi^-)K^{\\pm}$ decays at LHCb

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00392618

    An amplitude analysis of the 4-body charmed decay $D^0\\rightarrow K^+K^-\\pi^+\\pi^-$ has been performed using data collected from symmetric electron-positron collisions at the CLEO experiment. Both flavour tagged and CP tagged data are utilised in the analysis, making it unique among amplitude analyses performed at other experiments and providing extra sensitivity to the phases of the amplitude components. This analysis uses a data driven regularisation method to determine which of the multitude of possible amplitude components to include in the amplitude model. The dominant contributions are found to be $D^0 \\to \\phi(1020) \\, \\rho^0(770)$, $D^0 \\to K^- \\, K_{1}(1270)^{+}$ and $D^0 \\to K^- \\, K_{1}(1400)^{+}$. Tests for CP violation in the $D$ system are performed using the amplitude model; no evidence for CP violation is found. The amplitude model obtained is crucial input for a model-dependent measurement of the CP-violating phase $\\gamma$ using $B^\\pm \\to D(\\to K^+K^-\\pi^+\\pi^-)K^\\pm$ decays, which remains...

  8. Measurement of K/sub NN/, K/sub SS/, K/sub SL/, and K/sub LL/ in polarized np → polarized pn at 800 MeV in the CEX region

    International Nuclear Information System (INIS)

    Ransome, R.D.; Hollas, C.L.; Riley, P.J.

    1980-01-01

    The spin transfer parameters K/sub NN/, K/sub SS/, K/sub SL/, and K/sub LL/ have been measured for np elastic scattering at 800 MeV between 165 0 and 180 0 c.m. The parameters K/sub NN/ and K/sub LL/ are in good agreement with the quasi-free reaction polarized pd → polarized npp at 180 0

  9. A study of K*(890) and K*(1420) production mechanisms in K/sup +/p. -->. K/sup +/. pi. /sup -/. delta. /sup + +/ at 13 GeV/c. [Exchange mechanisms, angular distributions

    Energy Technology Data Exchange (ETDEWEB)

    Estabrooks, P; Martin, A D [Durham Univ. (UK); Brandenburg, G W; Carnegie, R K; Cashmore, R J; Davier, M; Dunwoodie, W M; Lasinski, T A; Leith, D W.G.S.; Matthews, J A.J.

    1976-04-05

    Amplitudes for K*(890) and K*(1420) production, and their lower spin background, are determined from an analysis of the K..pi.. angular distribution observed in K/sup +/p..-->..K/sup +/..pi../sup -/..delta../sup + +/ at 13 GeV/c. The exchange mechanisms responsible for K*..delta.. production are studied, and a simple model is introduced which describes all features of the data.

  10. kW-class picosecond thin-disc prepulse laser Perla for efficient EUV generation

    Czech Academy of Sciences Publication Activity Database

    Endo, Akira; Smrž, Martin; Mužík, Jiří; Novák, Ondřej; Chyla, Michal; Mocek, Tomáš

    2017-01-01

    Roč. 16, č. 4 (2017), s. 1-6, č. článku 041011. ISSN 1932-5150 R&D Projects: GA MŠk LO1602; GA ČR GA16-12960S; GA MŠk LM2015086 EU Projects: European Commission(XE) 739573 - HiLASE CoE Grant - others:OP VVV - HiLASE-CoE(XE) CZ.02.1.01/0.0/0.0/15_006/0000674 Institutional support: RVO:68378271 Keywords : EUV source * laser produced plasma * FEL * prepulse * thin-disc laser Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.350, year: 2016

  11. Vitamine K

    Directory of Open Access Journals (Sweden)

    Bal dit Sollier Claire

    2011-03-01

    Full Text Available Subclasses of vitamin K, their origins, their differential characteristics of absorption and metabolism, their relative effects on gammacarboxylation of various proteins implicated in hemostasis andcoagulation, in bone calcification are not well known even by experts in these fields. These misunderstandings explain errors in recommendations for public and for patients. This review will not expose again the fundamentals on vitamins K as presented in the paper by Marc Guillaumont published in 2000 in this same journal. This 2011 review will try to update our actual knowledge and most of all will insist on their practical implications especially on the management of oral anticoagulant treatments since until recently vitamin K antagonist was the only available type of such a treatment. Several examples illustrate the need for a better understanding of this subject. The fear that diet vitamin K could deregulate the equilibrium of oral vitamin K antagonist treatment leads to recommend a quite total suppression of vitamin K containing components in the diet of anticoagulated patients. This leads to an opposite effect: a high sensitivity to vitamin K and to disequilibrium of the anticoagulant treatment while a comprehensivemoderate and regular diet intake of vitamin K first facilitates the food choice of the patients but also helps to stabilise the treatment of chronically anticoagulated patients. Vitamin K plays a role in bone calcification and in osteoporosis prevention. Until recently the food supplementation with vitamin K in view of preventing osteoporosis in general population was strongly limited due to fear to affect the treatment equilibrium in anticoagulated patients. While an understanding that the effects of moderate supplementation in vitamin K has no or limited effect on anticoagulation and on the long run could at the opposite help to stabilize the daily level of anticoagulation in patients chronically treated with vitamin K.

  12. R K Mangal

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. R K Mangal. Articles written in Bulletin of Materials Science. Volume 29 Issue 7 December 2006 pp 653-657 Semiconductors. Preparation of Al–Sb semiconductor by swift heavy ion irradiation · R K Mangal M Singh Y K Vijay D K Avasthi · More Details Abstract Fulltext PDF.

  13. A K Meikap

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Meikap. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 649-652 Alloys and Steels. An X-ray diffraction study of defect parameters in a Ti-base alloy · G Karmaker P Mukherjee A K Meikap S K Chattopadhyay S K Chatterjee.

  14. K+ and Na+ fluxes in roots of two Chinese Iris populations

    Directory of Open Access Journals (Sweden)

    Pinfang LI,Biao ZHANG

    2014-06-01

    Full Text Available Maintenance of ion homeostasis, particularly the regulation of K+ and Na+ uptake, is important for all plants to adapt to salinity. Observations on ionic response to salinity and net fluxes of K+, Na+ in the root exhibited by plants during salt stress have highlighted the need for further investigation. The objectives of this study were to compare salt adaptation of two Chinese Iris (Iris lactea Pall. var. chinensis (Fisch. Koidz. populations, and to improve understanding of adaptation to salinity exhibited by plants. Plants used in this study were grown from seeds collected in the Xinjiang Uygur Autonomous Region (Xj and Beijing Municipality (Bj, China. Hydroponically-grown seedlings of the two populations were supplied with nutrient solutions containing 0.1 (control and 140 mmol·L-1 NaCl. After 12 days, plants were harvested for determination of relative growth rate and K+, Na+ concentrations. Net fluxes of K+, Na+ from the apex and along the root axis to 10.8 mm were measured using non-invasive micro-test technique. With 140 mmol·L-1 NaCl treatment, shoots for population Xj had larger relative growth rate and higher K+ concentration than shoots for population Bj. However, the Na+ concentrations in both shoots and roots were lower for Xj than those for Bj. There was a lower net efflux of K+ found in population Xj than by Bj in the mature zone (approximately 2.4-10.8 mm from root tip. However, no difference in the efflux of Na+ between the populations was obtained. Population Xj of I. lactea continued to grow normally under NaCl stress, and maintained a higher K+/Na+ ratio in the shoots. These traits, which were associated with lower K+ leakage, help population Xj adapt to saline environments.

  15. 46 CFR 111.01-11 - Corrosion-resistant parts.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Corrosion-resistant parts. 111.01-11 Section 111.01-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS General § 111.01-11 Corrosion-resistant parts. Each enclosure and part of electric...

  16. A K Singh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Singh. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 633-638 Alloys and Steels. Analysis of stainless steel samples by energy dispersive X-ray fluorescence (EDXRF) spectrometry · M K Tiwari A K Singh K J S Sawhney · More Details ...

  17. K C Mittal

    Indian Academy of Sciences (India)

    K C Mittal. Articles written in Sadhana. Volume 30 Issue 6 December 2005 pp 757-764. Development of a 300-kV Marx generator and its application to drive a relativistic electron beam · Y Choyal Lalit Gupta Preeti Vyas Prasad Deshpande Anamika Chaturvedi K C Mittal K P Maheshwari · More Details Abstract Fulltext PDF.

  18. Experimental determination and modeling of the solubility phase diagram of the ternary system (Li{sub 2}SO{sub 4} + K{sub 2}SO{sub 4} + H{sub 2}O) at 288.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shiqiang, E-mail: wangshiqiang@tust.edu.cn [Tianjin Key Laboratory of Marine Resources and Chemistry, College of Marine Science and Engineering, Tianjin University of Science and Technology, Tianjin 300457 (China); Guo, Yafei [Tianjin Key Laboratory of Marine Resources and Chemistry, College of Marine Science and Engineering, Tianjin University of Science and Technology, Tianjin 300457 (China); Li, Dongchan [Engineering Research Center of Seawater Utilization Technology of Ministry of Education, Hebei University of Technology, Tianjin 300130 (China); Tang, Peng; Deng, Tianlong [Tianjin Key Laboratory of Marine Resources and Chemistry, College of Marine Science and Engineering, Tianjin University of Science and Technology, Tianjin 300457 (China)

    2015-02-10

    Highlights: • Solubility of the ternary system Li{sub 2}SO{sub 4} + K{sub 2}SO{sub 4} + H{sub 2}O at 288.15 K has been measured. • Phase diagram of this system was simulated and calculated by a thermodynamic model. • Li{sub 2}SO{sub 4}·K{sub 2}SO{sub 4} belongs to the incongruent double salt in this system. • Solution density was calculated using empirical equation. - Abstract: The solubility and density in the thermodynamic phase equilibria ternary system (Li{sub 2}SO{sub 4} + K{sub 2}SO{sub 4} + H{sub 2}O) at 288.15 K and 0.1 MPa were investigated experimentally with the method of isothermal dissolution equilibrium. This system at 288.15 K consists of two invariant points, three univariant isothermal dissolution curves; and three crystallization regions. The salt Li{sub 2}SO{sub 4}·K{sub 2}SO{sub 4} belongs to the incongruent double salt, and no solid solution was found. Based on the Pitzer model and its extended Harvie–Weare (HW) model, the mixing ion-interaction parameters of θ{sub Li,K}, ψ{sub Li,K,SO4} at 288.15 K and the solubility equilibrium constants K{sub sp} of solid phases Li{sub 2}SO{sub 4}·H{sub 2}O and Li{sub 2}SO{sub 4}·K{sub 2}SO{sub 4}, which are not reported in the literature were acquired. A comparison between the calculated and experimental results at 288.15 K for the ternary system shows that the calculated solubilities obtained with the extended HW model agree well with experimental data.

  19. Rapid internalization of the oncogenic K+ channel K(V10.1.

    Directory of Open Access Journals (Sweden)

    Tobias Kohl

    Full Text Available K(V10.1 is a mammalian brain voltage-gated potassium channel whose ectopic expression outside of the brain has been proven relevant for tumor biology. Promotion of cancer cell proliferation by K(V10.1 depends largely on ion flow, but some oncogenic properties remain in the absence of ion permeation. Additionally, K(V10.1 surface populations are small compared to large intracellular pools. Control of protein turnover within cells is key to both cellular plasticity and homeostasis, and therefore we set out to analyze how endocytic trafficking participates in controlling K(V10.1 intracellular distribution and life cycle. To follow plasma membrane K(V10.1 selectively, we generated a modified channel of displaying an extracellular affinity tag for surface labeling by α-bungarotoxin. This modification only minimally affected K(V10.1 electrophysiological properties. Using a combination of microscopy and biochemistry techniques, we show that K(V10.1 is constitutively internalized involving at least two distinct pathways of endocytosis and mainly sorted to lysosomes. This occurs at a relatively fast rate. Simultaneously, recycling seems to contribute to maintain basal K(V10.1 surface levels. Brief K(V10.1 surface half-life and rapid lysosomal targeting is a relevant factor to be taken into account for potential drug delivery and targeting strategies directed against K(V10.1 on tumor cells.

  20. DPW-VI Results Using FUN3D with Focus on k-kL-MEAH2015 (k-kL) Turbulence Model

    Science.gov (United States)

    Abdol-Hamid, K. S.; Carlson, Jan-Renee; Rumsey, Christopher L.; Lee-Rausch, Elizabeth M.; Park, Michael A.

    2017-01-01

    The Common Research Model wing-body configuration is investigated with the k-kL-MEAH2015 turbulence model implemented in FUN3D. This includes results presented at the Sixth Drag Prediction Workshop and additional results generated after the workshop with a nonlinear Quadratic Constitutive Relation (QCR) variant of the same turbulence model. The workshop provided grids are used, and a uniform grid refinement study is performed at the design condition. A large variation between results with and without a reconstruction limiter is exhibited on "medium" grid sizes, indicating that the medium grid size is too coarse for drawing conclusions in comparison with experiment. This variation is reduced with grid refinement. At a fixed angle of attack near design conditions, the QCR variant yielded decreased lift and drag compared with the linear eddy-viscosity model by an amount that was approximately constant with grid refinement. The k-kL-MEAH2015 turbulence model produced wing root junction flow behavior consistent with wind tunnel observations.

  1. Almost all k-cop-win graphs contain a dominating set of cardinality k

    OpenAIRE

    Pralat, Pawel

    2013-01-01

    We consider $k$-cop-win graphs in the binomial random graph $G(n,1/2).$ It is known that almost all cop-win graphs contain a universal vertex. We generalize this result and prove that for every $k \\in N$, almost all $k$-cop-win graphs contain a dominating set of cardinality $k$. From this it follows that the asymptotic number of labelled $k$-cop-win graphs of order $n$ is equal to $(1+o(1)) (1-2^{-k})^{-k} {n \\choose k} 2^{n^2/2 - (1/2-\\log_2(1-2^{-k})) n}$.

  2. 46 CFR 35.01-55 - Pilot boarding operation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Pilot boarding operation. 35.01-55 Section 35.01-55... Requirements § 35.01-55 Pilot boarding operation. (a) The master shall ensure that pilot boarding equipment is... instructions. (b) The master shall ensure compliance with the following during pilot boarding operations: (1...

  3. New measurement of the $K^{\\pm} \\to \\pi^{\\pm}\\mu^{+}\\mu^{-}$ decay

    CERN Document Server

    Batley, J.R.; Lazzeroni, C.; Munday, D.J.; Slater, M.W.; Wotton, S.A.; Arcidiacono, R.; Bocquet, G.; Cabibbo, N.; Ceccucci, A.; Cundy, D.; Falaleev, V.; Fidecaro, M.; Gatignon, L.; Gonidec, A.; Kubischta, W.; Norton, A.; Maier, A.; Patel, M.; Peters, A.; Balev, S.; Frabetti, P.L.; Goudzovski, E.; Hristov, P.; Kekelidze, V.; Kozhuharov, V.; Litov, L.; Madigozhin, D.; Marinova, E.; Molokanova, N.; Polenkevich, I.; Potrebenikov, Yu.; Stoynev, S.; Zinchenko, A.; Monnier, E.; Swallow, E.; Winston, R.; Rubin, P.; Walker, A.; Baldini, W.; Cotta Ramusino, A.; Dalpiaz, P.; Damiani, C.; Fiorini, M.; Gianoli, A.; Martini, M.; Petrucci, F.; Savrie, M.; Scarpa, M.; Wahl, H.; Bizzeti, A.; Lenti, M.; Veltri, M.; Calvetti, M.; Celeghini, E.; Iacopini, E.; Ruggiero, G.; Behler, M.; Eppard, K.; Kleinknecht, K.; Marouelli, P.; Masetti, L.; Moosbrugger, U.; Morales Morales, C.; Renk, B.; Wache, M.; Wanke, R.; Winhart, A.; Coward, D.; Dabrowski, A.; Fonseca Martin, T.; Shieh, M.; Szleper, M.; Velasco, M.; Wood, M.D.; Cenci, P.; Pepe, M.; Petrucci, M.C.; Anzivino, G.; Imbergamo, E.; Nappi, A.; Piccini, M.; Raggi, M.; Valdata-Nappi, M.; Cerri, C.; Fantechi, R.; Collazuol, G.; Di Lella, L.; Lamanna, G.; Mannelli, I.; Michetti, A.; Costantini, F.; Doble, N.; Fiorini, L.; Giudici, S.; Pierazzini, G.; Sozzi, M.; Venditti, S.; Bloch-Devaux, B.; Cheshkov, C.; Cheze, J.B.; De Beer, M.; Derre, J.; Marel, G.; Mazzucato, E.; Peyaud, B.; Vallage, B.; Holder, M.; Ziolkowski, M.; Biino, C.; Cartiglia, N.; Marchetto, F.; Bifani, S.; Clemencic, M.; Goy Lopez, S.; Dibon, H.; Jeitler, M.; Markytan, M.; Mikulec, I.; Neuhofer, G.; Widhalm, L.

    2011-01-01

    A sample of 3120 $K^\\pm\\to\\pi^\\pm\\mu^+\\mu^-$ decay candidates with $(3.3\\pm0.7)$% background contamination has been collected by the NA48/2 experiment at the CERN SPS, allowing a detailed study of the decay properties. The branching ratio was measured to be ${\\rm BR}=(9.62\\pm0.25)\\times 10^{-8}$. The form factor $W(z)$, where $z=(M_{\\mu\\mu}/M_K)^2$, was parameterized according to several models. In particular, the slope of the linear form factor $W(z)=W_0(1+\\delta z)$ was measured to be $\\delta=3.11\\pm0.57$. Upper limits of $2.9\\times 10^{-2}$ and $2.3\\times 10^{-2}$ on possible charge asymmetry and forward-backward asymmetry were established at 90% CL. An upper limit ${\\rm BR}(K^\\pm\\to\\pi^\\mp\\mu^\\pm\\mu^\\pm)<1.1\\times 10^{-9}$ was established at 90% CL for the rate of the lepton number violating decay.

  4. K-AP: Generating specified K clusters by efficient Affinity Propagation

    KAUST Repository

    Zhang, Xiangliang

    2010-12-01

    The Affinity Propagation (AP) clustering algorithm proposed by Frey and Dueck (2007) provides an understandable, nearly optimal summary of a data set. However, it suffers two major shortcomings: i) the number of clusters is vague with the user-defined parameter called self-confidence, and ii) the quadratic computational complexity. When aiming at a given number of clusters due to prior knowledge, AP has to be launched many times until an appropriate setting of self-confidence is found. The re-launched AP increases the computational cost by one order of magnitude. In this paper, we propose an algorithm, called K-AP, to exploit the immediate results of K clusters by introducing a constraint in the process of message passing. Through theoretical analysis and experimental validation, K-AP was shown to be able to directly generate K clusters as user defined, with a negligible increase of computational cost compared to AP. In the meanwhile, K-AP preserves the clustering quality as AP in terms of the distortion. K-AP is more effective than k-medoids w.r.t. the distortion minimization and higher clustering purity. © 2010 IEEE.

  5. 46 CFR 58.01-50 - Machinery space, noise.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Machinery space, noise. 58.01-50 Section 58.01-50... MACHINERY AND RELATED SYSTEMS General Requirements § 58.01-50 Machinery space, noise. (a) Each machinery space must be designed to minimize the exposure of personnel to noise in accordance with IMO A.468(XII...

  6. D K Ghosh

    Indian Academy of Sciences (India)

    D K Ghosh. Articles written in Pramana – Journal of Physics. Volume 63 Issue 6 December 2004 pp 1359-1365. Working group report: Low energy and flavour physics · Amol Dighe Anirban Kundu K Agashe B Anantanarayan A Chandra A Datta P K Das S P Das A Dighe R Forty D K Ghosh Y -Y Keum A Kundu N Mahajan S ...

  7. 21 CFR 864.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 864.9 Section 864.9 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY...

  8. The phosphatase activity of the isolated H4-H5 loop of Na(+)/K(+) ATPase resides outside its ATP binding site

    Czech Academy of Sciences Publication Activity Database

    Krumscheid, R.; Ettrich, Rüdiger; Sovová, Žofie; Sušánková, Klára; Lánský, Zdeněk; Hofbauerová, Kateřina; Linnertz, H.; Teisinger, Jan; Amler, Evžen; Schoner, W.

    2004-01-01

    Roč. 271, č. 19 (2004), s. 3923-3936 ISSN 0014-2956 R&D Projects: GA MŠk(CZ) LN00A141; GA ČR(CZ) GA204/01/0254; GA ČR(CZ) GA204/01/1001; GA ČR(CZ) GP206/03/D082; GA ČR(CZ) GA309/02/1479 Grant - others:Deutsche Forschungsgemeinschaft(DE) Bonn Scho 139/21-2+3; CZ-DE(CZ) TSR-088-97; CZ-DE(CZ) CZE 00/33 Institutional research plan: CEZ:AV0Z5011922 Keywords : Na(+)/K(+) ATPase * p-nitrophenylphosphate * H4-H5 loop Subject RIV: CE - Biochemistry Impact factor: 3.260, year: 2004

  9. K*(892)0Λ & K+Σ*(1385)- photoproduction on the deuteron

    International Nuclear Information System (INIS)

    Mattione, Paul

    2014-01-01

    Preliminary measurements of the differential cross sections of the γn → K*(892) 0 Λ and γn → K + Σ*(1385) - reactions are shown using data from the Jefferson Lab Hall B CLAS g13 experiment. No experimental cross section data have yet been published on the γn → K*(892) 0 Λ reaction, and the only published cross section data on the γn → K + Σ*(1385) - reaction are at forward angles, where t-channel K + and K* + exchanges are predicted to dominate. These data can be used to contribute to the search for the "missing" N* resonances, some of which are predicted to have non-negligible couplings to the excited strangeness channels. (author)

  10. Measurement of the decays B--> phiK and B--> phiK*.

    Science.gov (United States)

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Y; Lees, J P; Robbe, P; Tisserand, V; Palano, A; Chen, G P; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Reinertsen, P L; Stugu, B; Abbott, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Clark, A R; Fan, Q; Gill, M S; Gowdy, S J; Gritsan, A; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kluth, S; Kolomensky, Y G; Kral, J F; LeClerc, C; Levi, M E; Liu, T; Lynch, G; Meyer, A B; Momayezi, M; Oddone, P J; Perazzo, A; Pripstein, M; Roe, N A; Romosan, A; Ronan, M T; Shelkov, V G; Telnov, A V; Wenzel, W A; Bright-Thomas, P G; Harrison, T J; Hawkes, C M; Kirk, A; Knowles, D J; O'Neale, S W; Penny, R C; Watson, A T; Watson, N K; Deppermann, T; Koch, H; Krug, J; Kunze, M; Lewandowski, B; Peters, K; Schmuecker, H; Steinke, M; Andress, J C; Barlow, N R; Bhimji, W; Chevalier, N; Clark, P J; Cottingham, W N; De Groot, N; Dyce, N; Foster, B; Mass, A; McFall, J D; Wallom, D; Wilson, F F; Abe, K; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Camanzi, B; Jolly, S; McKemey, A K; Tinslay, J; Blinov, V E; Bukin, A D; Bukin, D A; Buzykaev, A R; Dubrovin, M S; Golubev, V B; Ivanchenko, V N; Korol, A A; Kravchenko, E A; Onuchin, A P; Salnikov, A A; Serednyakov, S I; Skovpen, Y I; Telnov, V I; Yushkov, A N; Lankford, A J; Mandelkern, M; McMahon, S; Stoker, D P; Ahsan, A; Arisaka, K; Buchanan, C; Chun, S; Branson, J G; MacFarlane, D B; Prell, S; Rahatlou, S; Raven, G; Sharma, V; Campagnari, C; Dahmes, B; Hart, P A; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Richman, J D; Verkerke, W; Witherell, M; Yellin, S; Beringer, J; Dorfan, D E; Eisner, A M; Frey, A; Grillo, A A; Grothe, M; Heusch, C A; Johnson, R P; Kroeger, W; Lockman, W S; Pulliam, T; Sadrozinski, H; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Metzler, S; Oyang, J; Porter, F C; Ryd, A; Samuel, A; Weaver, M; Yang, S; Zhu, R Y; Devmal, S; Geld, T L; Jayatilleke, S; Mancinelli, G; Meadows, B T; Sokoloff, M D; Bloom, P; Fahey, S; Ford, W T; Gaede, F; Johnson, D R; Michael, A K; Nauenberg, U; Olivas, A; Park, H; Rankin, P; Roy, J; Sen, S; Smith, J G; van Hoek, W C; Wagner, D L; Blouw, J; Harton, J L; Krishnamurthy, M; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Brandt, T; Brose, J; Colberg, T; Dahlinger, G; Dickopp, M; Dubitzky, R S; Maly, E; Müller-Pfefferkorn, R; Otto, S; Schubert, K R; Schwierz, R; Spaan, B; Wilden, L; Behr, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Ferrag, S; Roussot, E; T'Jampens, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Anjomshoaa, A; Bernet, R; Di Lodovico, F; Khan, A; Muheim, F; Playfer, S; Swain, J E; Falbo, M; Bozzi, C; Dittongo, S; Folegani, M; Piemontese, L; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Xie, Y; Zallo, A; Bagnasco, S; Buzzo, A; Contri, R; Crosetti, G; Fabbricatore, P; Farinon, S; Lo Vetere, M; Macri, M; Monge, M R; Musenich, R; Pallavicini, M; Parodi, R; Passaggio, S; Pastore, F C; Patrignani, C; Pia, M G; Priano, C; Robutti, E; Santroni, A; Morii, M; Bartoldus, R; Dignan, T; Hamilton, R; Mallik, U; Cochran, J; Crawley, H B; Fischer, P A; Lamsa, J; Meyer, W T; Rosenberg, E I; Benkebil, M; Grosdidier, G; Hast, C; Höcker, A; Lacker, H M; LePeltier, V; Lutz, A M; Plaszczynski, S; Schune, M H; Trincaz-Duvoid, S; Valassi, A; Wormser, G; Bionta, R M; Brigljevic, V; Fackler, O; Fujino, D; Lange, D J; Mugge, M; Shi, X; van Bibber, K; Wenaus, T J; Wright, D M; Wuest, C R; Carroll, M; Fry, J R; Gabathuler, E; Gamet, R; George, M; Kay, M; Payne, D J; Sloane, R J; Touramanis, C; Aspinwall, M L; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gunawardane, N J; Martin, R; Nash, J A; Sanders, P; Smith, D; Azzopardi, D E; Back, J J; Dixon, P; Harrison, P F; Potter, R J; Shorthouse, H W; Strother, P; Vidal, P B; Williams, M I; Cowan, G; George, S; Green, M G; Kurup, A; Marker, C E; McGrath, P; McMahon, T R; Ricciardi, S; Salvatore, F; Scott, I; Vaitsas, G; Brown, D; Davis, C L; Allison, J; Barlow, R J; Boyd, J T; Forti, A; Fullwood, J; Jackson, F; Lafferty, G D; Savvas, N; Simopoulos, E T; Weatherall, J H; Farbin, A; Jawahery, A; Lillard, V; Olsen, J; Roberts, D A; Schieck, J R; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Lin, C S; Moore, T B; Staengle, H; Willocq, S; Wittlin, J; Brau, B; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Britton, D I; Milek, M; Patel, P M; Trischuk, J; Lanni, F; Palombo, F; Bauer, J M; Booke, M; Cremaldi, L; Eschenburg, V; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Martin, J P; Nief, J Y; Seitz, R; Taras, P; Zacek, V; Nicholson, H; Sutton, C S; Cartaro, C; Cavallo, N; De Nardo, G; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; LoSecco, J M; Alsmiller, J R; Gabriel, T A; Handler, T; Brau, J; Frey, R; Iwasaki, M; Sinev, N B; Strom, D; Colecchia, F; Dal Corso, F; Dorigo, A; Galeazzi, F; Margoni, M; Michelon, G; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Torassa, E; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; De La Vaissière, C; Del Buono, L; Hamon, O; Le Diberder, F; Leruste, P; Lory, J; Roos, L; Stark, J; Versillé, S; Manfredi, P F; Re, V; Speziali, V; Frank, E D; Gladney, L; Guo, Q H; Panetta, J H; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Martinez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Simi, G; Triggiani, G; Walsh, J; Haire, M; Judd, D; Paick, K; Turnbull, L; Wagoner, D E; Albert, J; Bula, C; Lu, C; McDonald, K T; Miftakov, V; Schaffner, S F; Smith, A J; Tumanov, A; Varnes, E W; Cavoto, G; del Re, D; Faccini, R; Ferrarotto, F; Ferroni, F; Fratini, K; Lamanna, E; Leonardi, E; Mazzoni, M A; Morganti, S; Piredda, G; Safai Tehrani, F; Serra, M; Voena, C; Christ, S; Waldi, R; Adye, T; Franek, B; Geddes, N I; Gopal, G P; Xella, S M; Aleksan, R; De Domenico, G; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel De Monchenault, G; Kozanecki, W; Langer, M; London, G W; Mayer, B; Serfass, B; Vasseur, G; Yeche, C; Zito, M; Copty, N; Purohit, M V; Singh, H; Yumiceva, F X; Adam, I; Anthony, P L; Aston, D; Baird, K; Bartelt, J; Bloom, E; Boyarski, A M; Bulos, F; Calderini, G; Claus, R; Convery, M R; Coupal, D P; Coward, D H; Dorfan, J; Doser, M; Dunwoodie, W; Field, R C; Glanzman, T; Godfrey, G L; Grosso, P; Himel, T; Huffer, M E; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W; Luitz, S; Luth, V; Lynch, H L; Manzin, G; Marsiske, H; Menke, S; Messner, R; Moffeit, K C; Mount, R; Muller, D R; O'Grady, C P; Petrak, S; Quinn, H; Ratcliff, B N; Robertson, S H; Rochester, L S; Roodman, A; Schietinger, T; Schindler, R H; Schwiening, J; Serbo, V V; Snyder, A; Soha, A; Spanier, S M; Stahl, A; Stelzer, J; Su, D; Sullivan, M K; Talby, M; Tanaka, H A; Trunov, A; Va'vra, J; Wagner, S R; Weinstein, A J; Wisniewski, W J; Young, C C; Burchat, P R; Cheng, C H; Kirkby, D; Meyer, T I; Roat, C; De Silva, A; Henderson, R; Bugg, W; Cohn, H; Hart, E; Weidemann, A W; Benninger, T; Izen, J M; Kitayama, I; Lou, X C; Turcotte, M; Bianchi, F; Bona, M; Di Girolamo, B; Gamba, D; Smol, A; Zanin, D; Bosisio, L; Della Ricca, G; Lanceri, L; Pompili, A; Poropat, P; Prest, M; Vallazza, E; Vuagnin, G; Panvini, R S; Brown, C M; Kowalewski, R; Roney, J M; Band, H R; Charles, E; Dasu, S; Elmer, P; Hu, H; Johnson, J R; Liu, R; Nielsen, J; Orejudos, W; Pan, Y; Prepost, R; Scott, I J; Sekula, S J; von Wimmersperg-Toeller, J H; Wu, S L; Yu, Z; Zobering, H; Kordich, T M; Neal, H

    2001-10-08

    We have observed the decays B--> phiK and phiK(*) in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are B(B+--> phiK+) = (7.7(+1.6)(-1.4)+/-0.8)x10(-6), B(B0--> phiK0) = (8.1(+3.1)(-2.5)+/-0.8)x10(-6), B(B+--> phiK(*+)) = (9.7(+4.2)(-3.4)+/-1.7)x10(-6), and B(B0--> phiK(*0)) = (8.7(+2.5)(-2.1)+/-1.1)x10(-6). We also report the upper limit B(B+--> phipi(+))<1.4x10(-6) ( 90% C.L.).

  11. 17 CFR 210.9-01 - Application of §§ 210.9-01 to 210.9-07

    Science.gov (United States)

    2010-04-01

    ... COMMISSION FORM AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES....9-01 Application of §§ 210.9-01 to 210.9-07 This article is applicable to consolidated financial statements filed for bank holding companies and to any financial statements of banks that are included in...

  12. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  13. Molecular epidemiology of Klebsiella pneumoniae K1 and K2 isolates in Japan.

    Science.gov (United States)

    Harada, Sohei; Ishii, Yoshikazu; Saga, Tomoo; Aoki, Kotaro; Tateda, Kazuhiro

    2018-03-20

    Although severe infections caused by hypervirulent Klebsiella pneumoniae isolates, such as K1 isolates belonging to sequence type (ST) 23, have been a significant problem in Asian countries, epidemiology of these isolates in Japan remains unclear. We performed a nationwide molecular epidemiological study of K. pneumoniae K1 and K2 isolates in Japan. Of the 259K. pneumoniae isolates collected, 14 and 16 isolates were identified as capsular genotypes K1 and K2, respectively. All K1 isolates were ST23 or its closely related clones and showed high genetic similarity by pulsed-field gel electrophoresis (PFGE) and the DiversiLab system (DL). K2 isolates, belonging to ST14, ST25, ST65, ST86, and ST110, were more genetically diverse than K1 isolates. Isolates belonging to a specific ST showed identical virulence gene profiles with a few exceptions. PFGE and DL results using K1 and K2 isolates were generally in agreement. Copyright © 2018. Published by Elsevier Inc.

  14. 40 CFR 86.1807-01 - Vehicle labeling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 19 2010-07-01 2010-07-01 false Vehicle labeling. 86.1807-01 Section... (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES (CONTINUED) General Compliance Provisions for Control of Air Pollution From New and In-Use Light-Duty Vehicles, Light-Duty Trucks...

  15. 21 CFR 880.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 880.9 Section 880.9 Food and Drugs FOOD AND DRUG... Food, Drug, and Cosmetic Act (the act). The exemption from the requirement of premarket notification...

  16. 21 CFR 878.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 878.9 Section 878.9 Food and Drugs FOOD AND DRUG..., and Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510...

  17. 21 CFR 884.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 884.9 Section 884.9 Food and Drugs FOOD AND DRUG..., and Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510...

  18. 21 CFR 876.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 876.9 Section 876.9 Food and Drugs FOOD AND DRUG..., and Cosmetic Act (the act). The exemption from the requirement of premarket notification (section 510...

  19. 21 CFR 862.9 - Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Limitations of exemptions from section 510(k) of the Federal Food, Drug, and Cosmetic Act (the act). 862.9 Section 862.9 Food and Drugs FOOD AND DRUG... Federal Food, Drug, and Cosmetic Act (the act). The exemption from the requirement of premarket...

  20. Transition probabilities between levels of K and K+

    International Nuclear Information System (INIS)

    Campos Gutierrez, J.; Martin Vicente, A.

    1984-01-01

    In this work transition probabilities between Ievels of n < 11 for K and for the known of K+ are calculated. Two computer programs based on the Coulomb approximation and the most suitable coupling schemes has been used. Lifetimes of all these levels are also calculated. (Author)

  1. Polaronic transport and thermoelectricity in Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2)

    Science.gov (United States)

    Liu, Yu; Kang, Chang-Jong; Stavitski, Eli; Du, Qianheng; Attenkofer, Klaus; Kotliar, G.; Petrovic, C.

    2018-04-01

    We report a study of Co-doped berthierite Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2). The alloy series of Fe1 -xCoxSb2S4 crystallize in an orthorhombic structure with the Pnma space group, similar to FeSb2, and show semiconducting behavior. The large discrepancy between activation energy for conductivity, Eρ (146 ˜270 meV ), and thermopower, ES (47 ˜108 meV ), indicates the polaronic transport mechanism. Bulk magnetization and heat-capacity measurements of pure FeSb2S4 (x =0 ) exhibit a broad antiferromagnetic transition (TN=46 K ) followed by an additional weak transition (T*=50 K ). Transition temperatures (TN and T*) slightly decrease with increasing Co content x . This is also reflected in the thermal conductivity measurement, indicating strong spin-lattice coupling. Fe1 -xCoxSb2S4 shows relatively high value of thermopower (up to ˜624 μ V K-1 at 300 K) and thermal conductivity much lower when compared to FeSb2, a feature desired for potential applications based on FeSb2 materials.

  2. Acinetobacter baumannii K11 and K83 capsular polysaccharides have the same 6-deoxy-l-talose-containing pentasaccharide K units but different linkages between the K units.

    Science.gov (United States)

    Kenyon, Johanna J; Shashkov, Alexander S; Senchenkova, Sof'ya N; Shneider, Mikhail M; Liu, Bin; Popova, Anastasiya V; Arbatsky, Nikolay P; Miroshnikov, Konstantin A; Wang, Lei; Knirel, Yuriy A; Hall, Ruth M

    2017-10-01

    Acinetobacter baumannii produces a variety of capsular polysaccharides (CPS) via genes located at the chromosomal K locus and some KL gene clusters include genes for the synthesis of specific sugars. The structures of K11 and K83 CPS produced by isolates LUH5545 and LUH5538, which carry related KL11a and KL83 gene clusters, respectively, were established by sugar analysis and one- and two-dimensional 1 H and 13 C NMR spectroscopy. Both CPS contain l-rhamnose (l-Rha) and 6-deoxy-l-talose (l-6dTal), and both KL gene clusters include genes for dTDP-l-Rhap synthesis and a tle (talose epimerase) gene encoding an epimerase that converts dTDP-l-Rhap to dTDP-l-6dTalp. The K11 and K83 repeat units are the same pentasaccharide, consisting of d-glucose, l-Rha, l-6dTal, and N-acetyl-d-glucosamine, except that l-6dTal is 2-O-acetylated in K83. However, the K units are linked differently, with l-Rha in the main chain in K11, but as a side-branch in K83. KL11 and KL83 encode unrelated Wzy polymerases that link the K units together and different acetyltransferases, though only Atr8 from KL83 is active. The substrate specificity of each Wzy polymerase was assigned, and the functions of all glycosyltransferases were predicted. The CPS structures produced by three closely related K loci, KL29, KL105 and KL106, were also predicted. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. 600 kV modulator design for the SLAC Next Linear Collider Test Accelerator

    International Nuclear Information System (INIS)

    Harris, K.; de Lamare, J.; Nesterov, V.; Cassel, R.

    1992-07-01

    Preliminary design for the SLAC Next Linear Collider Test Accelerator (NLCTA) requires a pulse power source to produce a 600 kV, 600 A, 1.4 μs, 0.1% flat top pulse with rise and fall times of approximately 100 ns to power an X-Band klystron with a microperveance of 1.25 at ∼ 100 MW peak RF power. The design goals for the modulator, including those previously listed, are peak modulator pulse power of 340 MW operating at 120 Hz. A three-stage darlington pulse-forming network, which produces a >100 kV, 1.4 μs pulse, is coupled to the klystron load through a 6:1 pulse transformer. Careful consideration of the transformer leakage inductance, klystron capacitance, system layout, and component choice is necessary to produce the very fast rise and fall times at 600 kV operating continuously at 120 Hz

  4. Measurement of the branching ratio for the doubly cabibbo suppressed decay D++ K-K+K+; Medida da razao de ramificacao do Decaimento D++ K-K+K+ duplamente suprimido por cabibbo

    Energy Technology Data Exchange (ETDEWEB)

    Silva Carvalho, Hendly da [Brazilian Centre for Physics Research (CBPF), Rio de Janeiro (Brazil).

    1997-07-01

    In this thesis, we performed a study for the decay modes D++ K-K+K+ and D+s+ K-K+K+, using the data collected by the E791, a hadroproduction of charm experiment at Fermilab. The D++ K-K+K+ decay is doubly Cabibbo suppressed while the D+s+ K-K+K+ decay is singly Cabibbo suppressed. We found 11.6 +- 3.9 events in the D+ mass region and 8.9 +- 3.3 in the D+s mass region. The D++ K-K+K+ branching ratio is measured to be (3.7 +- 1.3 +- 0.6) x 10-4 while the D++ K-K+K+ branching ratio relative to D+s+ K-K+K+ is measured to be (4.2 +- 1.5 +- 0.6) x 10-2.

  5. Duality between SU(N)k and SU(k)N WZW models

    International Nuclear Information System (INIS)

    Naculich, S.G.; Schnitzer, H.J.

    1990-01-01

    We exhibit a duality of the SU(N) k WZW model under interchange of the group parameter N and the level k. The primary fields of SU(N) k and SU(k) N are related by transposition of their associated Young tableaux. The holomorphic blocks of the four-point functions of the primary fields are in one-to-one correspondence, and satisfy orthogonality and completeness relations with respect to one another. We derive these relations through a path integral realization of the SU(N) k WZW model in terms of a theory of constrained Dirac fermions. (orig.)

  6. Diagnostics on LALR(k) conflicts based on a method for LR(k) testing

    DEFF Research Database (Denmark)

    Kristensen, Bent Bruun; Madsen, Ole Lehrmann

    1981-01-01

    A user of an LALR(k) parser generator system may have difficulties in understanding how a given LALR(k) conflict is generated. This is especially difficult if the conflict does not correspond to an LR(k) conflict. A practical method for giving informative diagnostics on LALR(k) conflicts is prese......A user of an LALR(k) parser generator system may have difficulties in understanding how a given LALR(k) conflict is generated. This is especially difficult if the conflict does not correspond to an LR(k) conflict. A practical method for giving informative diagnostics on LALR(k) conflicts...

  7. The Effects of Calcium, Vitamins D and K co-Supplementation on Markers of Insulin Metabolism and Lipid Profiles in Vitamin D-Deficient Women with Polycystic Ovary Syndrome.

    Science.gov (United States)

    Karamali, Maryam; Ashrafi, Mahnaz; Razavi, Maryamalsadat; Jamilian, Mehri; Kashanian, Maryam; Akbari, Maryam; Asemi, Zatollah

    2017-05-01

    Data on the effects of calcium, vitamins D and K co-supplementation on markers of insulin metabolism and lipid profiles among vitamin D-deficient women with polycystic ovary syndrome (PCOS) are scarce. This study was done to determine the effects of calcium, vitamins D and K co-supplementation on markers of insulin metabolism and lipid profiles in vitamin D-deficient women with PCOS. This randomized double-blind, placebo-controlled trial was conducted among 55 vitamin D-deficient women diagnosed with PCOS aged 18-40 years old. Subjects were randomly assigned into 2 groups to intake either 500 mg calcium, 200 IU vitamin D and 90 µg vitamin K supplements (n=28) or placebo (n=27) twice a day for 8 weeks. After the 8-week intervention, compared with the placebo, joint calcium, vitamins D and K supplementation resulted in significant decreases in serum insulin concentrations (-1.9±3.5 vs. +1.8±6.6 µIU/mL, P=0.01), homeostasis model of assessment-estimated insulin resistance (-0.4±0.7 vs. +0.4±1.4, P=0.01), homeostasis model of assessment-estimated b cell function (-7.9±14.7 vs. +7.0±30.3, P=0.02) and a significant increase in quantitative insulin sensitivity check index (+0.01±0.01 vs. -0.008±0.03, P=0.01). In addition, significant decreases in serum triglycerides (-23.4±71.3 vs. +9.9±39.5 mg/dL, P=0.03) and VLDL-cholesterol levels (-4.7±14.3 vs. +2.0±7.9 mg/dL, P=0.03) was observed following supplementation with combined calcium, vitamins D and K compared with the placebo. Overall, calcium, vitamins D and K co-supplementation for 8 weeks among vitamin D-deficient women with PCOS had beneficial effects on markers of insulin metabolism, serum triglycerides and VLDL-cholesterol levels. © Georg Thieme Verlag KG Stuttgart · New York.

  8. Comparative genome analysis of novel Podoviruses lytic for hypermucoviscous Klebsiella pneumoniae of K1, K2, and K57 capsular types.

    Science.gov (United States)

    Solovieva, Ekaterina V; Myakinina, Vera P; Kislichkina, Angelina A; Krasilnikova, Valentina M; Verevkin, Vladimir V; Mochalov, Vladimir V; Lev, Anastasia I; Fursova, Nadezhda K; Volozhantsev, Nikolay V

    2018-01-02

    Hypermucoviscous (HV) strains of capsular types K1, K2 and K57 are the most virulent representatives of the Klebsiella pneumoniae species. Eight novel bacteriophages lytic for HV K. pneumoniae were isolated and characterized. Three bacteriophages, KpV41, KpV475, and KpV71 were found to have a lytic activity against mainly K. pneumoniae of capsular type K1. Two phages, KpV74, and KpV763 were lytic for K2 capsular type K. pneumoniae, and the phage KpV767 was specific to K57-type K. pneumoniae only. Two more phages, KpV766, and KpV48 had no capsular specificity. The phage genomes consist of a linear double-stranded DNA of 40,395-44,623bp including direct terminal repeats of 180-246 bp. The G + C contents are 52.3-54.2 % that is slightly lower than that of genomes of K. pneumoniae strains being used for phage propagation. According to the genome structures, sequence similarity and phylogenetic data, the phages are classified within the genus Kp32virus and Kp34virus of subfamily Autographivirinae, family Podoviridae. In the phage genomes, genes encoding proteins with putative motifs of polysaccharide depolymerase were identified. Depolymerase genes of phages KpV71 and KpV74 lytic for hypermucoviscous K. pneumoniae of K1 and K2 capsular type, respectively, were cloned and expressed in Escherichia coli, and the recombinant gene products were purified. The specificity and polysaccharide-degrading activity of the recombinant depolymerases were demonstrated. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. The K Dwarf Advantage for Biosignatures

    Science.gov (United States)

    Arney, Giada; Domagal-Goldman, Shawn David; Meadows, Victoria

    2018-01-01

    Biosignature detection is typically studied in the context of an atmosphere in chemical disequilibrium. Oxygen (O2) and methane (CH4) are generally considered the “canonical” biosignature disequilibrium pair. However, the modern CH4 concentration poses a major detection challenge to future direct imaging telescopes, and it has been difficult for Earth to accumulate spectrally detectable quantities of O2 and CH4 over its history (Olson et al 2016, Reinhard et al 2017). Even the lower atmospheric levels of O2 typical of the Earth’s Proterozoic eon (0.01-1% of the modern O2 amount) may have resulted in a reduced photochemical lifetime of CH4 due to decreased UV shielding of CH4 (Claire et al 2006, Goldblatt et al 2006). However, while the above is true for an Earthlike planet orbiting a sunlike star, the situation changes for other stars. For instance, Segura et al (2005) found longer photochemical lifetimes for CH4 in the atmospheres of Earthlike planets orbiting M dwarfs. M dwarfs, however, present several barriers to planetary habitability including desiccation during the stellar super-luminous pre-main sequence phase (Lugar and Barnes 2015) and tidal locking. K dwarfs, which comprise about 12% of all main sequence stars, avoid these M dwarf hazards, and will be important targets for future exoplanet direct imaging missions. Using a photochemical model, we find CH4 and O2 are simultaneously detectable in the atmospheres of K dwarf planets with various O2 concentrations ranging between Proterozoic levels and modern O2 amounts. For instance, for a planet with an Earth-like CH4 surface flux (1 x 1011 molecules/cm2/s) and a Proterozoic-like O2 level (1% of modern), the planet generates a CH4 surface mixing ratio of 1x10-5 for a planet orbiting the sun, and 1.5x10-4 – an order of magnitude more CH4 – for a planet orbiting a K6V star. This is enough to produce detectable CH4 and O2 for the planet orbiting the K6V star. We discuss the implications of this “K

  10. A newly emerging HIV-1 recombinant lineage (CRF58_01B) disseminating among people who inject drugs in Malaysia.

    Science.gov (United States)

    Chow, Wei Zhen; Takebe, Yutaka; Syafina, Nur Ezreen; Prakasa, Malarvelli Soorya; Chan, Kok Gan; Al-Darraji, Haider Abdulrazzaq Abed; Koh, Clayton; Kamarulzaman, Adeeba; Tee, Kok Keng

    2014-01-01

    The HIV epidemic is primarily characterised by the circulation of HIV-1 group M (main) comprising of 11 subtypes and sub-subtypes (A1, A2, B-D, F1, F2, G, H, J, and K) and to date 55 circulating recombinant forms (CRFs). In Southeast Asia, active inter-subtype recombination involving three main circulating genotypes--subtype B (including subtype B', the Thai variant of subtype B), CRF01_AE, and CRF33_01B--have contributed to the emergence of novel unique recombinant forms. In the present study, we conducted the molecular epidemiological surveillance of HIV-1 gag-RT genes among 258 people who inject drugs (PWIDs) in Kuala Lumpur, Malaysia, between 2009 and 2011 whereby a novel CRF candidate was recently identified. The near full-length genome sequences obtained from six epidemiologically unlinked individuals showed identical mosaic structures consisting of subtype B' and CRF01_AE, with six unique recombination breakpoints in the gag-RT, pol, and env regions. Among the high-risk population of PWIDs in Malaysia, which was predominantly infected by CRF33_01B (>70%), CRF58_01B circulated at a low but significant prevalence (2.3%, 6/258). Interestingly, the CRF58_01B shared two unique recombination breakpoints with other established CRFs in the region: CRF33_01B, CRF48_01B, and CRF53_01B in the gag gene, and CRF15_01B (from Thailand) in the env gene. Extended Bayesian Markov chain Monte Carlo sampling analysis showed that CRF58_01B and other recently discovered CRFs were most likely to have originated in Malaysia, and that the recent spread of recombinant lineages in the country had little influence from neighbouring countries. The isolation, genetic characterization, and evolutionary features of CRF58_01B among PWIDs in Malaysia signify the increasingly complex HIV-1 diversity in Southeast Asia that may hold an implication on disease treatment, control, and prevention.

  11. A newly emerging HIV-1 recombinant lineage (CRF58_01B disseminating among people who inject drugs in Malaysia.

    Directory of Open Access Journals (Sweden)

    Wei Zhen Chow

    Full Text Available The HIV epidemic is primarily characterised by the circulation of HIV-1 group M (main comprising of 11 subtypes and sub-subtypes (A1, A2, B-D, F1, F2, G, H, J, and K and to date 55 circulating recombinant forms (CRFs. In Southeast Asia, active inter-subtype recombination involving three main circulating genotypes--subtype B (including subtype B', the Thai variant of subtype B, CRF01_AE, and CRF33_01B--have contributed to the emergence of novel unique recombinant forms. In the present study, we conducted the molecular epidemiological surveillance of HIV-1 gag-RT genes among 258 people who inject drugs (PWIDs in Kuala Lumpur, Malaysia, between 2009 and 2011 whereby a novel CRF candidate was recently identified. The near full-length genome sequences obtained from six epidemiologically unlinked individuals showed identical mosaic structures consisting of subtype B' and CRF01_AE, with six unique recombination breakpoints in the gag-RT, pol, and env regions. Among the high-risk population of PWIDs in Malaysia, which was predominantly infected by CRF33_01B (>70%, CRF58_01B circulated at a low but significant prevalence (2.3%, 6/258. Interestingly, the CRF58_01B shared two unique recombination breakpoints with other established CRFs in the region: CRF33_01B, CRF48_01B, and CRF53_01B in the gag gene, and CRF15_01B (from Thailand in the env gene. Extended Bayesian Markov chain Monte Carlo sampling analysis showed that CRF58_01B and other recently discovered CRFs were most likely to have originated in Malaysia, and that the recent spread of recombinant lineages in the country had little influence from neighbouring countries. The isolation, genetic characterization, and evolutionary features of CRF58_01B among PWIDs in Malaysia signify the increasingly complex HIV-1 diversity in Southeast Asia that may hold an implication on disease treatment, control, and prevention.

  12. Vitamin K

    Science.gov (United States)

    Vitamins are substances that your body needs to grow and develop normally. Vitamin K helps your body by making proteins for ... blood clotting. If you don't have enough vitamin K, you may bleed too much. Newborns have ...

  13. Tests of CP Violation with $\\bar{K^0}$ and $ K^{0} $ at LEAR

    CERN Multimedia

    2002-01-01

    % PS195 Tests of CP Violation with &bar.K$^0$ and K$^0$ at LEAR \\\\ \\\\The aim of the experiment is to carry out precision tests of CP, T and CPT on the neutral kaon system through $ K ^0 - $\\bar{K}^0 $ interferometry using LEAR as an intense source. A beam of $ ~10^{6}~\\bar{p}$~events/second is brought to rest in a hydrogen target producing $ K ^0 $ and $ $\\bar{K}^0 $ events through the reaction channels : \\\\ \\\\ \\begin{center} $\\bar{p}p~~~~~\\rightarrow~~~~K^0~+~(K^-\\pi^+$) \\\\ \\\\~~~~~~~~$\\rightarrow~~~~\\bar{K}^0~+~(K^+\\pi^-$) \\end{center}\\\\ \\\\The neutral strange particles and their antiparticles are tagged by detecting in the magnetic field the sign of the accompanying charged kaons identified via Cerenkovs and scintillators. The experiment has the unique feature that the decays from particles and antiparticles are recorded under the same operating conditions using tracking chambers and a gas sampling electromagnetic calorimeter. The measured time-dependent $ K ^0 $-$ $\\bar{K}^0 $ asymmetries for non-lepton...

  14. Semi-inclusive B->K(K*)X decays with initial bound state effects

    International Nuclear Information System (INIS)

    He, Xiao-Gang; Jin, Changhao; Ma, J. P.

    2001-01-01

    The effects of the initial b quark bound state for the semi-inclusive decays B->K(K * )X are studied using light cone expansion and heavy quark effective theory methods. We find that the initial bound state effects on the branching ratios and CP asymmetries are small. In the light cone expansion approach, the CP-averaged branching ratios are increased by about 2% with respect to the free b-quark decay. For {bar B} 0 ->K - (K *- )X, the CP-averaged branching ratios are sensitive to the phase γ and the CP asymmetry can be as large as 7% (14%), whereas for B - ->{bar K} 0 ({bar K} *0 )X the CP-averaged branching ratios are not sensitive to γ and the CP asymmetries are small ( -4 [(0.25 - 2.0)x10 -4 ] for {bar B} 0 ->K - (K *- )X and (0.77 - 0.84)x10 -4 [(0.67 - 0.74)x10 -4 ] for B - ->{bar K} 0 ({bar K} *0 )X, depending on the value of the CP violating phase γ. In the heavy quark effective theory approach, we find that the branching ratios are decreased by about 10% and the CP asymmetries are not affected. These predictions can be tested in the near future

  15. 33 CFR 67.01-10 - Delegation of functions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Delegation of functions. 67.01-10 Section 67.01-10 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY AIDS TO... Delegation of functions. The Coast Guard District Commander may delegate the authority for performing...

  16. 17 CFR 210.6A-01 - Application of §§ 210.6A-01 to 210.6A-05.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE ACT OF 1934, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Employee Stock Purchase... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Application of §§ 210.6A-01...

  17. Vitamins K2, K3 and K5 exert antitumor effects on established colorectal cancer in mice by inducing apoptotic death of tumor cells.

    Science.gov (United States)

    Ogawa, Mutsumi; Nakai, Seiji; Deguchi, Akihiro; Nonomura, Takako; Masaki, Tsutomu; Uchida, Naohito; Yoshiji, Hitoshi; Kuriyama, Shigeki

    2007-08-01

    Although a number of studies have shown that vitamin K possesses antitumor activities on various neoplastic cell lines, there are few reports demonstrating in vivo antitumor effects of vitamin K, and the antitumor effect on colorectal cancer (CRC) remains to be examined. Therefore, antitumor effects of vitamin K on CRC were examined both in vitro and in vivo. Vitamins K2, K3 and K5 suppressed the proliferation of colon 26 cells in a dose-dependent manner, while vitamin K1 did not. On flow cytometry, induction of apoptosis by vitamins K2, K3 and K5 was suggested by population in sub-G1 phase of the cell cycle. Hoechst 33342 staining and a two-color flow cytometric assay using fluorescein isothiocyanate-conjugated annexin V and propidium iodide confirmed that vitamins K2, K3 and K5 induced apoptotic death of colon 26 cells. Enzymatic activity of caspase-3 in colon 26 cells was significantly up-regulated by vitamins K2, K3 and K5. The pan-caspase inhibitor, benzyloxycarbonyl-Val-Ala-Asp-fluoromethyl ketone, substantially prevented vitamin K-mediated apoptosis. In vivo study using syngeneic mice with subcutaneously established colon 26 tumors demonstrated that intravenous administration of vitamins K2, K3 and K5 significantly suppressed the tumor growth. The number of apoptotic tumor cells was significantly larger in the vitamin K-treated groups than in the control group. These results suggest that vitamins K2, K3 and K5 exerted effective antitumor effects on CRC in vitro and in vivo by inducing caspase-dependent apoptotic death of tumor cells, suggesting that these K vitamins may be promising agents for the treatment of patients with CRC.

  18. Measurement of $CP$ violation and the $B_s^0$ meson decay width difference with $B_s^0 \\to J/\\psi K^+K^-$ and $B_s^0\\to J/\\psi\\pi^+\\pi^-$ decays

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lohn, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Mcnab, A; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-06-21

    The time-dependent $CP$ asymmetry in $B_s^0\\to J/\\psi K^+K^-$ decays is measured using $pp$ collision data at $\\sqrt{s}=7$TeV, corresponding to an integrated luminosity of 1.0$fb^{-1}$, collected with the LHCb detector. The decay time distribution is characterised by the decay widths $\\Gamma_{\\mathrm{L}}$ and $\\Gamma_{\\mathrm{H}}$ of the light and heavy mass eigenstates of the $B_s^0$--$\\overline{B}_s^0$ system and by a $CP$ -violating phase $\\phi_s$. In a sample of 27 617 $B_s^0\\to J/\\psi K^+K^-$ decays, where the dominant contribution comes from $B_s^0\\to J/\\psi\\phi$ decays, these parameters are measured to be \\[ \\begin{array}{ccllllllll} \\phi_s &\\;=\\; & 0.07 &\\pm & 0.09 & \\text{(stat)} &\\pm & 0.01 & \\text{(syst)} & \\text{rad},\\\\ \\Gamma_s \\equiv (\\Gamma_{\\mathrm{L}}+\\Gamma_{\\mathrm{H}})/2 &\\;=\\; & 0.663 &\\pm & 0.005 & \\text{(stat)} &\\pm & 0.006 & \\text{(syst)} & {\\mathrm ps}^{-1}, \\\\ \\Delta\\Gamma_{s} \\equiv \\Gamma_{\\ma...

  19. Measurement of the time-dependent CP asymmetry in B{sup 0}→J/ψK{sub S}{sup 0} decays

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adametz, A. [Physikalisches Institut, Ruprecht-Karls-Universität Heidelberg, Heidelberg (Germany); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Université, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Fédérale de Lausanne (EPFL), Lausanne (Switzerland); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); and others

    2013-04-10

    This Letter reports a measurement of the CP violation observables S{sub J/ψK{sub S{sup 0}}} and C{sub J/ψK{sub S{sup 0}}} in the decay channel B{sup 0}→J/ψK{sub S}{sup 0} performed with 1.0 fb{sup −1} of pp collisions at √(s)=7 TeV collected by the LHCb experiment. The fit to the data yields S{sub J/ψK{sub S{sup 0}}}=0.73±0.07(stat)±0.04(syst) and C{sub J/ψK{sub S{sup 0}}}=0.03±0.09(stat)±0.01(syst). Both values are consistent with the current world averages and within expectations from the Standard Model.

  20. 17 CFR 256.01-11 - Methods of allocation.

    Science.gov (United States)

    2010-04-01

    ... applicable and currently effective methods of allocation filed with the Commission. Both direct and allocated... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods of allocation. 256.01... HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-11 Methods of allocation. Indirect costs and...

  1. Thermoluminescence and glow curves analysis of γ-exposed Eu{sup 3+} doped K{sub 3}Y(PO{sub 4}){sub 2} nanophosphors

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Palvi; Bedyal, A.K. [School of Physics, Shri Mata Vaishno Devi University, Katra-182320, J& K (India); Kumar, Vinay, E-mail: vinaykdhiman@yahoo.com [School of Physics, Shri Mata Vaishno Devi University, Katra-182320, J& K (India); Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein 9300 (South Africa); Singh, Vivek K.; Khajuria, Y. [School of Physics, Shri Mata Vaishno Devi University, Katra-182320, J& K (India); Ntwaeaborwa, O.M.; Swart, H.C. [Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein 9300 (South Africa)

    2016-01-15

    Highlights: • First time, a detailed comparative study of the glow curves and kinetic parameters was made on K{sub 3}Y(PO{sub 4}){sub 2} nanophosphor. • Combustion method was employed to synthesize the Eu{sup 3+} doped K{sub 3}Y(PO{sub 4}){sub 2} nanophosphor. • The nanophosphor exhibited sublinear response suggesting that it is suitable for TL dosimetry. - Abstract: Eu{sup 3+} doped K{sub 3}Y(PO{sub 4}){sub 2} nanophosphor was synthesized by combustion synthesis using urea as a fuel. The crystal structure and particle morphology of the nanophosphor were investigated by using X-ray diffraction and transmission electron microscopy, respectively. A Thermoluminescence (TL) study was carried out after exposing the samples to gamma radiation. The TL glow curves exhibited a prominent peak at 407 K and a small hump at 478 K. The intensity of the peaks increased with the increase in the dose of the gamma rays (0.01–5 kGy). The K{sub 3}Y(PO{sub 4}){sub 2}: Eu{sup 3+} (2.5 mol%) nanophosphor exhibited sublinear TL response to γ-radiation over a wide range of gamma doses (0.01–5 kGy). The TLanal program was used to analyze the glow curves of the K{sub 3}Y(PO{sub 4}){sub 2} nanophosphor at different doses (0.2–5 kGy) and different heating rates (3–10 K/s). A comparative study was done for kinetic trapping parameters that were determined by the peak shape methods of Chen, Grossweiner and Lushchik. The frequency factors (s) for each glow peak were also calculated. The values of the activation energy (E) obtained by the TLanal program were in good agreement with those obtained by the peak shape methods. The effect of different amount of doses and different heating rates are discussed.

  2. The aligned K-center problem

    KAUST Repository

    Braß , Peter; Knauer, Christian; Na, Hyeonsuk; Shin, Chansu; Vigneron, Antoine E.

    2011-01-01

    running time O(n4 log2 n). Then we present (1+ε)-approximation algorithms for these three problems. When we denote T(k, ε) = (k/ε2+(k/ε) log k) log(1/ε), these algorithms run in O(n log k + T(k, ε)) time, O(n log k + T(k, ε)/ε) time, and O(n log k + T(k, ε

  3. Measurement of K{sup *{+-}}(892) production in deep inelastic ep scattering with the H1 detector at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Sunar, Deniz

    2009-07-15

    A first measurement is presented of K{sup *}(892){sup {+-}} vector mesons, observed through the decay chain K{sup *}(892){sup {+-}} {yields} K{sup 0}{sub S}{pi}{sup {+-}} {yields} {pi}{sup +}{pi}{sup -}{pi}{sup {+-}}; in neutral current deep-inelastic ep scattering. The data were taken at the HERA collider in the years 2005.2007 with centre of mass energy {radical}(s)=319 GeV using the H1 detector and correspond to an integrated luminosity of approximately 302 pb{sup -1}. The measurement of differential cross section was performed in the kinematic range which covers the photon virtuality 50:1 K{sup *{+-}} vector meson is restricted in transverse momentum p{sub T}(K{sup *{+-}})>1 GeV and pseudorapidity -1.5<{eta}(K{sup *{+-}})<1.5. The results are compared to predictions of leading order Monte Carlo models matched with the parton showers. Persbericht (orig.)

  4. Y2K

    OpenAIRE

    Stephanie Schmitt-Grohe; Martin Uribe

    1999-01-01

    This paper studies, within a general equilibrium model, the dynamics of Y2K-type shocks: anticipated, permanent losses in output whose magnitude can be lessened by investing resources in advance. The implied dynamics replicate three observed characteristics of those triggered by the Y2K bug: (1) Precautionary investment: investment in solving the Y2K problem begins before the year 2000; (2) Investment delay: although economic agents have been aware of the Y2K problem since the 1960s, investme...

  5. k-visit Attribute Grammars

    DEFF Research Database (Denmark)

    Nielson, Hanne Riis; Skyum, S.

    1981-01-01

    It is shown that any well-defined attribute grammar is k-visit for some k. Furthermore, it is shown that given a well-defined grammar G and an integer k, it is decidable whether G is k-visit. Finally it is shown that the k-visit grammars specify a proper hierarchy with respect to translations...

  6. Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes II. experimental determination

    DEFF Research Database (Denmark)

    Chatzichristodoulou, Christodoulos; Søgaard, Martin; Glasscock, Julie

    2011-01-01

    Thin (∼30 m), dense Ce0.9Gd0.1O1.95- (CGO10) membranes (5 5 cm2+) supported on a porous NiO/YSZ substrate were fabricated by tape casting, wet powder spraying and lamination. A La 0.58Sr0.4Co0.2Fe0.8O 3-δ/Ce0.9Gd0.1O1.95- (LSCF/CGO10) composite cathode was applied by screen printing. Oxygen...... compartment. The performance of the membrane was also investigated under varying CH 4 and H2O gas mixtures at 1106 K. The oxygen flux increased with decreasing steam to carbon ratio and was found to exceed 10 N mL min-1 cm-2 of O2 for steam to carbon ratios below 4:3. Post-test analysis of the tested membrane...

  7. Exchange bias training effect in phase separated polycrystalline Sm{sub 0.1}Ca{sub 0.7}Sr{sub 0.2}MnO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Markovich, V., E-mail: markoviv@bgu.ac.il [Department of Physics, Ben-Gurion University of the Negev, 84105, Beer-Sheva (Israel); Fita, I.; Wisniewski, A.; Puzniak, R. [Institute of Physics, Polish Academy of Sciences, Aleja Lotnikow 32/46, 02-668, Warsaw (Poland); Martin, C. [Laboratoire CRISMAT, UMR 6508, ISMRA, 14050, Caen Cedex (France); Jung, G. [Department of Physics, Ben-Gurion University of the Negev, 84105, Beer-Sheva (Israel); Institute of Physics, Polish Academy of Sciences, Aleja Lotnikow 32/46, 02-668, Warsaw (Poland); Gorodetsky, G. [Department of Physics, Ben-Gurion University of the Negev, 84105, Beer-Sheva (Israel)

    2016-12-01

    Magnetic properties of antiferromagnetic (AFM) electron doped manganite Sm{sub 0.1}Ca{sub 0.7}Sr{sub 0.2}MnO{sub 3} have been investigated, focusing mainly on the exchange bias (EB) effect and associated training effect. The studied compound exhibits the ground state with heterogeneous spin configuration, consisting of the C-type antiferromagnetic phase with the Néel temperature T{sub N-C} ≈ 120 K, the G-AFM phase with the Néel temperature T{sub N-G} ≈ 60 K, and ferromagnetic-like phase with a very weak spontaneous magnetic moment. Measurements of hysteresis loops have shown that the exchange bias field monotonously decreases with increasing temperature and vanishes above 40 K, while the coercivity disappears only above 70 K. The temperature variation of the exchange bias field has been successfully described by an exponential decay form. The stability of EB has been evaluated in the studies of the training effect, which has been discussed in the frame of the spin relaxation model, elucidating the important role of the AFM domain rearrangement at the interface. The complex phase separation and possible contributions from different interfaces between coexisting magnetic phases to the EB effect have also been discussed. - Highlights: • Sm{sub 0.1}Ca{sub 0.7}Sr{sub 0.2}MnO{sub 3} exhibits exchange bias (EB) effect at low temperatures T < 40 K. • The EB effect is associated with the phase separation and the presence of FM clusters as well as the G- and C-type AFM phases. • The training effect (TE) has been discussed in the frame of the spin relaxation model. • The TE is relatively small, indicating that AFM moment configuration is almost frozen during the magnetization reversal.

  8. Q(n) species distribution in K2O.2SiO2 glass by 29Si magic angle flipping NMR.

    Science.gov (United States)

    Davis, Michael C; Kaseman, Derrick C; Parvani, Sahar M; Sanders, Kevin J; Grandinetti, Philip J; Massiot, Dominique; Florian, Pierre

    2010-05-06

    Two-dimensional magic angle flipping (MAF) was employed to measure the Q((n)) distribution in a (29)Si-enriched potassium disilicate glass (K(2)O.2SiO(2)). Relative concentrations of [Q((4))] = 7.2 +/- 0.3%, [Q((3))] = 82.9 +/- 0.1%, and [Q((2))] = 9.8 +/- 0.6% were obtained. Using the thermodynamic model for Q((n)) species disproportionation, these relative concentrations yield an equilibrium constant k(3) = 0.0103 +/- 0.0008, indicating, as expected, that the Q((n)) species distribution is close to binary in the potassium disilicate glass. A Gaussian distribution of isotropic chemical shifts was observed for each Q((n)) species with mean values of -82.74 +/- 0.03, -91.32 +/- 0.01, and -101.67 +/- 0.02 ppm and standard deviations of 3.27 +/- 0.03, 4.19 +/- 0.01, and 5.09 +/- 0.03 ppm for Q((2)), Q((3)), and Q((4)), respectively. Additionally, nuclear shielding anisotropy values of zeta =-85.0 +/- 1.3 ppm, eta = 0.48 +/- 0.02 for Q((2)) and zeta = -74.9 +/- 0.2 ppm, eta = 0.03 +/- 0.01 for Q((3)) were observed in the potassium disilicate glass.

  9. K B Shaik

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...

  10. Characterization of a novel HLA-B*39:01:01-related allele, HLA-B*39:130, by cloning and phasing.

    Science.gov (United States)

    Li, L X; Tian, W; Zhu, F M; Wang, W Y; Cai, J H

    2017-12-01

    A novel HLA-B*39:01:01-related variant, HLA-B*39:130, has been identified in a normal individual of Han ethnicity in Hunan province, southern China. Following Sanger polymerase chain reaction-sequence-based typing (PCR-SBT), this new allele was further confirmed by cloning, phasing and sequencing. Aligned with HLA-B*39:01:01, HLA-B*39:130 has a nonsynonymous thymine substitution at nucleotide position 94 in exon 4, resulting in amino acid change from threonine to isoleucine at codon 214 (ACA→ATA) of the mature HLA-BmRNA molecule. © 2017 John Wiley & Sons Ltd.

  11. ATHENA X-IFU 300 K-50 mK cryochain demonstrator cryostat

    Science.gov (United States)

    Prouvé, T.; Duval, J. M.; Charles, I.; Yamasaki, N. Y.; Mitsuda, K.; Nakagawa, T.; Shinozaki, K.; Tokoku, C.; Yamamoto, R.; Minami, Y.; Le Du, M.; Andre, J.; Daniel, C.; Linder, M.

    2018-01-01

    In the framework of the ESA X-ray mission ATHENA, scheduled for launch in 2028, an ESA Core Technology Program (CTP) was started in 2016 to build a flight like cryostat demonstrator in parallel with the phase A studies of the ATHENA/X-IFU instrument [1,2]. As part of this CTP, called the Detector Cooling System (DCS), design, manufacturing and test of a cryostat including existing space coolers will be done. In addition to the validation of thermal performance, a Focal Plan Assembly (FPA) demonstrator using Transition Edge Sensors (TES) detector technology will be also integrated and its performance characterized versus the environment provided by the cryostat. This is a unique opportunity to validate many crucial issues of the cryogenic part of such a sensitive instrument. A dedicated activity within this CTP-DCS is the demonstration of the 300 K-50 mK cooling chain in a Ground System Equipment (GSE) cryostat. The studies are focused on the operation of the space coolers, which is made possible by the use of a ground cooler for cooling cryogenic shields and mechanical supports. Thanks to the modularity of the cryostat, several cooling chains could be tested. In the base line configuration described here, the low temperature stage is the CEA hybrid sorption/ADR 50 mK cooler with thermal interfaces at 4 K and 2 K. 4 K cooling is accomplished by a 4 K Joule-Thomson (JT) cryocooler and its Stirling precooler provided by JAXA. Regarding the 2 K stage, at first a 2 K JT from JAXA will be used. Alternatively, a 2 K JT cooler from RAL could replace the JAXA 2 K JT. In both cases new prototype(s) of a 2 K JT will be implemented, precooled by the EM 15 K pule tube cooler from Air Liquide. This test program is also the opportunity to validate the operation of the cryochain with respect to various requirements, such as time constant and temperature stabilities. This would bring us valuable inputs to integrate the cryochain in DCS cryostat or for the X-IFU phase A studies

  12. Study of $\\pi^{-}p$ Interactions at 85 GeV/c Leading to $K^{+}K^{+}K$^{-}K^{-}$ in the Final State - Search for New States

    CERN Multimedia

    2002-01-01

    The aim of this experiment is to study the properties of 2K|+2K|- systems and to search for new states produced centrally in the @p|-p collisions at 85 GeV/c. The experiment makes use of the high data rate capability of the upgraded @W' MWPC system and the large forward acceptance of the two hodoscoping Cerenkov counters. \\\\ \\\\ A sample of 20 M events was recorded using a selective trigger on 4 charged kaons with X~@$>$~0. Amongst the topics to be explored are : \\item a) Study of the @F@F(C=+1) and @F@F@p@+ mass spectrum including a search for the n^c; \\item b) Search for gluonium states decaying to K|+K|-, @F@F, @Ff', f'f'; \\item c) Study of @F production as a function of (X(F), p^t) and whether it prefers to be produced singly or in association with another @F; \\item d) Study of the KK@p, and KK@p@p systems including (i) a search for low-lying crypto exotic mesons (usds) predicted to decay to K|+K|-@p@+ or @F@p@+; (ii) a search for charmed-strange exotic mesons (udcs) predicted to decay into two kaons of th...

  13. Measurement of the effective $B^0_s \\rightarrow K^+K^-$ lifetime

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Conti, G; Contu, A; Cook, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; d'Enterria, D G; Esperante Pereira, D; Estève, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Koppenburg, P; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefévre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martin Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Nies, S; Niess, V; Nikitin, N; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilar, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; du Pree, T; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skottowe, H P; Skwarnicki, T; Smith, A C; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Styles, N; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Torr, N; Tournefier, E; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A

    2012-01-01

    A measurement of the effective $B^0_s \\rightarrow K^+K^-$ lifetime is presented using approximately $37 pb^{-1}$ of data collected by LHCb during 2010. This quantity can be used to put constraints on contributions from processes beyond the Standard Model in the $B_s$ meson system and is determined by two complementary approaches as $\\tau_{B_s\\to K^+K^-} = 1.440 \\pm 0.096 (stat) \\pm 0.008 (syst) \\pm 0.003 (model) ps$.

  14. Molecular detection of HIV-1 subtype B, CRF01_AE, CRF33_01B, and newly emerging recombinant lineages in Malaysia.

    Science.gov (United States)

    Chook, Jack Bee; Ong, Lai Yee; Takebe, Yutaka; Chan, Kok Gan; Choo, Martin; Kamarulzaman, Adeeba; Tee, Kok Keng

    2015-03-01

    A molecular genotyping assay for human immunodeficiency virus type 1 (HIV-1) circulating in Southeast Asia is difficult to design because of the high level of genetic diversity. We developed a multiplex real-time polymerase chain reaction (PCR) assay to detect subtype B, CRF01_AE, CRF33_01B, and three newly described circulating recombinant forms, (CRFs) (CRF53_01B, CRF54_01B, and CRF58_01B). A total of 785 reference genomes were used for subtype-specific primers and TaqMan probes design targeting the gag, pol, and env genes. The performance of this assay was compared and evaluated with direct sequencing and phylogenetic analysis. A total of 180 HIV-infected subjects from Kuala Lumpur, Malaysia were screened and 171 samples were successfully genotyped, in agreement with the phylogenetic data. The HIV-1 genotype distribution was as follows: subtype B (16.7%); CRF01_AE (52.8%); CRF33_01B (24.4%); CRF53_01B (1.1%); CRF54_01B (0.6%); and CRF01_AE/B unique recombinant forms (4.4%). The overall accuracy of the genotyping assay was over 95.0%, in which the sensitivities for subtype B, CRF01_AE, and CRF33_01B detection were 100%, 100%, and 97.7%, respectively. The specificity of genotyping was 100%, inter-subtype specificities were > 95% and the limit of detection of 10(3) copies/mL for plasma. The newly developed real-time PCR assay offers a rapid and cost-effective alternative for large-scale molecular epidemiological surveillance for HIV-1. © The American Society of Tropical Medicine and Hygiene.

  15. Coupled channel analysis of s-wave ππ and K anti-K photoproduction

    International Nuclear Information System (INIS)

    Chueng-Ryong Ji; Szczepaniak, A.; Kaminski, R.; Lesniak, L.; Williams, R.

    1997-10-01

    We present a coupled channel partial wave analysis of non-diffractive S-wave π + π - and K + K - photoproduction focusing on the K anti-K threshold. Final state interactions are included. We calculate total cross sections, angular and effective mass distributions in both ππ and K anti-K channels. Our results indicate that these processes are experimentally measurable and valuable information on the f 0 (980) resonance structure can be obtained. (author)

  16. Test of the non separability of the K0anti K0 system

    International Nuclear Information System (INIS)

    Six, J.

    1984-01-01

    At present there is no experimental verification that the K 0 anti K 0 system remains a non-separate system when the particles fly apart. Furry's hypothesis may be considered as an example. An experimental test of this non-separability requires producing K 0 and anti K 0 interactions. It is shown that this is feasible for the annihilation panti p → K 0 anti K 0 with the CERN LEAR facility. (Auth.)

  17. Measurement of the decays B->phi K and B->phi K*

    Energy Technology Data Exchange (ETDEWEB)

    MacFarlane, David B

    2001-07-25

    The authors have observed the decays B {yields} {phi}K and {phi} K* in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are {beta}(B{sup +} {yields} {phi}K{sup +}) = (7.7{sub -1.4}{sup +1.6} {+-} 0.8) x 10{sup -6}, {Beta}(B{sup 0} {yields} {phi}K{sup 0}) = (8.1{sub -2.5}{sup + 3.1} {+-} 0.8) x 10{sup -6}, {Beta}(B{sup +} {yields} {phi}K*{sup +}) = (9.7{sub -3.4}{sup +4.2} {+-} 1.7) x 10{sup -6}, and {Beta}(B{sup 0} {yields} {phi}K*{sup 0}) = (8.6 {sub -2.4}{sup +2.8} {+-} 1.1) x 10{sup -6}. We also report the upper limit {Beta}(B{sup +} {yields} {phi}{pi}{sup +}) < 1.4 s 10{sup -6} (90% CL).

  18. K-n and K-p elastic scattering in K-d collisions from 1.2 to 2.2 GeV/c

    International Nuclear Information System (INIS)

    Declais, Y.; Duchon, J.; Louvel, M.; Patry, J.-P.; Seguinot, J.; Baillon, P.; Bruman, C.; Ferro-Luzzi, M.; Perreau, J.-M.; Ypsilantis, T.

    1977-01-01

    This report contains the detailed description of an experiment which has determined the differential cross section of the K - n→K - n elastic scattering reaction. The results are 12 angular distributions spanning the K - n c.m. energy interval from approximately 1.86 to approximately 2.32 GeV. The measurements have been performed at the CERN PS using a beam of negative kaons with momenta from 1.2 to 2.2 GeV/c incident on a liquid deuterium target. By means of electronic apparatus the process K - d→K - n psub(s) was identified and recorded; this process is basically the same as the K - n elastic reaction insofar as the spectator proton psub(s) has low momentum. The elastic reaction was derived from the above process by taking into account the Fermi motion of the target neutron and by introducing the appropriate corrections to compensate for the effects due to the composite nature of the neutron (double-scattering, final state interaction). These results, constituting the first extensive collection of data on the pure isospin 1 anti KN state have been used in conjunction with other data in a preliminary partial wave analysis of the anti KN elastic system over the c.m. energy range from 1.84 to 2.23 GeV. Mainly for testing purposes, a similar amount of data has been collected for the K - p elastic reaction also from K - d collisions (K - d→K - p nsub(s)). (Auth.)

  19. Effects of cortisol and salinity acclimation on Na+/K+/2Cl–- cotransporter gene expression and Na+, K+-ATPase activity in the gill of Persian sturgeon, Acipenser persicus, fry

    Directory of Open Access Journals (Sweden)

    Saber Khodabandeh

    2009-10-01

    Full Text Available Na+, K+-ATPase activity and Na+/K+/2Cl–- cotransporter (NKCC gene expression in the gills of Persian sturgeon, Acipenser persicus, fry (2-3 g, 3.30-8.12 cm total body length in freshwater (control group, diluted Caspian Sea water (5 ppt and after treatment with cortisol in freshwater were studied. Na+, K+-ATPase activity was lower in the 5 ppt-acclimated fish (1.07±0.05 _mol Pi/mg protein/h than in the control fish (1.19±0.05 μmol Pi/mg protein/h but this difference was not significant. nKCC gene expression in the 5 ppt-acclimated fish (1.6±0.07 was significantly higher than in the control fish (0.8±0.00. In the cortisol treated fish, Na+, K+-ATPase activity (1.91±0.05 μmol Pi/mg protein/h and NKCC gene expression (3.2±0.1 were significantly higher than in the control group. our results show that Persian sturgeon fry (2-3 g can tolerate 5 ppt salinity by changing their enzymatic content and activity, and that exogenous cortisol application can increase the osmoregulatory capacity of fry before release into brackish water and can reduce their mortality.

  20. D K Banerjee

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. D K Banerjee. Articles written in Resonance – Journal of Science Education. Volume 18 Issue 2 February 2013 pp 188-193 Classics. On the Stereoselective Synthesis of Oestrone · D K Banerjee K M Sivanandaiah · More Details Fulltext PDF ...

  1. 33 CFR 144.01-30 - First-aid kit.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false First-aid kit. 144.01-30 Section...) OUTER CONTINENTAL SHELF ACTIVITIES LIFESAVING APPLIANCES Manned Platforms § 144.01-30 First-aid kit. On each manned platform a first-aid kit approved by the Commandant or the U.S. Bureau of Mines shall be...

  2. 17 CFR 210.3A-01 - Application of § 210.3A-01 to § 210.3A-05.

    Science.gov (United States)

    2010-04-01

    ... Financial Statements § 210.3A-01 Application of § 210.3A-01 to § 210.3A-05. Sections 210.3A-01 to 210.3A-05 shall govern the presentation of consolidated and combined financial statements. [44 FR 19386, Apr. 3... COMMISSION FORM AND CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES...

  3. Vitamin K

    Science.gov (United States)

    ... seem to benefit older women who still have strong bones. Taking vitamin K1 seems to increase bone strength and might prevent fractures in older women. But it might not work as well in older men. Vitamin K1 doesn't seem to improve bone ...

  4. Enhancement of thermoelectric efficiency of CoSb3-based skutterudites by double filling with K and Tl

    Directory of Open Access Journals (Sweden)

    Ken eKurosaki

    2014-10-01

    Full Text Available The high-temperature thermoelectric properties of thallium (Tl and potassium (K double-filled cobalt antimonide (CoSb3-based skutterudites with nominal compositions TlxK0.3Co4Sb12 (x = 0.1–0.3 were investigated. The filling fraction of Tl in CoSb3 was enhanced by co-filling with K, which resulted in all of the samples showing the filled-skutterudite single phase. Owing to the high filling ratio, the carrier concentration in the sample with x = 0.3 was as high as 4.3 × 1020 cm−3 at room temperature. Furthermore, quite low lattice thermal conductivity (as low as 0.9 W m−1 K−1 was obtained for the sample with x = 0.3, probably because of strong phonon scattering by the Tl and K co-rattling effect, which resulted in a maximum zT of around one at 773 K.

  5. Measurement of the CKM angle $\\gamma$ using $B^\\pm \\to D K^\\pm$ with $D \\to K^0_{\\rm S} \\pi^+\\pi^-, K^0_{\\rm S} K^+ K^-$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-10-16

    A binned Dalitz plot analysis of $B^\\pm \\to D K^\\pm$ decays, with $D \\to K^0_{\\rm S} \\pi^+\\pi^-$ and $D \\to K^0_{\\rm S} K^+ K^-$, is performed to measure the $C\\!P$-violating observables $x_{\\pm}$ and $y_{\\pm}$, which are sensitive to the Cabibbo-Kobayashi-Maskawa angle $\\gamma$. The analysis exploits a sample of proton-proton collision data corresponding to 3.0 fb$^{-1}$ collected by the LHCb experiment. Measurements from CLEO-c of the variation of the strong-interaction phase of the $D$ decay over the Dalitz plot are used as inputs. The values of the parameters are found to be $x_+ = ( -7.7 \\pm 2.4 \\pm 1.0 \\pm 0.4 )\\times 10^{-2}$, $x_- = (2.5 \\pm 2.5 \\pm 1.0 \\pm 0.5) \\times 10^{-2}$, $y_+ = (-2.2 \\pm 2.5 \\pm 0.4 \\pm 1.0)\\times 10^{-2}$, and $y_- = (7.5 \\pm 2.9 \\pm 0.5 \\pm 1.4) \\times 10^{-2}$. The first, second, and third uncertainties are the statistical, the experimental systematic, and that associated with the precision of the strong-phase parameters. These are the most precise measurements of these obs...

  6. Y2K

    OpenAIRE

    Schmitt-Grohe, Stephanie; Uribe, Martin

    1998-01-01

    As the millennium draws to an end, the threat posed by the Year 2000 (Y2K) problem is inducing vast private and public spending on its remediation. In this paper, we model the Y2K problem as an anticipated, permanent loss in output whose magnitude can be lessened by investing resources in advance. We embed the Y2K problem into a dynamic general equilibrium framework and show that our model replicates three observed characteristics of the dynamics triggered by the Y2K bug: (1) Precautionary in...

  7. The moyamoya disease susceptibility variant RNF213 R4810K (rs112735431) induces genomic instability by mitotic abnormality

    Energy Technology Data Exchange (ETDEWEB)

    Hitomi, Toshiaki [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Habu, Toshiyuki [Radiation Biology Center, Kyoto University, Kyoto (Japan); Kobayashi, Hatasu; Okuda, Hiroko; Harada, Kouji H. [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Osafune, Kenji [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Taura, Daisuke; Sone, Masakatsu [Department of Medicine and Clinical Science, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Asaka, Isao; Ameku, Tomonaga; Watanabe, Akira; Kasahara, Tomoko; Sudo, Tomomi; Shiota, Fumihiko [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Hashikata, Hirokuni; Takagi, Yasushi [Department of Neurosurgery, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Morito, Daisuke [Faculty of Life Sciences, Kyoto Sangyo University, Kyoto (Japan); Miyamoto, Susumu [Department of Neurosurgery, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Nakao, Kazuwa [Department of Medicine and Clinical Science, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Koizumi, Akio, E-mail: koizumi.akio.5v@kyoto-u.ac.jp [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan)

    2013-10-04

    Highlights: •Overexpression of RNF213 R4810K inhibited cell proliferation. •Overexpression of RNF213 R4810K had the time of mitosis 4-fold and mitotic failure. •R4810K formed a complex with MAD2 more readily than wild-type. •iPSECs from the MMD patients had elevated mitotic failure compared from the control. •RNF213 R4810K induced mitotic abnormality and increased risk of aneuploidy. -- Abstract: Moyamoya disease (MMD) is a cerebrovascular disease characterized by occlusive lesions in the Circle of Willis. The RNF213 R4810K polymorphism increases susceptibility to MMD. In the present study, we characterized phenotypes caused by overexpression of RNF213 wild type and R4810K variant in the cell cycle to investigate the mechanism of proliferation inhibition. Overexpression of RNF213 R4810K in HeLa cells inhibited cell proliferation and extended the time of mitosis 4-fold. Ablation of spindle checkpoint by depletion of mitotic arrest deficiency 2 (MAD2) did not shorten the time of mitosis. Mitotic morphology in HeLa cells revealed that MAD2 colocalized with RNF213 R4810K. Immunoprecipitation revealed an RNF213/MAD2 complex: R4810K formed a complex with MAD2 more readily than RNF213 wild-type. Desynchronized localization of MAD2 was observed more frequently during mitosis in fibroblasts from patients (n = 3, 61.0 ± 8.2%) compared with wild-type subjects (n = 6, 13.1 ± 7.7%; p < 0.01). Aneuploidy was observed more frequently in fibroblasts (p < 0.01) and induced pluripotent stem cells (iPSCs) (p < 0.03) from patients than from wild-type subjects. Vascular endothelial cells differentiated from iPSCs (iPSECs) of patients and an unaffected carrier had a longer time from prometaphase to metaphase than those from controls (p < 0.05). iPSECs from the patients and unaffected carrier had significantly increased mitotic failure rates compared with controls (p < 0.05). Thus, RNF213 R4810K induced mitotic abnormalities and increased risk of genomic instability.

  8. The moyamoya disease susceptibility variant RNF213 R4810K (rs112735431) induces genomic instability by mitotic abnormality

    International Nuclear Information System (INIS)

    Hitomi, Toshiaki; Habu, Toshiyuki; Kobayashi, Hatasu; Okuda, Hiroko; Harada, Kouji H.; Osafune, Kenji; Taura, Daisuke; Sone, Masakatsu; Asaka, Isao; Ameku, Tomonaga; Watanabe, Akira; Kasahara, Tomoko; Sudo, Tomomi; Shiota, Fumihiko; Hashikata, Hirokuni; Takagi, Yasushi; Morito, Daisuke; Miyamoto, Susumu; Nakao, Kazuwa; Koizumi, Akio

    2013-01-01

    Highlights: •Overexpression of RNF213 R4810K inhibited cell proliferation. •Overexpression of RNF213 R4810K had the time of mitosis 4-fold and mitotic failure. •R4810K formed a complex with MAD2 more readily than wild-type. •iPSECs from the MMD patients had elevated mitotic failure compared from the control. •RNF213 R4810K induced mitotic abnormality and increased risk of aneuploidy. -- Abstract: Moyamoya disease (MMD) is a cerebrovascular disease characterized by occlusive lesions in the Circle of Willis. The RNF213 R4810K polymorphism increases susceptibility to MMD. In the present study, we characterized phenotypes caused by overexpression of RNF213 wild type and R4810K variant in the cell cycle to investigate the mechanism of proliferation inhibition. Overexpression of RNF213 R4810K in HeLa cells inhibited cell proliferation and extended the time of mitosis 4-fold. Ablation of spindle checkpoint by depletion of mitotic arrest deficiency 2 (MAD2) did not shorten the time of mitosis. Mitotic morphology in HeLa cells revealed that MAD2 colocalized with RNF213 R4810K. Immunoprecipitation revealed an RNF213/MAD2 complex: R4810K formed a complex with MAD2 more readily than RNF213 wild-type. Desynchronized localization of MAD2 was observed more frequently during mitosis in fibroblasts from patients (n = 3, 61.0 ± 8.2%) compared with wild-type subjects (n = 6, 13.1 ± 7.7%; p < 0.01). Aneuploidy was observed more frequently in fibroblasts (p < 0.01) and induced pluripotent stem cells (iPSCs) (p < 0.03) from patients than from wild-type subjects. Vascular endothelial cells differentiated from iPSCs (iPSECs) of patients and an unaffected carrier had a longer time from prometaphase to metaphase than those from controls (p < 0.05). iPSECs from the patients and unaffected carrier had significantly increased mitotic failure rates compared with controls (p < 0.05). Thus, RNF213 R4810K induced mitotic abnormalities and increased risk of genomic instability

  9. On k-Gamma and k-Beta Distributions and Moment Generating Functions

    Directory of Open Access Journals (Sweden)

    Gauhar Rahman

    2014-01-01

    Full Text Available The main objective of the present paper is to define k-gamma and k-beta distributions and moments generating function for the said distributions in terms of a new parameter k>0. Also, the authors prove some properties of these newly defined distributions.

  10. Impedance and magnetoelectric characteristics of (1 - x)BaTiO3- xLa0.7Sr0.3MnO3 ( x = 0.1 and 0.3) nano-composites

    Science.gov (United States)

    Nayek, C.; Murugavel, P.; Dinesh Kumar, S.; Subramanian, V.

    2015-08-01

    We have synthesized the phase-pure (1 - x)BaTiO3- xLa0.7Sr0.3MnO3 ( x = 0.1 and 0.3) magnetoelectric composites without interdiffusion among the existing phases. The magnetic measurements revealed an anomaly at the ferroelectric Curie temperature (393 K) of BaTiO3, and the dielectric data revealed an anomaly at the ferromagnetic transition temperature (360 K) of La0.7Sr0.3MnO3 ascertaining the magnetoelectric coupling in the composite. Impedance analysis indicated dipolar polarization contributions to the dielectric spectrum with two non-Debye-type relaxations. Both the grain and grain boundary contributions were present in the system with dominant grain boundary effect in all the composites. The composites show semiconducting behavior with the barrier hopping-type conducting mechanism. To avoid the free charge carrier and the space charge contributions, the magnetoelectric response was measured at high frequency range. The maximum values of magnetoelectric voltage coefficient measured at 100 kHz were 221 and 219 mV/Oe-cm for x = 0.1 and 0.3 samples, respectively.

  11. V K Agrawal

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. V K Agrawal. Articles written in Bulletin of Materials Science. Volume 33 Issue 4 August 2010 pp 383-390 Electrical Properties. Temperature dependence of electromechanical properties of PLZT /57/43 ceramics · A K Shukla V K Agrawal I M L Das Janardan Singh S L ...

  12. Quantum k-Poincare 1994

    International Nuclear Information System (INIS)

    Lukierski, J.; Ruegg, H.; Tolstoy, V.N.

    1994-08-01

    After a description of three distinguished bases proposed for k-Poincare algebra, the representations of the k-deformed Poincare algebra as differential operators acting on the functions of commuting moments are considered. Further, the duality between the k-Poincare algebra U n (P 4 ) and the quantum Poincare group P k is discussed. The recent developments of the k-deformed formalism are presented in conclusion. 51 refs

  13. Bulanık Enformasyon

    Directory of Open Access Journals (Sweden)

    İsmail TOK

    2009-04-01

    Full Text Available Bu çalışmada ilk olarak, bulanık olasılık uzayının bazı temel özellikleri detaya ve ispatlara girilmeksizin incelenmektedir. Daha sonra, kararsızlık ve bulanık enformasyon tanımları veriliyor. Son olarak da, bulanık enformasyonun bazı özellikler ispatlanıyor.

  14. K Girigowda

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K Girigowda. Articles written in Resonance – Journal of Science Education. Volume 10 Issue 11 November 2005 pp 79-84 Classroom. Loading Effects on Resolution in Thin Layer Chromatography and Paper Chromatography · K Girigowda V H Mulimani.

  15. Assembly and Test of SQ01b, a Nb3Sn Quadrupole Magnet for the LHC Accelerator Research Program

    International Nuclear Information System (INIS)

    Ferracin, P.; Ambrosio, G.; Bartlett, S. E.; Bordini, B.; Carcagno, R.H.; Caspi, S.; Dietderich, D.R.; Feher, S.; Gourlay, S.A.; Hafalia, A.R.; Lamm, M.J.; Lietzke, A.F.; Mattafirri, S.; McInturff, A.D.; Orris, D.F.; Pischalnikov, Y.M.; Sabbi, G.L.; Sylvester, C.D.; Tartaglia, M.A.; Velev, G.V.; Zlobin, A.V.; Kashikhin, V.V.

    2006-01-01

    The US LHC Accelerator Research Program (LARP) consists of four US laboratories (BNL, FNAL, LBNL, and SLAC) collaborating with CERN to achieve a successful commissioning of the LHC and to develop the next generation of Interaction Region magnets. In 2004, a large aperture Nb 3 Sn racetrack quadrupole magnet (SQ01) has been fabricated and tested at LBNL. The magnet utilized four subscale racetrack coils and was instrumented with strain gauges on the support structure and directly over the coil's turns. SQ01 exhibited training quenches in two of the four coils and reached a peak field in the conductor of 10.4 T at a current of 10.6 kA. After the test, the magnet was disassembled, inspected with pressure indicating films, and reassembled with minor modifications. A second test (SQ01b) was performed at FNAL and included training studies, strain gauge measurements and magnetic measurements. Magnet inspection, test results, and magnetic measurements are reported and discussed, and a comparison between strain gauge measurements and 3D finite element computations is presented

  16. Assembly and Test of SQ01b, a Nb3Sn Quadrupole Magnet for the LHC Accelerator Research Program

    Energy Technology Data Exchange (ETDEWEB)

    Ferracin, P.; Ambrosio, G.; Bartlett, S. E.; Bordini, B.; Carcagno, R.H.; Caspi, S.; Dietderich, D.R.; Feher, S.; Gourlay, S.A.; Hafalia, A.R.; Lamm, M.J.; Lietzke, A.F.; Mattafirri, S.; McInturff, A.D.; Orris, D.F.; Pischalnikov, Y.M.; Sabbi, G.L.; Sylvester, C.D.; Tartaglia, M.A.; Velev, G.V.; Zlobin, A.V.; Kashikhin, V.V.

    2006-06-01

    The US LHC Accelerator Research Program (LARP) consists of four US laboratories (BNL, FNAL, LBNL, and SLAC) collaborating with CERN to achieve a successful commissioning of the LHC and to develop the next generation of Interaction Region magnets. In 2004, a large aperture Nb{sub 3}Sn racetrack quadrupole magnet (SQ01) has been fabricated and tested at LBNL. The magnet utilized four subscale racetrack coils and was instrumented with strain gauges on the support structure and directly over the coil's turns. SQ01 exhibited training quenches in two of the four coils and reached a peak field in the conductor of 10.4 T at a current of 10.6 kA. After the test, the magnet was disassembled, inspected with pressure indicating films, and reassembled with minor modifications. A second test (SQ01b) was performed at FNAL and included training studies, strain gauge measurements and magnetic measurements. Magnet inspection, test results, and magnetic measurements are reported and discussed, and a comparison between strain gauge measurements and 3D finite element computations is presented

  17. Mozart k.545 mimics mozart k.448 in reducing epileptiform discharges in epileptic children.

    Science.gov (United States)

    Lin, Lung-Chang; Lee, Mei-Wen; Wei, Ruey-Chang; Mok, Hin-Kiu; Wu, Hui-Chuan; Tsai, Chin-Lin; Yang, Rei-Cheng

    2012-01-01

    Mozart K.448 has been shown to improve cognitive function, leading to what is known as the Mozart Effect. Our previous work reveals positive effects of Mozart K.448 in reducing epileptiform discharges in epileptic children. In this study, we evaluated the effect of Mozart K.545 and compared the effects with those of Mozart K.448 on epileptiform discharges in children with epilepsy. Thirty-nine epileptic children with epileptiform discharges were included in the study. They received electroencephalogram examinations before, during, and after listening to Mozart K.448 and K.545, one week apart, respectively. The frequencies of epileptiform discharges were compared. There was a significant decrease in the frequency of epileptiform discharges during and right after listening to Mozart K.448 and K.545 (reduced by 35.7 ± 32.7% during Mozart K.448 and 30.3 ± 44.4% after Mozart K.448; and 34.0 ± 39.5% during Mozart K.545 and 31.8 ± 39.2% after Mozart K.545). Spectrogrammatic analysis of the two pieces of music demonstrated that both share similar spectrogrammatic characteristics. Listening to Mozart K.448 and K.545 decreased the epileptiform discharges in epileptic children. This suggests that Mozart K.448 is not the only piece of music to have beneficial effects on children with epilepsy. Other music with lower harmonics may also decrease epileptiform discharges in epileptic children.

  18. Repdigits in k-Lucas sequences

    Indian Academy of Sciences (India)

    Since the function x ↦→ x/ log x is increasing for all x>e, it is easy to check that the inequality x log x. < A implies x < 2A log A, whenever A ≥ 3. Thus, taking A := 1.2 × 1013 k4 log2 k, inequality (14) yields n − 1 < 2 (1.2 × 1013k4 log2 k) log(1.2 × 1013 k4 log2 k). < (2.4 × 1013k4 log2 k)(31 + 4 log k + 2 log log k).

  19. Lifelong Learning as a Chameleonic Concept and Versatile Practice: Y2K Perspectives and Trends

    Science.gov (United States)

    Grace, Andre P.

    2004-01-01

    This essay focuses on contemporary lifelong-learning discourse as it was reflected in deliberations during three events held in Australia, Canada and the UK during 2000-01. Through the dialogical lenses of these Y2K events that brought together an array of international participants, it examines lifelong learning as a chameleonic concept and…

  20. Marmara gölü balık faunası ve balıkçılık faaliyetleri.

    Directory of Open Access Journals (Sweden)

    Ali İlhan

    2015-12-01

    Full Text Available Bu çalışma, Mart 2012-Şubat 2013 tarihleri arasında Marmara Gölü balık faunasının ve göldeki balıkçılık faaliyetlerinin günümüzdeki durumunu ortaya çıkarmak amacıyla gerçekleştirilmiştir. Balık örneklemeleri, gölün doğu, orta ve batı kesiminde belirlenen 3 farklı istasyonda gerçekleştirilmiştir. Balık avcılığında, fanyalı ve fanyasız ağlar ile kerevit pinterleri kullanılmıştır. Söz konusu ağ ve pinterlerin suda kalma süreleri mevsimsel şartlara göre küçük değişiklikler gösterse de yaklaşık olarak 12 saattir. İstasyonlar arası homojeniteyi sağlamak amacıyla her istasyonda aynı özellikteki ağlar ve pinterler kullanılmıştır. Ayrıca, kıyısal bölgede küçük boylu türlerin ve diğer türlerin juvenillerinin yakalanması için tül ığrıp kullanılmıştır. Araştırma sonucunda gölde Atherinidae, Cyprinidae, Cobitidae, Percidae, Poecilidae ve Gobiidae familyalarına ait 15 takson tespit edilmiştir. Gölün son on yıllık balıkçılık verileri incelendiğinde en önemli ticari türün Sazan (Cyprinus carpio olduğu, bunu sudak (Sander lucioperca, yayın (Silurus glanis ve tatlısu kolyozu (Alburnus battalgilae’nun izlediği belirlenmiştir. Ayrıca, her ne kadar ticari değeri diğerleri kadar yüksek olmasa da üretim miktarı açısından gümüşi havuz balığı (Carassius gibelio’nın da gölde önemli derecede yer aldığı saptanmıştır

  1. C K Maiti

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C K Maiti. Articles written in Bulletin of Materials Science. Volume 24 Issue 6 December 2001 pp 579-582 Thin Films. Metallo–organic compound-based plasma enhanced CVD of ZrO2 films for microelectronic applications · S Chatterjee S K Samanta H D Banerjee C K Maiti.

  2. G K Ananthasuresh

    Indian Academy of Sciences (India)

    G K Ananthasuresh · More Details Fulltext PDF. Volume 17 Issue 4 April 2012 pp 317-318 Editorial. Editorial · G K Ananthasuresh · More Details Fulltext PDF. Volume 20 Issue 2 February 2015 pp 98-122 General Article. Buckminster Fuller and his Fabulous Designs · G K Ananthasuresh · More Details Fulltext PDF ...

  3. B K Godwal

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B K Godwal. Articles written in Bulletin of Materials Science. Volume 23 Issue 2 April 2000 pp 151-154 Instrumentation. A CCD area detector for X-ray diffraction under high pressure for rotating anode source · Amar Sinha Alka B Garg V Vijayakumar B K Godwal S K Sikka.

  4. Vector meson production in the final state K K of photon-photon collisions

    Energy Technology Data Exchange (ETDEWEB)

    Althoff, M; Braunschweig, W; Gerhards, R; Kirschfink, J F; Martyn, H U; Rosskamp, P; Wallraff, W; Bock, B; Eisenmann, Y; Fischer, H M

    1986-08-01

    Vector meson production is studied in the reaction ->K K . A clear PHI(1020) signal is seen in the K K mass distribution and a Ksup(*0)(890) signal is visible in the Ksup(+-) sup(-+) one. Both do not seem to be strongly correlated with quasi two body final states. Cross sections for the processes ->K K , ->PHI , ->Ksup(*0)Ksup(+-) sup(-+) and upper limits for the production of duction of PHIrho, PHIPHI and Ksup(*0)Ksup(*0) are given as function of the invariant mass.

  5. Preliminary measurements with a 4 K gravitational wave antenna

    International Nuclear Information System (INIS)

    Boughn, S.P.; McAshan, M.S.; Paik, H.J.; Taber, R.C.; Fairbank, W.M.; Giffard, R.P.

    1975-01-01

    The behavior of a small resonant gravitational wave antenna cooled to 4 K has been measured. This antenna is the prototype for a much larger system designed to be cooled eventually below 10 mK. Noise levels have been observed in the fundamental mechanical mode of the antenna corresponding to temperatures below 50 K. The antenna is a 680 kg cylindrical bar of aluminum clad with a layer of 0.38 mm thick niobium-titanium. It is levitated on a magnetic field of 0.2 T provided by a set of curved superconducting coils. The helium tank is suspended by low resonant-frequency springs and acoustic isolation stacks constructed of alternate layers of rubber and iron. This suspension is mechanically independent of the rest of the cryostat. Measurements have shown that the magnetic levitation stage provides a further vibration attenuation in excess of 50 dB at the frequency of the antenna mode. When levitated at an exchange gas pressure of 0.01 Pa the energy decay time for the fundamental bar mode at 1312 Hz has been measured to be 40 s. This corresponds to a Q of 3.3 x 10 5 . For the experiments to be described the bar carries at one end an acceleration transducer, operating in a non-resonant mode. (Auth.)

  6. Titanium K-Shell X-Ray Production from High Velocity Wire Arrays Implosions on the 20-MA Z Accelerator

    International Nuclear Information System (INIS)

    Apruzese, J.P.; Beg, F.N.; Clark, R.C.; Coverdale, C.A.; Davis, J.; Deeney, C.; Douglas, M.R.; Nash, T.J.; Ruiz-Comacho, J.; Spielman, R.B.; Struve, K.W.; Thornhill, J.W.; Whitney, K.G.

    1999-01-01

    The advent of the 20-MA Z accelerator [R.B. Spielman, C. Deeney, G.A. Chandler, et al., Phys. Plasmas 5, 2105, (1997)] has enabled implosions of large diameter, high-wire-number arrays of titanium to begin testing Z-pinch K-shell scaling theories. The 2-cm long titanium arrays, which were mounted on a 40-mm diameter, produced between 75±15 to 125±20 kJ of K-shell x-rays. Mass scans indicate that, as predicted, higher velocity implosions in the series produced higher x-ray yields. Spectroscopic analyses indicate that these high velocity implosions achieved peak electron temperatures from 2.7±0.1 to 3.2±0.2 keV and obtained a K-shell emission mass participation of up to 12%

  7. K Gowthamarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K Gowthamarajan. Articles written in Resonance – Journal of Science Education. Volume 8 Issue 5 May 2003 pp 38-46 General Article. Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral Delivery of Insulin · K Gowthamarajan Giriraj T Kulkarni.

  8. X-ray diffraction studies on K3Gd5 (PO4) 6 between 20K to 1073 K

    International Nuclear Information System (INIS)

    Bevara, Samatha; Achary, S.N.; Tyagi, A.K.; Sinha, A.K.; Sastry, P.U.

    2016-01-01

    Complex inorganic phosphates have been of interest due to their diversified crystal chemistry depending on composition, preparation condition as well as external parameters like temperature and pressure. In addition varieties of complex phosphates have been considered as potential host matrices for immobilization of radioactive elements as well as for selective separation of ions from high level nuclear waste or heavy metal ion pollutants from environment. Temperature and/or pressure induced structural variations are often noticed in such type complex phosphates. In K 2 O-Gd 2 O 3 -P 2 O 5 , a novel complex phosphate with K 3 Gd 5 (PO 4 ) 6 has been reported recently. In order to study the effect of temperature on crystal structure of K 3 Gd 5 (PO 4 ) 6 variable temperature XRD studies between 20 K to 1073 K were carried out and the results are presented herein

  9. K C Bhamu

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. K C BHAMU. Articles written in Pramana – Journal of Physics. Volume 89 Issue 1 July 2017 pp 11 Research Article. Density functional study of A g S c O 2 : Electronic and optical properties · K C BHAMU JAGRATI SAHARIYA RISHI VYAS K R PRIOLKAR · More Details ...

  10. k c mistri

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K C MISTRI. Articles written in Sadhana. Volume 42 Issue 9 September 2017 pp 1459-1471. Influence of yielding base and rigid base on propagation of Rayleigh-type wave in a viscoelastic layer of Voigt type · S SAHA A CHATTOPADHYAY K C MISTRI A K SINGH · More Details Abstract Fulltext ...

  11. Fatigue life of fibre reinforced plastics at 295 K after thermal cycling between 295 K and 77 K

    Science.gov (United States)

    Belisario, G.; Caproni, F.; Marchetti, E.

    Results of low cycle three-point end fatigue tests at 295 K are reported. These were obtained from fibre reinforced plastics (FRP) flat specimens made of epoxy matrix reinforced with glass rovings only or glass rovings and Kevlar cloth. It is shown that previous thermal cycles between 295 K and 77 K exert an influence on the fatigue life as well on the acoustic emission results.

  12. Mozart K.545 Mimics Mozart K.448 in Reducing Epileptiform Discharges in Epileptic Children

    Directory of Open Access Journals (Sweden)

    Lung-Chang Lin

    2012-01-01

    Full Text Available Mozart K.448 has been shown to improve cognitive function, leading to what is known as the Mozart Effect. Our previous work reveals positive effects of Mozart K.448 in reducing epileptiform discharges in epileptic children. In this study, we evaluated the effect of Mozart K.545 and compared the effects with those of Mozart K.448 on epileptiform discharges in children with epilepsy. Thirty-nine epileptic children with epileptiform discharges were included in the study. They received electroencephalogram examinations before, during, and after listening to Mozart K.448 and K.545, one week apart, respectively. The frequencies of epileptiform discharges were compared. There was a significant decrease in the frequency of epileptiform discharges during and right after listening to Mozart K.448 and K.545 (reduced by 35.7±32.7% during Mozart K.448 and 30.3±44.4% after Mozart K.448; and 34.0±39.5% during Mozart K.545 and 31.8±39.2% after Mozart K.545. Spectrogrammatic analysis of the two pieces of music demonstrated that both share similar spectrogrammatic characteristics. Listening to Mozart K.448 and K.545 decreased the epileptiform discharges in epileptic children. This suggests that Mozart K.448 is not the only piece of music to have beneficial effects on children with epilepsy. Other music with lower harmonics may also decrease epileptiform discharges in epileptic children.

  13. Facts about Vitamin K

    Science.gov (United States)

    Facts about Vitamin K 1 R. Elaine Turner and Wendy J. Dahl 2 FCS8666 Figure 1. Vitamin K is mostly found in vegetables, especially green ... ColognePhotos/iStock/Thinkstock, © ColognePhotos Why do we need vitamin K? Vitamin K is one of the fat- ...

  14. K-forbidden transition probabilities

    International Nuclear Information System (INIS)

    Saitoh, T.R.; Sletten, G.; Bark, R.A.; Hagemann, G.B.; Herskind, B.; Saitoh-Hashimoto, N.; Tsukuba Univ., Ibaraki

    2000-01-01

    Reduced hindrance factors of K-forbidden transitions are compiled for nuclei with A∝180 where γ-vibrational states are observed. Correlations between these reduced hindrance factors and Coriolis forces, statistical level mixing and γ-softness have been studied. It is demonstrated that the K-forbidden transition probabilities are related to γ-softness. The decay of the high-K bandheads has been studied by means of the two-state mixing, which would be induced by the γ-softness, with the use of a number of K-forbidden transitions compiled in the present work, where high-K bandheads are depopulated by both E2 and ΔI=1 transitions. The validity of the two-state mixing scheme has been examined by using the proposed identity of the B(M1)/B(E2) ratios of transitions depopulating high-K bandheads and levels of low-K bands. A break down of the identity might indicate that other levels would mediate transitions between high- and low-K states. (orig.)

  15. Application of electrospray mass spectrometry to the characterization of recombinant proteins up to 44 kDa

    NARCIS (Netherlands)

    Van Dorsselaer, A.; Bitsch, F.; Green, B.; Jarvis, S.; Lepage, P.; Bischoff, Rainer; Kolbe, V.J.; Roitsch, C.

    1990-01-01

    Mass measurement by electrospray mass spectrometry (ESMS) is used as a rapid preliminary verification of the identity of various recombinant proteins ranging from 7 to 44 kDa with an accuracy of 0.01-0.03%. ESMS not only improves the speed but also the reliability of the protein structure

  16. Dose due to 40K

    International Nuclear Information System (INIS)

    Escareno J, E.; Vega C, H. R.

    2011-10-01

    The dose due to 40 K has been estimated. Potassium is one of the most abundant elements in nature, being approximately 2% of the Earth's crust. Potassium has three isotopes 39 K, 40 K and 41 K, two are stable while 40 K is radioactive with a half life of 1.2x10 9 years; there is 0.0117% 40 K-to-K ratio. Potassium plays an important role in plants, animals and humans growth and reproduction. Due to the fact that K is an essential element for humans, 40 K is the most abundant radioisotope in human body. In order to keep good health conditions K must be intake at daily basis trough food and beverages, however when K in ingested above the requirements produce adverse health effects in persons with renal, cardiac and hypertension problems or suffering diabetes. In 89.3% 40 K decays to 40 C through β-decay, in 10.3% decays through electronic capture and emitting 1.46 MeV γ-ray. K is abundant in soil, construction materials, sand thus γ-rays produced during 40 K decay contribute to external dose. For K in the body practically all 40 K decaying energy is absorbed by the body; thus 40 K contributes to total dose in humans and it is important to evaluate its contribution. In this work a set of 40 K sources were prepared using different amounts of KCl salt, a γ-ray spectrometer with a NaI(Tl) was characterized to standardized the sources in order to evaluate the dose due to 40 K. Using thermoluminescent dosemeters the dose due to 40 K was measured and related to the amount of 40 K γ-ray activity. (Author)

  17. K2-231 b: A Sub-Neptune Exoplanet Transiting a Solar Twin in Ruprecht 147

    Science.gov (United States)

    Curtis, Jason Lee; Vanderburg, Andrew; Torres, Guillermo; Kraus, Adam L.; Huber, Daniel; Mann, Andrew W.; Rizzuto, Aaron C.; Isaacson, Howard; Howard, Andrew W.; Henze, Christopher E.; Fulton, Benjamin J.; Wright, Jason T.

    2018-04-01

    We identify a sub-Neptune exoplanet (R p = 2.5 ± 0.2 {R}\\oplus ) transiting a solar twin in the Ruprecht 147 star cluster (3 Gyr, 300 pc, [Fe/H] = +0.1 dex). The ∼81 day light curve for EPIC 219800881 (V = 12.71) from K2 Campaign 7 shows six transits with a period of 13.84 days, a depth of ∼0.06%, and a duration of ∼4 hr. Based on our analysis of high-resolution MIKE spectra, broadband optical and NIR photometry, the cluster parallax and interstellar reddening, and isochrone models from PARSEC, Dartmouth, and MIST, we estimate the following properties for the host star: M ⋆ = 1.01 ± 0.03 {M}ȯ , R ⋆ = 0.95 ± 0.03 {R}ȯ , and {T}{{eff}} = 5695 ± 50 K. This star appears to be single based on our modeling of the photometry, the low radial velocity (RV) variability measured over nearly 10 yr, and Keck/NIRC2 adaptive optics imaging and aperture-masking interferometry. Applying a probabilistic mass–radius relation, we estimate that the mass of this planet is M p = 7 + 5 – 3 {M}\\oplus , which would cause an RV semi-amplitude of K = 2 ± 1 {\\text{m s}}-1 that may be measurable with existing precise RV facilities. After statistically validating this planet with BLENDER, we now designate it K2-231b, making it the second substellar object to be discovered in Ruprecht 147 and the first planet; it joins the small but growing ranks of 22 other planets and three candidates found in open clusters.

  18. External K+ dependence of strong inward rectifier K+ channel conductance is caused not by K+ but by competitive pore blockade by external Na.

    Science.gov (United States)

    Ishihara, Keiko

    2018-06-15

    Strong inward rectifier K + (sKir) channels determine the membrane potentials of many types of excitable and nonexcitable cells, most notably the resting potentials of cardiac myocytes. They show little outward current during membrane depolarization (i.e., strong inward rectification) because of the channel blockade by cytoplasmic polyamines, which depends on the deviation of the membrane potential from the K + equilibrium potential ( V - E K ) when the extracellular K + concentration ([K + ] out ) is changed. Because their open - channel conductance is apparently proportional to the "square root" of [K + ] out , increases/decreases in [K + ] out enhance/diminish outward currents through sKir channels at membrane potentials near their reversal potential, which also affects, for example, the repolarization and action-potential duration of cardiac myocytes. Despite its importance, however, the mechanism underlying the [K + ] out dependence of the open sKir channel conductance has remained elusive. By studying Kir2.1, the canonical member of the sKir channel family, we first show that the outward currents of Kir2.1 are observed under the external K + -free condition when its inward rectification is reduced and that the complete inhibition of the currents at 0 [K + ] out results solely from pore blockade caused by the polyamines. Moreover, the noted square-root proportionality of the open sKir channel conductance to [K + ] out is mediated by the pore blockade by the external Na + , which is competitive with the external K + Our results show that external K + itself does not activate or facilitate K + permeation through the open sKir channel to mediate the apparent external K + dependence of its open channel conductance. The paradoxical increase/decrease in outward sKir channel currents during alternations in [K + ] out , which is physiologically relevant, is caused by competition from impermeant extracellular Na . © 2018 Ishihara.

  19. 46 CFR 112.01-20 - Final emergency power source.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Final emergency power source. 112.01-20 Section 112.01-20 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING EMERGENCY LIGHTING AND POWER SYSTEMS Definitions of Emergency Lighting and Power Systems § 112.01-20 Final emergency...

  20. Lectures on K-theory

    International Nuclear Information System (INIS)

    Karoubi, M.

    2003-01-01

    This opening contribution consists of a comprehensive survey of developments in K-theory in the last forty-five years, and covers a very broad spectrum of the subject, including Topological K-theory, Atiyah-Singer index theorem, K-theory of Banach algebras, Higher Algebraic K-theory and Cyclic Homology

  1. Enthalpies of Dissolution of Crystalline Naproxen Sodium in Water and Potassium Hydroxide Aqueous Solutions at 298 K

    Science.gov (United States)

    Lytkin, A. I.; Chernikov, V. V.; Krutova, O. N.; Bychkova, S. A.; Volkov, A. V.; Skvortsov, I. A.

    2018-03-01

    The enthalpies of dissolution of crystalline naproxen sodium in water and aqueous solutions of KOH at 298.15 K are measured by direct calorimetric means in a wide range of concentrations. The acid-base properties of naproxen sodium at ionic strength I 0 and I = 0.1 (KNO3) and a temperature of 298.15 K are studied by spectrophotometric means. The concentration and thermodynamic dissociation constants are determined. The standard enthalpies of the formation of naproxen sodium and the products of its dissociation in aqueous solution are calculated.

  2. K-bar-mesic nuclei

    International Nuclear Information System (INIS)

    Dote, Akinobu; Akaishi, Yoshinori; Yamazaki, Toshimitsu

    2005-01-01

    New nuclei 'K-bar-Mesic Nuclei' having the strangeness are described. At first it is shown that the strongly attractive nature of K-bar N interaction is reasoned inductively from consideration of the relation between Kaonic hydrogen atom and Λ (1405) which is an excited state of hyperon Λ. The K-bar N interactions are reviewed and summarized into three categories: 1. Phenomenological approach with density dependent K-bar N interaction (DD), relativistic mean field (RMF) approach, and hybrid of them (RMF+DD). 2. Boson exchange model. 3. Chiral SU(3) theory. The investigation of some light K-bar-nuclei by Akaishi and Yamazaki using phenomenological K-bar N interaction is explained in detail. Studies by antisymmetrized molecular dynamics (AMD) approach are also presented. From these theoretical researches, the following feature of K-bar-mesic nuclei are revealed: 1) Ground state is discrete and bound by 100 MeV or more. 2) Density is very high in side the K-bar-mesic nuclei. 3) Strange structures develop which are not seen in ordinary nuclei. Finally some recent experiments to explore K-bar-mesic nuclei are reviewed. (S. Funahashi)

  3. Model-independent measurement of the CKM angle $\\gamma$ using $B^0 \\to D K^{\\ast 0}$ decays with $D \\to K_{S}^{0} \\pi^{+} \\pi^{-}$ and $K_{S}^{0} K^{+} K^{-}$

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano

    2016-06-21

    A binned Dalitz plot analysis of the decays $B^0 \\to D K^{\\ast 0}$, with $D \\to K_{S}^{0} \\pi^{+} \\pi^{-}$ and $D \\to K_{S}^{0} K^{+} K^{-}$, is performed to measure the observables $x_\\pm$ and $y_\\pm$, which are related to the CKM angle $\\gamma$ and the hadronic parameters of the decays. The $D$ decay strong phase variation over the Dalitz plot is taken from measurements performed at the CLEO-c experiment, making the analysis independent of the $D$ decay model. With a sample of proton-proton collision data, corresponding to an integrated luminosity of $3.0\\,\\rm{fb}^{-1}$, collected by the LHCb experiment, the values of the $CP$ violation parameters are found to be $x_+ = 0.05 \\pm 0.35 \\pm 0.02$, $x_-=-0.31\\pm 0.20 \\pm 0.04$, $y_+=-0.81\\pm 0.28\\pm 0.06$ and $y_-=0.31\\pm 0.21 \\pm 0.05$, where the first uncertainties are statistical and the second systematic. These observables correspond to values $\\gamma$ = $(71 \\pm 20)^\\circ$, $r_{B^0} = 0.56\\pm 0.17$ and $\\delta_{B^0} = (204\\,^{+21}_{-20})^\\circ$. The parame...

  4. Stress-strain behavior under static loading in Gd123 high-temperature superconductors at 77 K

    Science.gov (United States)

    Fujimoto, Hiroyuki; Murakami, Akira; Teshima, Hidekazu; Morita, Mitsuru

    2013-10-01

    Mechanical properties of melt-growth GdBa2Cu3Ox (Gd123) superconducting samples with 10 wt.% Ag2O and 0.5 wt.% Pt were evaluated at 77 K through flexural tests for specimens cut from the samples in order to estimate the mechanical properties of the Gd123 material without metal substrates, buffer layers or stabilization layers. We discuss the mechanical properties; the Young's modulus and flexural strength with stress-strain behavior at 77 K. The results show that the flexural strength and fracture strain of Gd123 at 77 K are approximately 100 MPa and 0.1%, respectively, and that the origin of the fracture is defects such as pores, impurities and non-superconducting compounds. We also show that the Young's modulus of Gd123 is estimated to be 160-165 GPa.

  5. Measurement of the ratio of branching ratios BR(B+ → J/ψK+)/BR(B0 → J/φK0) and BR(B+ → J/ψK+)/BR(B+ → J/ψK*+)

    International Nuclear Information System (INIS)

    Atavales, J. B. G.

    1995-01-01

    A preliminary measurement of the ratio of branching ratios BR(B + → J/ψK + )/BR(B 0 → J/ψK 0 ) and BR(B + → J/ψK + )/BR(B + → J/ψK *+ ) is made by fully reconstructing each mode, where J/ψ → μ + μ - , K *+ → K 0 s π + and K 0 s → π + π - . The data were taken with the CDF detector during the 1993 run. The total integrated luminosity is ∼ 20pb -1 resulting in a sample of about 170 J/ψK ± , 50 J/ψK 0 S and 25 J/ψK *± candidate events. The results will be reported

  6. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  7. K Srinivasan

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Srinivasan. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 35-37 Metallic Materials. Impact toughness of ternary Al–Zn–Mg alloys in as cast and homogenized condition measured in the temperature range 263–673 K · Harish Kundar ...

  8. Constants and thermodynamics of the acid-base equilibria of triglycine in water-ethanol solutions containing sodium perchlorate at 298 K

    Science.gov (United States)

    Pham Tkhi, L.; Usacheva, T. R.; Tukumova, N. V.; Koryshev, N. E.; Khrenova, T. M.; Sharnin, V. A.

    2016-02-01

    The acid-base equilibrium constants for glycyl-glycyl-glycine (triglycine) in water-ethanol solvents containing 0.0, 0.1, 0.3, and 0.5 mole fractions of ethanol are determined by potentiometric titration at 298.15 K and an ionic strength of 0.1, maintained with sodium perchlorate. It is established that an increase in the ethanol content in the solvent reduces the dissociation constant of the carboxyl group of triglycine (increases p K 1) and increases the dissociation constant of the amino group of triglycine (decreases p K 2). It is noted that the weakening of the acidic properties of a triglycinium ion upon an increase of the ethanol content in the solvent is due to the attenuation of the solvation shell of the zwitterionic form of triglycine, and to the increased solvation of triglycinium ions. It is concluded that the acid strength of triglycine increases along with a rise in the EtOH content in the solvent, due to the desolvation of the tripeptide zwitterion and the enhanced solvation of protons.

  9. Gene : CBRC-TTRU-01-0332 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 2| PREDICTED: similar to vomeronasal 1 receptor, k1 [Equus caballus] 5e-51 40% MTEVWSSLDCCTKFLRIRYSTVTILEIFF...LKPQTSTCVLPSFLFFWVINMLICIWIITNNETVTNASAAQPGYSPVYCKTKRGDYRESAVFQSAMLIRVFLCINLTVWTS

  10. The influence of KD and K anti K mesonic molecules in selected reactions; Auswirkung der im KD- und K anti K-Kanal gebildeten mesonischen Molekuele in verschiedenen Reaktionen

    Energy Technology Data Exchange (ETDEWEB)

    Sassen, F.P.

    2004-07-01

    The attractive potential of the Juelich meson exchange model in the K anti K-channel causes formation of a scalar isoscalar molecule. We investigate this observation from different points of view. First we look at the dependence of pion production in the peripheral reaction {pi}{sup -}p {yields} {pi}{sup 0}{pi}{sup 0}n on the momentum transferred at the nucleus. Accounting for the production via {pi} and a{sub 1} emission in a consistent way, we are able to explain the momentum dependence using the Juelich model. Furthermore we investigate how a measurement of dd {yields} {alpha}K anti K close to threshold may contribute to our knowledge on K anti K interaction and the f{sub 0}(980). The Juelich model links the properties of the f{sub 0}(980) to the a{sub 0}(980). We will use this information to learn about the d anti K-interaction in pp {yields} dK anti K. The recent discovery of the D{sup *}{sub sJ}(2317) o ers a different perspective on the dynamical generation of poles, since it may be connected to the KD-threshold nearby. We construct a SU(4)-extention of the Juelich model including isospin violation. Within this extention a dynamical resonance is formed, which only may explain the D{sup *}{sub sJ}(2317) if isoscalar production is assumed. Special interest is paid to the predicted width of the D{sup *}{sub sJ}(2317) associated with a dynamical interpretation. (orig.)

  11. The system K2NbF7-K2TiF6-KCl

    International Nuclear Information System (INIS)

    Kamenskaya, L.A.; Matveev, A.M.

    1984-01-01

    Using visual-polythermal and thermographical methods the ternary system K 2 NbF 7 -K 2 TiE 6 -KCl has been studied. Crystallization fields of initial components and the field of solid solutions of double compounds K 3 NbClF 7 and K 3 TiClF 6 are outlined. Ternary eutectics at 654 deg C, having the composition K 2 NbF 6 -41, K 2 TiP 6 -41, KCl-18 mol.%, is determined. Potassium fluoroniobate and fluorotitanate form continuous solid solutions unstable in the presence of the third component, potassium chloride

  12. Waiting for the discovery of B0d→K0 anti K0

    International Nuclear Information System (INIS)

    Fleischer, R.; Recksiegel, S.

    2004-01-01

    The CP asymmetries of the decay B d 0 →K 0 anti K 0 , which originates from anti b→ anti d s anti s flavor-changing neutral-current processes, and its CP-averaged branching ratio BR(B d →K 0 anti K 0 ) offer interesting avenues to explore flavor physics. We show that we may characterize this channel, within the standard model, in a theoretically clean manner through a surface in observable space. In order to extract the relevant information from BR (B d →K 0 anti K 0 ), further information is required, which is provided by the B→ππ system and the SU(3) flavor symmetry, where we include the leading factorizable SU(3)-breaking corrections and discuss how experimental insights into non-factorizable effects can be obtained. We point out that the standard model implies a lower bound for BR(B d →K 0 anti K 0 ), which is very close to its current experimental upper bound, thereby suggesting that this decay should soon be observed. Moreover, we explore the implications for ''color suppression'' in the B→ππ system, and convert the data for these modes in a peculiar standard-model pattern for the CP-violating B d 0 →K 0 anti K 0 observables. (orig.)

  13. Gill Na+, K+-ATPase activity in largemouth bass (Micropterus salmoides) inhabiting reservoirs contaminated with mercury

    International Nuclear Information System (INIS)

    Brundage, S.; Jagoe, C.H.; Shaw-Allen, P.

    1995-01-01

    Active transport of Na + and K + for osmoregulation in fish involves gill Na + , K + -ATPase, a membrane-bound enzyme powered by hydrolysis of ATP. Na + , K + -ATPase is inhibited by many dissolved metals including Al, Cd, Cu and Hg, resulting in ionoregulatory dysfunction. However, dissolved Hg concentrations are quite low in most aquatic systems, and dietary sources are the most important contributors to Hg burdens in fish. One recent study demonstrated relationships between muscle Hg concentration and gill Na + , K + -ATPase in a marine fish, suggesting that Hg accumulated via diet can affect osmoregulation. The authors tested for such a relationship in several age-classes of a freshwater fish (Micropterus salmoides) collected from three reservoirs. Fish from Par Pond and L Lake, on the USDOE Savannah River Site in South Carolina had relatively high Hg content: for Par Pond, muscle and liver ranged from 1.58--12.01 and 1.46--23.22 microg Hg/g dry mass, respectively, and for L Lake muscle and liver ranged from 3.11--5.16 and 1.28--12.59 microg Hg/g dry mass, respectively. Bass from an offsite location, Thurmond Lake, had significantly (P + , K + -ATPase activity was not evident

  14. The SNL100-01 blade :

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, Daniel

    2013-02-01

    A series of design studies to investigate the effect of carbon on blade weight and performance for large blades was performed using the Sandia 100-meter All-glass Baseline Blade design as a starting point. This document provides a description of the final carbon blade design, which is termed as SNL100-01. This report includes a summary of the design modifications applied to the baseline all-glass 100-meter design and a description of the NuMAD model files that are made publicly available. This document is intended primarily to be a companion document to the distribution of the NuMAD blade model files for SNL100-01.

  15. PDB: CBRC-CJAC-01-0391 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0391 1FFX,1IA0,1JFF,1SA0,1SA1,1TUB,1TVK,2WBE,1Z2B,3DCO,3DU7,3E22, Region:421-804(Identity...=82%) PDB:1FFX Chain:B (X-ray Resolution=3.95),Region:421-804(Identity=82%) PDB:1IA0 Chai...n:B (EM Resolution=15.00),Region:421-804(Identity=82%) PDB:1JFF Chain:B (EM Resolution=3.50),Region:421-804(Identity...=82%) PDB:1SA0 Chain:B (X-ray Resolution=3.58),Region:421-804(Identity=82...%) PDB:1SA1 Chain:B (X-ray Resolution=4.20),Region:421-788(Identity=82%) PDB:1TUB Chain:B (EM Resolution=3.70),Region:421-788(Identit

  16. Binary and ternary recombination of D3+ ions at 80-130 K: Application of laser absorption spectroscopy

    Science.gov (United States)

    Dohnal, Petr; Hejduk, Michal; Rubovič, Peter; Varju, Jozef; Roučka, Štěpán; Plašil, Radek; Glosík, Juraj

    2012-11-01

    Recombination of D_3^+ ions with electrons at low temperatures (80-130 K) was studied using spectroscopic determination of D_3^+ ions density in afterglow plasmas. The use of cavity ring-down absorption spectroscopy enabled an in situ determination of the abundances of the ions in plasma and the translational and the rotational temperatures of the recombining ions. Two near infrared transitions at (5792.70 ± 0.01) cm-1 and at (5793.90 ± 0.01) cm-1 were used to probe the number densities of the lowest ortho state and of one higher lying rotational state of the vibrational ground state of D_3^+ ion. The results show that D_3^+ recombination with electrons consists of the binary and the third-body (helium) assisted process. The obtained binary recombination rate coefficients are in agreement with a recent theoretical prediction for electron-ion plasma in thermodynamic equilibrium with αbin(80 K) = (9.2 ± 2.0) × 10-8 cm3 s-1. The measured helium assisted ternary rate coefficients KHe are in agreement with our previously measured flowing afterglow data giving a value of KHe(80 K) = (1.2 ± 0.3) × 10-25 cm6 s-1.

  17. The density of molten indium at temperatures up to 600 K

    International Nuclear Information System (INIS)

    Alchagirov, B.B.; Khatsukov, A.M.; Mozgovoj, A.G.

    2004-01-01

    The liquid indium density measurement is carried out through the pycnometric method within the temperature range of 434-600 K both by heating and cooling. The totality of the obtained results was processed through the approximating equation. The root-mean-square deviation of the experimental data from the approximating equation does not exceed ±0.01%. The high accuracy of the obtained results is noted. The deviation of the existing data on the liquid indium density from the approximating equation is shown graphically [ru

  18. K-Ar age estimate for the KBS Tuff, East Turkana, Kenya

    International Nuclear Information System (INIS)

    McDougall, I.; Maier, R.; Sutherland-Hawkes, P.; Gleadow, A.J.W.

    1980-01-01

    Stone tools and numerous vertebrate fossils including hominids, have been found in close stratigraphic proximity to the KBS Tuff, whose age has been the subject of much debate. Concordant K-Ar ages, averaging 1.89 +- 0.01 Myr, are reported on anorthoclase phenocrysts from 13 pumice clasts collected from within the KBS Tuff or its correlatives. It is believed that this age is the best estimate currently available for the time of formation of this important marker horizon within the East Turkana Basin. (author)

  19. Gene : CBRC-TTRU-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

  20. Comparison of vitamins K1, K2 and K3 effects on growth of rat glioma and human glioblastoma multiforme cells in vitro.

    Science.gov (United States)

    Oztopçu, Pinar; Kabadere, Selda; Mercangoz, Ayşe; Uyar, Ruhi

    2004-09-01

    Glioblastoma multiforme is characterized as highly invasive and rapidly growing astrocytomas, and scientists have sought for efficient treatment against malignant gliomas for a long time. Therefore, we compared the respond of rat glioma (C6) and glioblastoma multiforme cells derived from two patients to vitamins K1, K2 and K3. The cells were exposed to 100, 250, 500, 750 and 1000 microM of vitamins K1 and K2, and 1, 10, 25, 50, 75 and 100 microM of vitamin K3 for 24 hours in an incubator atmosphere of 5% CO2, 37 degrees C and 100% humidity. Cell viability was estimated by MTT assay. Vitamin K1 showed no growth effect on all the glioma cells examined. Vitamin K2 did not cause any change in number of C6, however induced growth inhibition in a dose-dependent manner on glioblastoma multiforme. The IC50 values of vitamin K2 were 960 microM and 970 microM for glioblastoma multiforme, respectively. Vitamin K3 had also growth inhibitory effect in a dose-dependent manner on both C6 and glioblastoma multiforme. The IC50 values were 41 microM, 24 microM and 23 microM for vitamin K3, respectively. We concluded that vitamin K3 is more effective than vitamin K2 for inhibition of cancer cell growth, and might have an alternative value as an anticancer drug against glioblastoma multiforme.