WorldWideScience

Sample records for k-7 open school

  1. Open Schooling: Why Open Schools Are Re-Emerging as a New Model

    Science.gov (United States)

    Commonwealth of Learning, 2010

    2010-01-01

    Open schools are not just concerned with increasing access to secondary schooling, but also with equalising educational opportunities for citizens regardless of their geographic location or socio-economic background. Through a well-articulated policy, broad consensus on the most appropriate direction for the future development of open schooling…

  2. The Open School. An Annotated Bibliography. Current Bibliography No. 4.

    Science.gov (United States)

    Cockburn, Ilze, Comp.

    In 1970, the OISE library published an annotated bibliography entitled, Open Plan (See ED 051 549), that covered the design of open plan schools and the educational practices connected with these facilities. Since then, a clearer distinction has developed between the terms "open plan" and "open education." This revision of the earlier volume…

  3. Open Schools for improving Equity and Quality Education

    NARCIS (Netherlands)

    Stracke, Christian M.

    2016-01-01

    Invited Speech at International Lensky Education Forum 2016, Yakutsk, Republic of Sakha, Russian Federation, by Stracke, C. M. (2016, 16 August): "Open Schools for improving Equity and Quality Education"

  4. OPEN PRIMARY EDUCATION SCHOOL STUDENTS’ OPINIONS ABOUT MATHEMATICS TELEVISION PROGRAMMES

    Directory of Open Access Journals (Sweden)

    Kursat YENILMEZ

    2008-10-01

    Full Text Available The purpose of this study was to determine open primary education school students’ opinions about mathematics television programmes. This study indicated that to determine differences among open primary education school students’ opinions about mathematics television programmes point of view students’ characteristics like gender, age, grade, frequency of watching mathematics television programmes and living place. The sample consists of 99 students which were selected randomly from open primary school students in Eskisehir in 2005-2006 education years. Data were collected by a questionnaire which consists of 15 items and a demographical information form. Frequency tables, t-test and one-way analysis of variance (ANOVA were employed to analyze data. According to the results of the study, open primary education school students have some negative opinions about language, terms, suitability for learning levels, expression speed, number of repeating broadcast and summaries of mathematics television programmes.

  5. Using Open Space Technology for School Improvement.

    Science.gov (United States)

    Cox, David

    2002-01-01

    Describes a theory referred to as Open Space Technology (OST), which holds that the most productive learning in conference settings takes place in the open space between formally scheduled conference sessions. Argues that OST can be applied to staff development days and other educational development programs. (Contains 10 references.) (NB)

  6. Quality Middle Schools: Open and Healthy.

    Science.gov (United States)

    Hoy, Wayne K.; Sabo, Dennis J.

    This book offers hands-on suggestions for administrators who want to assess their schools' health. The goal is to improve middle schools by making sure the culture is right for all groups--students, teachers, and staff. Chapter 1, "Climate, Culture, and Quality," distinguishes between the concepts of organizational culture and climate, formulates…

  7. Please Come to Open School Week = Bienvenidos a "Escuela Abierta."

    Science.gov (United States)

    United Federation of Teachers, New York, NY.

    This booklet, printed in both English and Spanish, offers suggestions to parents for getting the most out of a visit to their children's schools during New York City's Open School Week. It is comprised of five sections. The first section, "The Parent/Teacher Conference," discusses the following areas: (1) questions and concerns to…

  8. Quality Primary Schooling an Open Global Challenge

    Directory of Open Access Journals (Sweden)

    Sayyed Farooq Shah

    2015-11-01

    Full Text Available This article draws upon research undertaken for exploring those factors and indicators which directly or indirectly influence the primary schooling quality and explores the efforts and steps taken by UNESCO, Education For All(EFA, and WORLD DAKAR FORUM and most recently by Mellinium Development Goal(MGD announced for 2015 as well. Relevant Data were collected from the above mentioned forums and from the teaches, head teachers, parents, policy makers, stake holders and learners to some extent, their views, expert opinions, expressions thoughts were filtered and international seminars announcements were also taken as model. At the end common view point was developed about the quality enhancing factors especially at primary level of schooling

  9. Acoustic design of open plan schools and comparison of requirements

    DEFF Research Database (Denmark)

    Møller Petersen, Claus; Rasmussen, Birgit

    2012-01-01

    between groups and satisfac¬tory speech intelligibility internally in groups. This paper describes the newest Danish requirements and recommendations for such open plan areas and presents the design, measurements and subjective evaluation of two newer Danish schools. According to the users, the general......In the Nordic countries several new schools have open plan areas for teaching and group work. However, to optimize learning efficiency for pupils and working conditions for teachers and to reduce noise levels, such spaces require special acoustic design to obtain sufficient sound attenuation...

  10. Open Source Energy Simulation for Elementary School

    CERN Document Server

    Lye, Sze Yee

    2012-01-01

    With the interactivity and multiple representation features, computer simulations lend itself to the guided inquiry learning. However, these simulations are usually designed for post-elementary students. Thus, the aim of this study is to investigate how the use of guided inquiry approach with customized energy simulation can improve students' understanding of this topic. In this ongoing research, the case study is adopted. In the first phase of the study, we have modified open source energy simulation based on principles for reducing extraneous processing, existing energy simulation and guided inquiry approach. The modified simulation is sent to teachers for evaluation and the feedback is encouraging. In the next phase of the study, the guided inquiry lesson package involving the energy simulation would be designed and deployed in an elementary classroom. Multiple data sources would be collected to seek a deeper understanding on how this learning package can possibly impact students' understanding of the phys...

  11. "Opening" a New Kind of High School: The Story of the Open High School of Utah

    Science.gov (United States)

    Tonks, DeLaina; Weston, Sarah; Wiley, David; Barbour, Michael K.

    2013-01-01

    The use of online learning at the primary and secondary school level is growing exponentially in the United States. Much of this growth is with full-time online schools, most of which are operated by for-profit companies that use proprietary online course content. In this article we trace the development of, and philosophy behind, a full-time…

  12. Texas charter school legislation and the evolution of open-enrollment charter schools.

    Directory of Open Access Journals (Sweden)

    Carrie Y. Barron Ausbrooks

    2005-03-01

    Full Text Available This article chronicles the evolution of legislation for Texas open-enrollment charter schools to their implementation by demonstrating how these schools have (or have not used their freedom from state-mandated requirements to develop innovative learning environments as well as to bring innovative curricula into the classroom. The investigative focus was on an analysis of Texas open-enrollment charter school legislation, from 1995 (74th legislative session to the 77th legislative session in 2001, and the characteristics of the state's 159 open-enrollment charter schools that were in operation during the 2001-2002 academic year. The authors found that charter school legislation has changed in response to concerns of all involved, and focuses on the need for balance between choice, innovation, and public accountability. Although charter schools are free from most state regulations, legislators were clearly interested in ensuring that this freedom does not impede charter schools' ability to provide a quality education to all students who attend them. The currently operating open-enrollment charter schools in Texas are more racially and economically segregated than other public schools in the state, and charter schools that targeted students most at risk for dropping out of school (and returning students who had previously dropped out differ from other schools in their stated teaching methods. Teacher turnover remains significantly greater than that for other public schools in the state. However, it does not appear to be specifically associated with schools that target disadvantaged students or minority students. The schools' mission statements suggest that innovative school environments are a factor in school design. Texas is poised to continue along the public education choice model. Charter school legislation provides a framework upon which charter schools may build to meet the educational needs of the students who choose to attend them

  13. Generation and characterisation of keratin 7 (K7 knockout mice.

    Directory of Open Access Journals (Sweden)

    Aileen Sandilands

    Full Text Available Keratin 7 (K7 is a Type II member of the keratin superfamily and despite its widespread expression in different types of simple and transitional epithelia, its functional role in vivo remains elusive, in part due to the lack of any appropriate mouse models or any human diseases that are associated with KRT7 gene mutations. Using conventional gene targeting in mouse embryonic stem cells, we report here the generation and characterisation of the first K7 knockout mouse. Loss of K7 led to increased proliferation of the bladder urothelium although this was not associated with hyperplasia. K18, a presumptive type I assembly partner for K7, showed reduced expression in the bladder whereas K20, a marker of the terminally differentiated superficial urothelial cells was transcriptionally up-regulated. No other epithelia were seen to be adversely affected by the loss of K7 and western blot and immunofluorescence microscopy analysis revealed that the expression of K8, K18, K19 and K20 were not altered in the absence of K7, with the exception of the kidney where there was reduced K18 expression.

  14. "On the gate of Arctic": Doors open to foreign schools

    Science.gov (United States)

    Pecchiar, Irene

    2015-04-01

    With the increased attention to the changing of the Arctic Region as a consequence of global climate changes, effective science education, outreach and communication need to be higher priorities within the scientific communities. In order to encourage the dissemination of polar research at educational levels Slovene high school students in Trieste were first engaged at school and at the National Museum of Antarctica of Trieste using conferences and laboratory activities to introduce the main polar climate change topics. Then together with three teachers they visited Tromso University (North Norway) for a week. The first aim of this project was to increase awareness of foreign schools on major topics concerning the Arctic issues (from the economic/social to the environmental/climatic point of view). Forty-three high school students were involved in the laboratory activities running at the University of Tromso and participated in seminars. The topics focused on were Ocean Acidification, Global Warming and the combined effects with other anthropogenic stressors. During their stay, students interviewed several scientists in order to allow them to edit a »visiting report«, that was updated every day in their blog and to elaborate all the material collected (photos, videos, data of laboratory work, reports). In Tromso, they were also introduced to the culture and tradition of the Scandinavian indigenous people at the Center of Sami Study. Back in Italy, they published some articles in local newspapers, and then they presented their results at the National Museum of Antarctica of Trieste about all the data elaboration in an open day exhibition with posters, short movies and PowerPoint presentations. All this work was made in order to pass their experience into the world. This was a pilot project, highlighting the role of universities as links between research and outreach. The next step should be to enlarge these kinds of activities to many Schools, Universities and

  15. When Free Isn't Free: The Realities of Running Open Source in School

    Science.gov (United States)

    Derringer, Pam

    2009-01-01

    Despite the last few years' growth in awareness of open-source software in schools and the potential savings it represents, its widespread adoption is still hampered. Randy Orwin, technology director of the Bainbridge Island School District in Washington State and a strong open-source advocate, cautions that installing an open-source…

  16. When Free Isn't Free: The Realities of Running Open Source in School

    Science.gov (United States)

    Derringer, Pam

    2009-01-01

    Despite the last few years' growth in awareness of open-source software in schools and the potential savings it represents, its widespread adoption is still hampered. Randy Orwin, technology director of the Bainbridge Island School District in Washington State and a strong open-source advocate, cautions that installing an open-source…

  17. Elucidation of the primary structure of the lantibiotic epilancin K7 from Staphylococcus epidermidis K7. Cloning and characterisation of the epilancin-K7-encoding gene and NMR analysis of mature epilancin K7

    NARCIS (Netherlands)

    Kamp, Mart van de; Hooven, Henno W. van den; Konings, Ruud N.H.; Bierbaum, Gabriele; Sahl, Hans-Georg; Kuipers, Oscar P.; Siezen, Roland J.; Vos, Willem M. de; Hilbers, Cornelis W.; Ven, Frank J.M. van de

    1995-01-01

    Lantibiotics are bacteriocins that contain unusual amino acids such as lanthionines and α,β-didehydro residues generated by posttranslational modification of a ribosomally synthesized precursor protein. The structural gene encoding the novel lantibiotic epilancin K7 from Staphylococcus epidemzidis K

  18. CERN School of Computing 2012 - Registration is open!

    CERN Multimedia

    IT Department

    2012-01-01

    The registration to the CERN School of Computing is now open. CSC2012 will take place in Uppsala from the 13th to the 24th of August. The programme is comprised of three main themes: Data Technologies, Base Technologies and Physics Computing and will address a number or timely questions including: Do you know how to bridge Grids and Clouds using virtualization technology? Is it possible to simplify LHC physics analysis using virtual machine? How can reliable storage services be built from unreliable hardware? Why are tapes still used in high energy physics data storage? How can I write code for tomorrow’s hardware, today? Do you want to see your software with attacker's eyes? Can you hack your own code? Do you know what do 'code injection' and 'integer overflow' have in common? What's so special about High Energy Physic's data format? What are the key statistical methods used in physics data analysis? The CSC is a true Summer Un...

  19. Open and Accessible: The Relationship between Closures and Circulation in School Library Media Centers

    Science.gov (United States)

    Dickinson, Gail; Gavigan, Karen; Pribesh, Shana

    2008-01-01

    A hallmark of school library media best practice is for the library media center to be open and accessible to patron use before, during, and after the school day and throughout the entire school year. Anecdotal evidence and informal discussion among school library media specialists indicate that library media facilities are sometimes used for…

  20. Opening Doors: Understanding School and Family Influences on Family Involvement

    Science.gov (United States)

    Carlisle, Erin; Stanley, Lindsey; Kemple, Kristen Mary

    2005-01-01

    Family involvement in schooling can benefit young children, teachers, and families. Family involvement in schools can be influenced by both school-related and family-related factors. School-related factors include teachers' attitudes toward families, and school and teacher expectations. Family-related factors include ethnicity, prior school…

  1. Exploring the Supply Side: Factors Related to Charter School Openings in NYC

    Science.gov (United States)

    Saultz, Andrew; Fitzpatrick, Dan; Jacobsen, Rebecca

    2015-01-01

    School choice policies have led to a proliferation of new schools opening. While economic theory suggests that new charters would open in high demand locations, limited work examines whether this is, indeed, occurring. Framing our study in geography, we explore both space factors and place factors as contrasting explanations for where new charters…

  2. CERN School of Computing 2011 - Registration is open

    CERN Multimedia

    IT Department

    2011-01-01

      The registration to the CERN School of Computing is open. CSC2011 will take place in Copenhagen from the 15th to the 26th of August. The programme is comprised of three main themes: Data Technologies, Base Technologies and Physics Computing and will address a number or timely questions including: Do you know how to bridge Grids and Clouds using virtualization technology? Is it possible to simplify LHC physics analysis using virtual machine? How can reliable storage services be built from unreliable hardware? Why are tapes still used in high energy physics data storage? How can I write code for tomorrow’s hardware, today? Do you want to see your software with attacker's eyes? Can you hack your own code? What's so special about High Energy Physic's data format? What are the key statistical methods used in physics data analysis? The CSC is a true Summer University. The focus is on delivering knowledge rather than know-how, which can better be provi...

  3. High School Open On-Line Courses (HOOC): A Case Study from Italy

    Science.gov (United States)

    Canessa, Enrique; Pisani, Armando

    2013-01-01

    The first implementation of complete high school, open on-line courses (HOOC) aiming to support the training and basic scientific knowledge of young students from the Liceo Ginnasio Dante Alighieri in Gorizia, Italy, is discussed. Using the open source and automated recording system openEyA, HOOC give a student the opportunity to watch on-line, at…

  4. Transforming High School Classrooms with Free/Open Source Software: "It's Time for an Open Source Software Revolution"

    Science.gov (United States)

    Pfaffman, Jay

    2008-01-01

    Free/Open Source Software (FOSS) applications meet many of the software needs of high school science classrooms. In spite of the availability and quality of FOSS tools, they remain unknown to many teachers and utilized by fewer still. In a world where most software has restrictions on copying and use, FOSS is an anomaly, free to use and to…

  5. CoSN K12 Open Technologies Implementation Study #3. Moodle: An Open Learning Content Management System for Schools

    Science.gov (United States)

    Consortium for School Networking (NJ1), 2008

    2008-01-01

    This report introduces educators to Moodle, an open-source software program for managing courses online. It briefly defines what Moodle is, what it can do, and gives specific examples of how it is being implemented. An appendix contains brief profiles of five school organizations that are using Moodle.

  6. Bringing Street Art to School: Open to Include

    Science.gov (United States)

    Santos, Graça Duarte; Varandas, Elisabete

    2016-01-01

    Inclusive Education values differences by reducing barriers to learning and promoting active participation and positive interactions between all members of school community. Nowadays, school faces numerous children/adolescents who for several reasons have developed challenging behaviours and high risk of dropping out school. They come often from…

  7. Opening Doors to Reading Building School-to-Work Skills

    CERN Document Server

    Fabry, Dee L

    2001-01-01

    This integrated, technology-based reading curriculum helps you build school-to-work skills in middle school learners-especially those who have reading difficulties. Based on a field-tested program (the STARR curriculum), it is specifically designed to meet student needs in the workplace and uses best practices research, SCANS foundations skills and competencies, and middle school research. Components include speaking, technology, analysis, reading, and research.

  8. Separations, Divorces, and Open Marriages in Professional Development School Partnerships.

    Science.gov (United States)

    Teitel, Lee

    1998-01-01

    Reports case studies of 10 partnerships in middle school level professional development schools that either moved apart or reconfigured their relationships over time. Written materials from, interviews with, and observations of partners indicated that though most succeeded, they needed better communication between partners to maximize their…

  9. Investigating the Impact of Schools' Open Space on Learning and Educational Achievement of Elementary Students

    Directory of Open Access Journals (Sweden)

    Abdolreza Gilavand

    2016-04-01

    Full Text Available Background It is obvious that most of informal learnings of social skills and constructive plays occur in school yards and play-fields where children spend much of their non-official time of teaching. This study aimed to investigate the impact of schools' open space on learning and educational achievement of elementary students in Ahvaz, Southwest of Iran. Materials and Methods At a cross-sectional study, 210 students were selected randomly as sample of study. Data collection tools included Hermance’s achievement motivation questionnaire and researcher-constructed questionnaire (observation checklist to examine the physical parameters of learning schools' open space and interviews with students. Data of study were analyzed in SPSS- 21 software. Results Results of this study showed that schools' open space has a significant impact on learning and academic achievement of elementary school students in Ahvaz- Iran (P

  10. The battle about the school building – the history behind the new wave of open plan schools in Norway

    Directory of Open Access Journals (Sweden)

    Erlend Vinje

    2013-09-01

    Full Text Available During the last years we have seen examples of hard battles regarding the architecture of new school buildings in Norway. In this article, I give voice to four central figures in this debate: the former Minister for Education and Research, Kristin Clemet; the leader of the teachers’ union Norsk Lektorlag, Gro Elisabeth Paulsen; the director of the Department for school buildings in Oslo, Harald Øvland; and the last voice belongs to the main safety representative for the teachers in Oslo, Knut Myhrer. These voices will shed light on questions like: who wanted the open plan schools (baseskoler, why the open plan schools were welcomed, who opposed the open plan schools, and why there was opposition. The quartet will also shed light on the eventual relation between the new curriculum reform Knowledge Promotion (Kunnskapsløftet and the new open plan schools, and also to what degree the teachers have participated in the process of developing these new school buildings.

  11. "OpenLAB": A 2-Hour PCR-Based Practical for High School Students

    Science.gov (United States)

    Bouakaze, Caroline; Eschbach, Judith; Fouquerel, Elise; Gasser, Isabelle; Kieffer, Emmanuelle; Krieger, Sophie; Milosevic, Sara; Saandi, Thoueiba; Florentz, Catherine; Marechal-Drouard, Laurence; Labouesse, Michel

    2010-01-01

    The Strasbourg University PhD school in Life and Health Sciences launched an initiative called "OpenLAB." This project was developed in an effort to help high school teenagers understand theoretical and abstract concepts in genetics. A second objective of this program is to help students in defining their future orientation and to…

  12. "OpenLAB": A 2-Hour PCR-Based Practical for High School Students

    Science.gov (United States)

    Bouakaze, Caroline; Eschbach, Judith; Fouquerel, Elise; Gasser, Isabelle; Kieffer, Emmanuelle; Krieger, Sophie; Milosevic, Sara; Saandi, Thoueiba; Florentz, Catherine; Marechal-Drouard, Laurence; Labouesse, Michel

    2010-01-01

    The Strasbourg University PhD school in Life and Health Sciences launched an initiative called "OpenLAB." This project was developed in an effort to help high school teenagers understand theoretical and abstract concepts in genetics. A second objective of this program is to help students in defining their future orientation and to attract them to…

  13. Home schooling as an open-learning educational challenge in ...

    African Journals Online (AJOL)

    Erna Kinsey

    of the community and there were parents who practised home schooling with- .... counteract these problems because parents teaching their children at home ... learners, who had done Outcomes-Based Education up to Grade 9, were eight.

  14. Jane Austen in the High School Classroom (Open to Suggestion).

    Science.gov (United States)

    Fritzer, Penelope

    1996-01-01

    Argues that Jane Austen's novels lend themselves to the high school curriculum, and that students will discover a leisurely, rural world in which the concerns of the young people are often similar to theirs. (SR)

  15. Jane Austen in the High School Classroom (Open to Suggestion).

    Science.gov (United States)

    Fritzer, Penelope

    1996-01-01

    Argues that Jane Austen's novels lend themselves to the high school curriculum, and that students will discover a leisurely, rural world in which the concerns of the young people are often similar to theirs. (SR)

  16. A new detached K7 dwarf eclipsing binary system

    CERN Document Server

    Young, T B; Webb, J K; Ashley, M C B; Christiansen, J L; Derekas, A; Nutto, C

    2006-01-01

    We present an analysis of a new, detached, double-lined eclipsing binary system with K7 Ve components, discovered as part of the University of New South Wales Extrasolar Planet Search. The object is significant in that only 6 other binary systems are known with comparable or lower mass. Such systems offer important tests of mass-radius theoretical models. Follow-up photometry and spectroscopy were obtained with the 40-inch and 2.3m telescopes at SSO respectively. An estimate of the radial velocity amplitude from spectral absorption features, combined with the orbital inclination (83.5 deg) estimated from lightcurve fitting, yielded a total mass of M=(1.041 +/- 0.06)M_sun and component masses of M_A=(0.529 +/- 0.035)M_sun and M_B=(0.512 +/- 0.035)M_sun. The radial velocity amplitude estimated from absorption features (167 +/- 3)kmps was found to be less than the estimate from the H_alpha emission lines (175 +/- 1.5)kmps. The lightcurve fit produced radii of R_A=(0.641 +/- 0.05)R_sun and R_B=(0.608 +/- 0.06)R_s...

  17. Data of evolutionary structure change: 1CLMA-2K7DA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2K7DA 1CLM 2K7D A A LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQN...PT-EAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA GQNPT-EAELQ

  18. Data of evolutionary structure change: 1CLMA-2K7CA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2K7CA 1CLM 2K7C A A LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQN...-PTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA SLGQN-PTEAE

  19. “Opening” a New Kind of School: The Story of the Open High School of Utah

    Directory of Open Access Journals (Sweden)

    DeLaina Tonks

    2013-03-01

    Full Text Available The use of online learning at the primary and secondary school level is growing exponentially in the United States. Much of this growth is with full-time online schools, most of which are operated by for-profit companies that use proprietary online course content. In this article we trace the development of, and philosophy behind, a full-time online school that uses open access software and open educational resources for course content. As more nations begin to put in place plans for primary and secondary education in the event of natural disasters (e.g., the Christchurch earthquakes or pandemics (e.g., avian flu or H1N1, the availability of open online content is of critical importance.

  20. Open pre-schools at integrated health services - A program theory

    Directory of Open Access Journals (Sweden)

    Agneta Abrahamsson

    2013-04-01

    Full Text Available Introduction: Family centres in Sweden are integrated services that reach all prospective parents and parents with children up to their sixth year, because of the co-location of the health service with the social service and the open pre-school. The personnel on the multi-professional site work together to meet the needs of the target group. The article explores a program theory focused on the open pre-schools at family centres. Method: A multi-case design is used and the sample consists of open pre-schools at six family centres. The hypothesis is based on previous research and evaluation data. It guides the data collection which is collected and analysed stepwise. Both parents and personnel are interviewed individually and in groups at each centre. Findings: The hypothesis was expanded to a program theory. The compliance of the professionals was the most significant element that explained why the open access service facilitated positive parenting. The professionals act in a compliant manner to meet the needs of the children and parents as well as in creating good conditions for social networking and learning amongst the parents. Conclusion: The compliance of the professionals in this program theory of open pre-schools at family centres can be a standard in integrated and open access services, whereas the organisation form can vary. The best way of increasing the number of integrative services is to support and encourage professionals that prefer to work in a compliant manner.

  1. Open pre-schools at integrated health services - A program theory

    Directory of Open Access Journals (Sweden)

    Agneta Abrahamsson

    2013-04-01

    Full Text Available Introduction: Family centres in Sweden are integrated services that reach all prospective parents and parents with children up to their sixth year, because of the co-location of the health service with the social service and the open pre-school. The personnel on the multi-professional site work together to meet the needs of the target group. The article explores a program theory focused on the open pre-schools at family centres.Method: A multi-case design is used and the sample consists of open pre-schools at six family centres. The hypothesis is based on previous research and evaluation data. It guides the data collection which is collected and analysed stepwise. Both parents and personnel are interviewed individually and in groups at each centre.Findings: The hypothesis was expanded to a program theory. The compliance of the professionals was the most significant element that explained why the open access service facilitated positive parenting. The professionals act in a compliant manner to meet the needs of the children and parents as well as in creating good conditions for social networking and learning amongst the parents. Conclusion: The compliance of the professionals in this program theory of open pre-schools at family centres can be a standard in integrated and open access services, whereas the organisation form can vary. The best way of increasing the number of integrative services is to support and encourage professionals that prefer to work in a compliant manner.

  2. CERN Accelerator School: Registration open for Advanced Accelerator Physics course

    CERN Multimedia

    2015-01-01

    Registration is now open for the CERN Accelerator School’s Advanced Accelerator Physics course to be held in Warsaw, Poland from 27 September to 9 October 2015.   The course will be of interest to physicists and engineers who wish to extend their knowledge of accelerator physics. The programme offers core lectures on accelerator physics in the mornings and a practical course with hands-on tuition in the afternoons.  Further information can be found at: http://cas.web.cern.ch/cas/Poland2015/Warsaw-advert.html http://indico.cern.ch/event/361988/

  3. CERN Accelerator School: Registration open for Advanced Accelerator Physics course

    CERN Multimedia

    2015-01-01

    Registration is now open for the CERN Accelerator School’s Advanced Accelerator Physics course to be held in Warsaw, Poland from 27 September to 9 October 2015.   The course will be of interest to physicists and engineers who wish to extend their knowledge of Accelerator Physics. The programme offers core lectures on accelerator physics in the mornings and a practical course with hands-on tuition in the afternoons.  Further information can be found at: http://cas.web.cern.ch/cas/Poland2015/Warsaw-advert.html http://indico.cern.ch/event/361988/

  4. Open Government as a Tool to Develop School Choice and School Performance: Analysis of Situation in Republic of Moldova

    Science.gov (United States)

    Pascanean, Ludmila

    2014-01-01

    The Open Government Partnership is an international initiative, committing governments to its principles of transparency. This article examines how it can advance the topic of freedom of educational choice, as it emphasizes the importance of parents' involvement in the decision-making process at the school level. The article is based on the…

  5. Effects of the window openings on the micro-environmental condition in a school bus

    Science.gov (United States)

    Li, Fei; Lee, Eon S.; Zhou, Bin; Liu, Junjie; Zhu, Yifang

    2017-10-01

    School bus is an important micro-environment for children's health because the level of in-cabin air pollution can increase due to its own exhaust in addition to on-road traffic emissions. However, it has been challenging to understand the in-cabin air quality that is associated with complex airflow patterns inside and outside a school bus. This study conducted Computational Fluid Dynamics (CFD) modeling analyses to determine the effects of window openings on the self-pollution for a school bus. Infiltration through the window gaps is modeled by applying variable numbers of active computational cells as a function of the effective area ratio of the opening. The experimental data on ventilation rates from the literature was used to validate the model. Ultrafine particles (UFPs) and black carbon (BC) concentrations were monitored in "real world" field campaigns using school buses. This modeling study examined the airflow pattern inside the school bus under four different types of side-window openings at 20, 40, and 60 mph (i.e., a total of 12 cases). We found that opening the driver's window could allow the infiltration of exhaust through window/door gaps in the back of school bus; whereas, opening windows in the middle of the school bus could mitigate this phenomenon. We also found that an increased driving speed (from 20 mph to 60 mph) could result in a higher ventilation rate (up to 3.4 times) and lower mean age of air (down to 0.29 time) inside the bus.

  6. Some Information about the Opening of Erzincan Orphan School

    Directory of Open Access Journals (Sweden)

    Galip EKEN

    2013-06-01

    Full Text Available The necessity of answering the orphan children’s material andspiritual needs which had increased at important measureduring the World War I become an important social problem inthat era. Not ignoring that important problem did the Ottomanstate opened many orphanages in many province and cities inAnatolia especially in Istanbul. One of them was established inErzincan in 1918. Establishing an orphanage in which the girlsand boys could have live together safely and which had 500beds had started with a decision taken by the central government.In this article some of the ranks about supplying of thefinancial source of the orphanage and the efforts spent for theproviding of the available built shed lights on.

  7. Opening Up the Black Box: Literacy Instruction in Schools Participating in Three Comprehensive School Reform Programs

    Science.gov (United States)

    Correnti, Richard; Rowan, Brian

    2007-01-01

    This study examines patterns of literacy instruction in schools adopting three of America's most widely disseminated comprehensive school reform (CSR) programs (the Accelerated Schools Project, America's Choice, and Success for All). Contrary to the view that educational innovations seldom affect teaching practices, the study found large…

  8. Building Resilience After School for Early Adolescents in Urban Poverty: Open Trial of Leaders @ Play.

    Science.gov (United States)

    Frazier, Stacy L; Dinizulu, Sonya Mathies; Rusch, Dana; Boustani, Maya M; Mehta, Tara G; Reitz, Kristin

    2015-11-01

    Leaders @ Play is a park after-school program for urban middle school youth designed to leverage recreational activities for social emotional learning. Mental health and park staff co-facilitated sports and games to teach and practice problem solving, emotion regulation, and effective communication. Additional practice occurred during multi-family groups and summer internships as junior camp counselors. We examined feasibility and promise via an open trial (n = 3 parks, 46 youth, 100 % African American, 100 % low-income, 59 % female, M = 13.09 years old). Improvements in social skills and reductions in problem behaviors lend support to after school programs as a space for mental health promotion.

  9. High School Teachers' Openness to Adopting New Practices: The Role of Personal Resources and Organizational Climate.

    Science.gov (United States)

    Johnson, Stacy R; Pas, Elise T; Loh, Deanna; Debnam, Katrina J; Bradshaw, Catherine P

    2017-03-01

    Although evidence-based practices for students' social, emotional, and behavioral health are readily available, their adoption and quality implementation in schools are of increasing concern. Teachers are vital to implementation; yet, there is limited research on teachers' openness to adopting new practices, which may be essential to successful program adoption and implementation. The current study explored how perceptions of principal support, teacher affiliation, teacher efficacy, and burnout relate to teachers' openness to new practices. Data came from 2,133 teachers across 51 high schools. Structural equation modeling assessed how organizational climate (i.e., principal support and teacher affiliation) related to teachers' openness directly and indirectly via teacher resources (i.e., efficacy and burnout). Teachers with more favorable perceptions of both principal support and teacher affiliation reported greater efficacy, and, in turn, more openness; however, burnout was not significantly associated with openness. Post hoc analyses indicated that among teachers with high levels of burnout, only principal support related to greater efficacy, and in turn, higher openness. Implications for promoting teachers' openness to new program adoption are discussed.

  10. A Kenyan Cloud School. Massive Open Online & Ongoing Courses for Blended and Lifelong Learning

    Directory of Open Access Journals (Sweden)

    William Jobe

    2013-11-01

    Full Text Available This research describes the predicted outcomes of a Kenyan Cloud School (KCS, which is a MOOC that contains all courses taught at the secondary school level in Kenya. This MOOC will consist of online, ongoing subjects in both English and Kiswahili. The KCS subjects offer self-testing and peer assessment to maximize scalability, and digital badges to show progress and completion to recognize and validate non-formal learning. The KCS uses the Moodle LMS with responsive web design to increase ubiquitous access from any device. Access is free and open, and the KCS intends to be a contextualized open educational resource for formal secondary institutions to support blended learning and a free source of non-formal education for lifelong learning. The expected outcomes are that this effort will reduce secondary school dropout rates, improve test scores, become a quality resource for blended learning, as well as validate and recognize lifelong learning in Kenya.

  11. Which Type of Inquiry Project Do High School Biology Students Prefer: Open or Guided?

    Science.gov (United States)

    Sadeh, Irit; Zion, Michal

    2012-10-01

    In teaching inquiry to high school students, educators differ on which method of teaching inquiry is more effective: Guided or open inquiry? This paper examines the influence of these two different inquiry learning approaches on the attitudes of Israeli high school biology students toward their inquiry project. The results showed significant differences between the two groups: Open inquiry students were more satisfied and felt they gained benefits from implementing the project to a greater extent than guided inquiry students. On the other hand, regarding documentation throughout the project, guided inquiry students believed that they conducted more documentation, as compared to their open inquiry peers. No significant differences were found regarding `the investment of time', but significant differences were found in the time invested and difficulties which arose concerning the different stages of the inquiry process: Open inquiry students believed they spent more time in the first stages of the project, while guided inquiry students believed they spent more time in writing the final paper. In addition, other differences were found: Open inquiry students felt more involved in their project, and felt a greater sense of cooperation with others, in comparison to guided inquiry students. These findings may help teachers who hesitate to teach open inquiry to implement this method of inquiry; or at least provide their students with the opportunity to be more involved in inquiry projects, and ultimately provide their students with more autonomy, high-order thinking, and a deeper understanding in performing science.

  12. Activity, specificity, and probe design for the smallpox virus protease K7L.

    Science.gov (United States)

    Aleshin, Alexander E; Drag, Marcin; Gombosuren, Naran; Wei, Ge; Mikolajczyk, Jowita; Satterthwait, Arnold C; Strongin, Alex Y; Liddington, Robert C; Salvesen, Guy S

    2012-11-16

    The K7L gene product of the smallpox virus is a protease implicated in the maturation of viral proteins. K7L belongs to protease Clan CE, which includes distantly related cysteine proteases from eukaryotes, pathogenic bacteria, and viruses. Here, we describe its recombinant high level expression, biochemical mechanism, substrate preference, and regulation. Earlier studies inferred that the orthologous I7L vaccinia protease cleaves at an AG-X motif in six viral proteins. Our data for K7L suggest that the AG-X motif is necessary but not sufficient for optimal cleavage activity. Thus, K7L requires peptides extended into the P7 and P8 positions for efficient substrate cleavage. Catalytic activity of K7L is substantially enhanced by homodimerization, by the substrate protein P25K as well as by glycerol. RNA and DNA also enhance cleavage of the P25K protein but not of synthetic peptides, suggesting that nucleic acids augment the interaction of K7L with its protein substrate. Library-based peptide preference analyses enabled us to design an activity-based probe that covalently and selectively labels K7L in lysates of transfected and infected cells. Our study thus provides proof-of-concept for the design of inhibitors and probes that may contribute both to a better understanding of the role of K7L in the virus life cycle and the design of novel anti-virals.

  13. Analyzing Inquiry Questions of High-School Students in a Gas Chromatography Open-Ended Laboratory Experiment

    Science.gov (United States)

    Blonder, Ron; Mamlock-Naaman, Rachel; Hofstein, Avi

    2008-01-01

    This paper describes the implementation of an open-ended inquiry experiment for high-school students, based on gas chromatography (GC). The research focuses on identifying the level of questions that students ask during the GC open inquiry laboratory, and it examines whether implementing the advanced inquiry laboratory opens up new directions for…

  14. Transgender Day of Remembrance and a Prospective Student Open House: How One Student Inspired a School to Do Both

    Science.gov (United States)

    Fusarelli, Bonnie C.; Eaton, Lucy E.

    2011-01-01

    This case study explores the challenges a school leader faced when her commitment to diversity was tested by a scheduling conflict. The school principal approved a Transgender Day of Remembrance but then realized that it was scheduled for the same night as the school's Open House to recruit prospective students. The case study provides an…

  15. From "Closing Doors" to "Opening Doors": Exploring gender and subject choice in UK schools

    Science.gov (United States)

    Marks, Ann

    2015-12-01

    Two reports drawing on the National (English) Pupil Database are discussed: the It's Different for Girls and the Closing Doors reports (2012 and 2013, respectively), both of which examine the experience of girls studying physics in England. The UK government has responded to these studies by launching the "Opening Doors" project (June 2014), which will focus on a whole-school approach to addressing gender imbalance in progression to post-16 studies.

  16. DEVELOPING CONCEPTUAL FRAMEWORK FOR REVISING SELF-LEARNING MATERIALS (SLMS OF THE OPEN SCHOOL (OS OF BANGLADESH OPEN UNIVERSITY (BOU AT A DIGITAL ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    Sabina YEASMIN

    2012-07-01

    Full Text Available Bangladesh Open University (BOU runs school programs as part of its academic activities through open schooling since its inception. As of today, the Open School uses the first generation self-learning materials (SLMs written, before an era, following an in-house style and template. The concerned faculty member corrects, every year, texts before the reprint; but this is limited to spelling mistakes, factual errors and page make-ups only. The University has taken policy and steps to revise the texts as a whole which is still limited to the previous process. But; the current government is implementing the agenda of digital Bangladesh which definitely will influence the texts vis-à-vis template, learner’s instructions, gender-sensitiveness, context and content. In addition, education theory has been sifted from instructivism to constructivism which is being experimented and implemented by the Ministerial project entitled Teaching Quality Improvement (TQI partnering with the BOU School of Education with new texts. Time changes, new things are being adopted. Open School also requires revising its texts in relation to the government’s current agenda of implementing the digital Bangladesh. This study collects data from tutors, distance educators, writers and reviewers and finally develops a framework for revising the OS SLMs at a digital environment.

  17. Information and Communication Technologies in Schools. A Handbook for Teachers or How ICT Can Create New, Open Learning Environments

    OpenAIRE

    Mariana Patru

    2006-01-01

    Information and Communication Technologies in Schools. A Handbook for Teachers or How ICT Can Create New, Open Learning Environments (Author Alexey Semenov, edited by Jonathan Anderson, published by UNESCO, Division of Higher Education, Paris, 2005. PP. 240).

  18. Building a whole new mind: an interprofessional experience in patient safety and quality improvement education using the IHI Open School.

    Science.gov (United States)

    Miller, Ryan; Winterton, Tessa; Hoffman, Wendell W

    2014-01-01

    Throughout the last decade, there has been a significant move toward integrating patient safety and quality improvement concepts into health professions education, essentially building a whole new mind in terms of medical knowledge. While existing literature has suggested possible means of implementation, little research has described outcomes and specific examples of integration. The Institute for Healthcare Improvement (IHI) Open School offers a curriculum that could be incorporated in most health professions training. This project serves to study implementation of Open School courses, garner student feedback and guide the implementation of quality and safety curricula across health disciplines in South Dakota. First-year medical and allied health students at the University of South Dakota completed surveys before and after having one introductory lecture and finishing two of the Open School courses in interprofessional teams within an existing health professions course. Medical student means showed significant differences in 16 of 16 (p=0.05) primary teaching points related to Open School course objectives, while allied health students showed significant differences in 13 of 16 (p=0.05) points. Students valued an introductory lecture and thought their educational experience was enhanced by the addition of the Open School courses. Our results demonstrate that the Open School courses chosen for this sample of interprofessional students provide a simple, inexpensive and effective method to implement quality and patient safety concepts within existing health professions curricula.

  19. FOREWORD: International Summer School for Advanced Studies 'Dynamics of open nuclear systems' (PREDEAL12)

    Science.gov (United States)

    Delion, D. S.; Zamfir, N. V.; Raduta, A. R.; Gulminelli, F.

    2013-02-01

    This proceedings volume contains the invited lectures and contributions presented at the International Summer School on Nuclear Physics held at Trei Brazi, a summer resort of the Bioterra University, near the city of Predeal, Romania, on 9-20 July 2012. The long tradition of International Summer Schools on Nuclear Physics in Romania dates as far back as 1964, with the event being scheduled every two years. During this period of almost 50 years, many outstanding nuclear scientists have lectured on various topics related to nuclear physics and particle physics. This year we celebrate the 80th birthday of Aureliu Sandulescu, one of the founders of the Romanian school of theoretical nuclear physics. He was Serban Titeica's PhD student, one of Werner Heisenberg's PhD students, and he organized the first edition of this event. Aureliu Sandulescu's major contributions to the field of theoretical nuclear physics are related in particular to the prediction of cluster radioactivity, the physics of open quantum systems and the innovative technique of detecting superheavy nuclei using the double magic projectile 48Ca (Calcium), nowadays a widely used method at the JINR—Dubna and GSI—Darmstadt laboratories. The title of the event, 'Dynamics of Open Nuclear Systems', is in recognition of Aureliu Sandulescu's great personality. The lectures were attended by Romanian and foreign Master and PhD students and young researchers in nuclear physics. About 25 reputable professors and researchers in nuclear physics delivered lectures during this period. According to a well-established tradition, an interval of two hours was allotted for each lecture (including discussions). Therefore we kept a balance between the school and conference format. Two lectures were held during the morning and afternoon sessions. After lecture sessions, three or four oral contributions were given by young scientists. This was a good opportunity for them to present the results of their research in front of

  20. Visualizing Discipline of the Body in a German Open-Air School (1923-1939): Retrospection and Introspection

    Science.gov (United States)

    Thyssen, Geert

    2007-01-01

    This article considers how historians might use imagery in the context of an open-air school in Germany, Senne I-Bielefeld (1922-1939). In considering the "nature" of such images, issues and problems associated with their interpretation are illuminated and discussed. First, two images selected from the pre-Nazi period of the school are examined…

  1. Authentic school science knowing and learning in open-inquiry science laboratories

    CERN Document Server

    Roth, Wolff-Michael

    1995-01-01

    According to John Dewey, Seymour Papert, Donald Schon, and Allan Collins, school activities, to be authentic, need to share key features with those worlds about which they teach. This book documents learning and teaching in open-inquiry learning environments, designed with the precepts of these educational thinkers in mind. The book is thus a first-hand report of knowing and learning by individuals and groups in complex open-inquiry learning environments in science. As such, it contributes to the emerging literature in this field. Secondly, it exemplifies research methods for studying such complex learning environments. The reader is thus encouraged not only to take the research findings as such, but to reflect on the process of arriving at these findings. Finally, the book is also an example of knowledge constructed by a teacher-researcher, and thus a model for teacher-researcher activity.

  2. Structural basis for targeting of human RNA helicase DDX3 by poxvirus protein K7.

    Science.gov (United States)

    Oda, Shun-Ichiro; Schröder, Martina; Khan, Amir R

    2009-11-11

    Poxviruses are DNA viruses that express numerous proteins to subvert the host immune response. Vaccinia virus protein K7 adopts a Bcl-2 fold and displays structural and functional similarities to Toll-like receptor antagonist A52. Both proteins interact with IRAK2 and TRAF6 and suppress TLR-dependent NF-kappaB activation. However, unlike A52, K7 also forms a complex with RNA helicase DDX3 and antagonizes interferon-beta promoter induction. We have narrowed the K7 binding site to an N-terminal peptide motif of DDX3 ahead of its core RNA-helicase domains. The crystal structure of full-length K7 in complex with the DDX3 peptide reveals a thumblike projection of tandem phenalyalanine residues of DDX3 into a deep hydrophobic cleft. Mutagenesis of these phenylalanines abolishes the effects of DDX3 on interferon-beta promoter induction. The structure of K7-DDX3 reveals a novel binding mode by a viral Bcl-2 protein that antagonizes a key pathway in innate immunity.

  3. An Analysis of Texts in Turkish Coursebooks Studied at Open Education Secondary School

    Directory of Open Access Journals (Sweden)

    Emine KOLAC

    2015-10-01

    Full Text Available Head spinning pace of change and development in information and technology has not yet discredited coursebooks as the major classroom tool and equipment. Coursebooks, as they have always been, are still the primary source and tool of teaching and learning process. As with the mainstream education, well-prepared coursebooks and texts are also a necessity for a high-quality Turkish course within distance education. Distance education is a legitimate education activity providing opportunities for students, teachers, and materials located in different places to meet. All the responsibility of teaching within distance education falls onto the course material. Among the printed materials, it is almost solely the coursebook and class notes that shoulder this responsibility. Texts within the current coursebooks should be analyzed in order to depict the current status, which will help increase the quality of distance education. Designed on the basis of this need, this study is expected to contribute to teaching Turkish through a realistic analysis of the texts in Turkish coursebooks studied at Open Education Secondary School (5th, 6th, 7th, and 8th grades. Bearing a descriptive research design, this paper aims to examine and assess the texts in Turkish coursebooks used in Open Education Secondary School in terms of genre, topic, and moral lessons. Research data has been collected through document analysis, one of the qualitative research methods. Each of 96 texts found in Turkish coursebooks were meticulously analyzed, and findings are presented in frequency tables.

  4. EURAMET.T-K7 Key Comparison of Water Triple-Point Cells

    Science.gov (United States)

    Peruzzi, A.; Bosma, R.; Kerkhof, O.; Rosenkranz, P.; Del Campo Maldonado, M. D.; Strnad, R.; Nielsen, J.; Anagnostou, M.; Veliki, T.; Zvizdic, D.; Grudnewicz, E.; Nedea, M.; Neagu, D. M.; Steur, P.; Filipe, E.; Lobo, I.; Antonsen, I.; Renaot, E.; Heinonen, M.; Weckstrom, T.; Bojkovski, J.; Turzo-Andras, E.; Nemeth, S.; White, M.; Tegeler, E.; Dobre, M.; Duris, S.; Kartal Dogan, A.; Uytun, A.; Augevicius, V.; Pauzha, A.; Pokhodun, A.; Simic, S.

    2011-12-01

    The results of a EURAMET key comparison of water triple-point cells (EURAMET.T-K7) are reported. The equipment used, the measuring conditions applied, and the procedures adopted for the water triple-point measurement at the participating laboratories are synthetically presented. The definitions of the national reference for the water triple-point temperature adopted by each laboratory are disclosed. The multiplicity of degrees of equivalence arising for the linking laboratories with respect to the "mother" comparison CCT-K7 is discussed in detail.

  5. How do children at special schools and their parents perceive their HRQoL compared to children at open schools?

    Directory of Open Access Journals (Sweden)

    Ramma Lebogang

    2010-07-01

    Full Text Available Abstract Background There has been some debate in the past as to who should determine values for different health states for economic evaluation. The aim of this study was to compare the Health Related Quality of Life (HRQoL in children attending open schools (OS and children with disabilities attending a special school (SS and their parents in Cape Town South Africa. Methods The EQ-5D-Y and a proxy version were administered to the children and their parents were requested to fill in the EQ-5D-Y proxy version without consultation with their children on the same day. Results A response rate of over 20% resulted in 567 sets of child/adult responses from OS children and 61 responses from SS children. Children with special needs reported more problems in the "Mobility" and "Looking after myself" domains but their scores with regard to "Doing usual activities", "Pain or discomfort" and "Worried, sad or unhappy" were similar to their typically developing counterparts. The mean Visual Analogue Scale (VAS score of SS children was (88.4, SD18.3, range 40-100 which was not different to the mean score of the OS respondents (87.9, SD16.5, range 5-100. The association between adult and child scores was fair to moderate in the domains. The correlations in VAS scores between Open Schools children and female care-givers' scores significant but low (r = .33, p Discussion It would appear that children with disabilities do not perceive their HRQoL to be worse than their able bodied counterparts, although they do recognise their limitations in the domains of "Mobility" and "Doing usual activities". Conclusions This finding lends weight to the argument that valuation of health states by children affected by these health states should not be included for the purpose of economic analysis as the child's resilience might result in better values for health states and possibly a correspondingly smaller resource allocation. Conversely, if HRQoL is to be used as a clinical

  6. PREFACE: 2nd International School and Conference Saint-Petersburg OPEN on Optoelectronics, Photonics, Engineering and Nanostructures (SPbOPEN2015)

    Science.gov (United States)

    2015-11-01

    The 2nd International School and Conference ''Saint Petersburg OPEN 2015'' on Optoelectronics, Photonics, Engineering and Nanostructures was held on April 6 - 8, 2015 at St. Petersburg Academic University. The School and Conference included a series of invited talks given by leading professors with the aim to introduce young scientists with actual problems and major advances in physics and technology. The keynote speakers were Mikhail V. Maximov (Ioffe Physico-Technical Institute RAS, Russia) Vladimir G. Dubrovskii (St. Petersburg Academic University and St. Petersburg State University, Russia) Anton Yu. Egorov (JSC Connector Optics, Russia) Victor V. Luchinin (St. Petersburg State Electrotechnical University, Russia) Vladislav E. Bugrov (St. Petersburg University of Internet Technologies, Mechanics and Optics, Russia) Vitali A. Schukin (VI Systems, Germany) Yuri P. Svirko (University of Eastern Finland, Finland) During the poster session all undergraduate and graduate students attending the conference presented their works. A sufficiently large number of participants, with more than 170 student attendees from all over the world, allowed the Conference to provide a fertile ground for fruitful discussions between the young scientists as well as to become a perfect platform for valuable discussions between student authors and highly experienced scientists. The best student papers, which were selected by the Program Committee and by the invited speakers basing on the theses and their poster presentation, were awarded with diplomas of the conference - see the photos. This year ''Saint Petersburg OPEN 2015'' is organized by St. Petersburg Academic University in cooperation with Peter the Great St. Petersburg Polytechnic University. The School and Conference is supported by Russian Science Foundation, SPIE (The International Society for Optics and Photonics), OSA (The Optical Society) and by Skolkovo Foundation. It is a continuation of the annual schools and seminars for

  7. Final report on APMP.T-K7 key comparison of water triple point cells

    Science.gov (United States)

    Tsai, S. F.; White, R.; Tamba, J.; Yamazawa, K.; Ho, M. K.; Tsui, C. M.; Zaid, G.; Achmadi, A.; Gam, K. S.; Othman, H.; Ali, N. M.; Yuan, K. H.; Shaochun, Y.; Liedberg, H.; Yaokulbodee, C.

    2016-01-01

    APMP.T-K7, was held from February 2008 to September 2009 to compare the national realizations of the water triple point among eleven NMIs. To reach the objective, each participating laboratory sent a transfer cell to CMS and stated a value for the temperature difference of the transfer cell, relative to the corresponding national standard, representing 273.16 K. CMS (Taiwan) organized the comparison, with the support from co-pilot institutes MSL (New Zealand) and NMIJ (Japan). The other eight participating laboratories included NMIA, SCL, KIM-LIPI, KRISS, NMIM/SIRIM, NMC, NMISA, and NIMT. This report presents the results of the TPW comparison, gives detailed information about the measurements made at the CMS and at the participating laboratories, and aims to link the results of APMP.T-K7 to CCT-K7. The results of this key comparison are also represented in the form of degrees of equivalence for the purposes of the MRA. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  8. High school students' enactment of chemistry knowing in open-entry laboratory investigations

    Science.gov (United States)

    Pilane, Sentsetsa M.

    2003-10-01

    This study is an exploration of student meaning making in a non-traditional, high activity, hands-on grade 12 high school chemistry setting. The study focused on a sequence of three "open-entry" laboratory investigations (i.e., iodine clock reaction, pop-can cell and electroplating). These open-entry laboratory investigations were designed to be flexible and to take place in settings where students could make an impact. Students were responsible for devising their own problem and entry strategy, for making decisions about what reagents to use, what variables to manipulate, and how to proceed to develop the problem to a resolution acceptable to them and to the teacher. To explore students' meaning making in open-entry laboratory settings, their interactions were video taped and samples of their written laboratory reports were collected from time to time. Students were also requested to write reflective notes on their experiences of each investigation, some students were interviewed at the end of the course. This thesis consists of accounts and interpretations of what students did and said as they made meaning in these open-entry, hands-on laboratory investigations. The research uses an enactivist perspective to explore the meanings emerging from the study. From an enactivist view, cognition is seen as perceptually guided action in which a knower brings forth a world of significance with others. Enactivism suggests that students do not only express their knowing in what they say or write but also in their actions with others within this learning community. The research revealed that meaning making in these circumstances was highly complex. It involved systematic trial and error at various levels within the multiple iterative feedback loops. Students' interactions in this setting were mediated by the culture of chemistry which is embodied in the practices of the discipline. With students having to make decisions with every action, their meaning making was not only

  9. The "Open-Earedness" Hypothesis and the Development of Age-Related Aesthetic Reactions to Music in Elementary School Children

    Science.gov (United States)

    Kopiez, Reinhard; Lehmann, Marco

    2008-01-01

    This study investigates age-related changes in musical preference in elementary school children. The tolerance towards unconventional musical styles has been called "open-earedness" (Hargreaves, 1982a), and it is assumed to decline with increasing age. Musical preferences of 186 students from grade 1 to 4 (age range: 6-10 years) were…

  10. Open Day at EVE and School of CERN Staff Association: an opportunity for many parents to discover the structure.

    CERN Document Server

    Staff Association

    2017-01-01

    On Saturday, 4 March 2017, the Children’s Day-Care Centre EVE and School of CERN Staff Association opened its doors to allow interested parents to visit the structure. Staff Association - Carole Dargagnon presents the EVE and school during the open day. This event was a great success and brought together many families. The Open Day was held in two sessions (first session at 10 am and second at 11 am), each consisting in two parts: a general presentation of the structure by the Headmistress Carole Dargagnon, a tour of the installations with Marie-Luz Cavagna and Stéphanie Palluel, the administrative assistants. The management team was delighted to offer parents the opportunity to participate in this pleasant event, where everyone could express themselves, ask questions and find answers in a friendly atmosphere.

  11. Delivering a medical school elective with massive open online course (MOOC) technology.

    Science.gov (United States)

    Robinson, Robert

    2016-01-01

    The educational technology of massive open online courses (MOOCs) has been successfully applied in a wide variety of disciplines and are an intense focus of educational research at this time. Educators are now looking to MOOC technology as a means to improve professional medical education, but very little is known about how medical MOOCs compare with traditional content delivery. A retrospective analysis of the course evaluations for the Medicine as a Business elective by fourth-year medical students at Southern Illinois University School of Medicine (SIU-SOM) for the 2012-2015 academic years was conducted. This course was delivered by small group flipped classroom discussions for 2012-2014 and delivered via MOOC technology in 2015. Learner ratings were compared between the two course delivery methods using routinely collected course evaluations. Course enrollment has ranged from 6-19 students per year in the 2012-2015 academic years. Student evaluations of the course are favorable in the areas of effective teaching, accurate course objectives, meeting personal learning objectives, recommending the course to other students, and overall when rated on a 5-point Likert scale. The majority of all student ratings (76-95%) of this elective course are for the highest possible choice (Strongly agree or Excellent) for any criteria, regardless if the course was delivered via a traditional or MOOC format. Statistical analysis of these ratings suggests that the Effective Teacher and Overall Evaluations did not statistically differ between the two delivery formats. Student ratings of this elective course were highly similar when delivered in a flipped classroom format or by using MOOC technology. The primary advantage of this new course format is flexibility of time and place for learners, allowing them to complete the course objectives when convenient for them. The course evaluations suggest this is a change that is acceptable to the target audience. This study suggests that

  12. KSC Press Site Transformer Bldg. (K7-1205c) SWMU 074 Interim Measure Work Plan

    Science.gov (United States)

    Starr, A. Scott; Applegate, Joe

    2014-01-01

    This document presents and discusses the Interim Measure (IM) Work Plan for the Press Site Transformer Building (K7-1205C). The purpose of the proposed IM activities is to remove soil affected with polychlorinated biphenyls (PCBs) greater than the Florida Department of Environmental Protection (FDEP) residential direct-exposure Soil Cleanup Target Level (R-SCTL) of 0.5 milligrams per kilogram and encapsulate concrete exhibiting PCB concentration greater than the Toxic Substance Control Act (TSCA) threshold of 50 milligrams per kilogram.

  13. The Swedish School and macroeconomic theory: Reflections on a small open economy operating within a regime of flexible exchanges

    Directory of Open Access Journals (Sweden)

    D. TROPEANO

    2013-10-01

    Full Text Available The Swedish School, with its representatives Ohlin, Hammarskjöld and Lindahl, made​important contributions to the economic theory of the open economy, even if such contributions have never been at the centre of attention of economists, probably due to their dark language style. In particular, it had a vision of the operating of an open economy that was completely different from post-war Keynesian orthodoxy. The exchange rate regime does not isolate a small economy from the repercussions of events that occur in financial markets and from goods at the international level. The other major assumption of open economy macroeconomics was the independence of monetary policy. The Keynesian models in the 1950s included only external money. On the contrary, the Swedes considered the credit system and the working of international banks.

  14. A CRITICAL ANALYSIS OF MANAGERIAL SKILLS COMPETENCIES OF SECONDARY SCHOOL HEADS TRAINED THROUGH DISTANCE MODE OF ALLAMA IQBAL OPEN UNIVERSITY

    Directory of Open Access Journals (Sweden)

    Muhammad AKHLAQ

    2010-07-01

    Full Text Available The premise of this article is to analyze the managerial skills competencies of secondary schools heads trained through distance mode of education in Pakistan. For this purpose a sample 300 secondary school teachers and 100 secondary schools head-teachers trained through distance mode and working in the Federal Government Educational Institutions (FGEI functioning under the administration of Pakistan army. The objectives of the study were: 1 to describe the M.Ed programme of AIOU, 2 to identify the managerial skills competencies of secondary school heads trained through Allama Iqbal Open University, 3 to find-out the managerial problems faced by the secondary school heads of FGEI, 4 to suggest some further suggestion to improve the managerial skills competencies of working heads of FGEI. The study focused the following categories of skills, Ø interpersonal communication skills, Ø planning skills, Ø collaboration/ teamwork skills, (iv proficiency skills, Ø organizational skills, Ø feedback skills, Ø basic technology knowledge, and Ø technology access knowledge. Major recommendations of the study were: 1 the scheme of study of M.Ed of Allama Iqbal Open University program be change as per need of administrator and it should focus be on management and administration, 2 For better performance of heads, an induction course covering all the managerial skills relevant to the job principal-sip should be arranged after each term and to be continue through out the service, 3 the present scheme of study of M.Ed program focus on teaching methodology, one additional semester be included that should cover the management courses and ,4 as the present study was delimited to the Federal Governmental Educational Institutions to analyze the managerial skills competencies of working heads of secondary schools. One logical avenue for future is to replicate this study on the whole the country to generalize the results.

  15. Colossal thermoelectric power factor in K 7/8RhO 2

    KAUST Repository

    Saeed, Yasir

    2012-04-12

    The thermoelectric properties of the layered oxides KxRhO 2 (x = 1/2 and 7/8) are investigated by means of the electronic structure, as determined by ab inito calculations and Boltzmann transport theory. In general, the electronic structure of K xRhO 2 is similar to Na xCoO 2, but with strongly enhanced transport. K 7/8RhO 2 exceeds the ultrahigh power factor of Na 0.88CoO 2 reported previously by more than 50%. The roles of the cation concentration and the lattice parameters in the transport properties in this class of compounds are explained. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. DEVELOPING CONCEPTUAL FRAMEWORK FOR REVISING LF-LEARNING MATERIALS (SLMs OF THE OPEN SCHOOL (OS OF BANGLADESH OPEN UNIVERSITY (BOU AT A DIGITAL ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    Sabina YEASMIN

    2011-10-01

    Full Text Available uses the first generation self-learning materials (SLMs written, before an era, following an in-house style and template. The concerned faculty member corrects, every year, texts before the reprint; but this is limited to spelling mistakes, factual errors and page make-ups only. The University has taken policy and steps to revise the texts as a whole which is still limited to the previous process. But; the current government is implementing the agenda of digital Bangladesh which definitely will influence the texts vis-à-vis template, learner’s instructions, gender-sensitiveness, context and content. In addition, education theory has been shifted from instructivism to constructivism which is being experimented and implemented by the Ministerial project entitled Teaching Quality Improvement (TQI partnering with the BOU School of Education with new texts. Time changes, new things are being adopted. Open School also requires revising its texts in relation to the government’s current agenda of implementing the digital Bangladesh. This study collects data from tutors, distance educators, writers and reviewers and finally develops a framework for revising the OS SLMs at a digital environment.

  17. Psychophysiological Characteristics and School Performance of Children in Open and Traditional Classrooms.

    Science.gov (United States)

    Koester, Lynne Sanford; Farley, Frank H.

    1982-01-01

    Children in open and traditional classrooms were observed and tested on physiological and performance measures. The children were categorized into subgroups according to their arousal level. Analyses of variance revealed that performance of high-arousal children in open classrooms decreased over time in contrast to all other subgroups. (Author/AL)

  18. Social Networks and Students' Performance in Secondary Schools: Lessons from an Open Learning Centre, Kenya

    Science.gov (United States)

    Muhingi, Wilkins Ndege; Mutavi, Teresia; Kokonya, Donald; Simiyu, Violet Nekesa; Musungu, Ben; Obondo, Anne; Kuria, Mary Wangari

    2015-01-01

    Given the known positive and negative effects of uncontrolled social networking among secondary school students worldwide, it is necessary to establish the relationship between social network sites and academic performances among secondary school students. This study, therefore, aimed at establishing the relationship between secondary school…

  19. Opening Opportunities through Math Board Games: Collaboration between Schools and a Teacher Education Program

    Science.gov (United States)

    Jimenez-Silva, Margarita; White-Taylor, Janel D.; Gomez, Conrado

    2010-01-01

    As the recession that began in 2008 continues to impact schools at every level, collaboration among educational entities is a matter of survival because public schools and universities are strapped for resources. Therefore, they must reach out and combine their efforts to provide needed services at a minimum cost. A natural partnership exists…

  20. Information and Communication Technologies in Schools A Handbook for Teachers or How ICT Can Create New, Open Learning Environments

    Directory of Open Access Journals (Sweden)

    Ramazan Güzel

    2017-02-01

    Full Text Available Information and Communication Technologies in Schools, a Handbook for Teachers or How ICT can Create New, Open Learning Environments delivers very detailed presentation and utilization of ICT in education. This publication is very good resource to teachers and teacher educators. In reviewing this book, the first thing that attracts the readers’ attention is the layout of the publication. Content, organization, and reference sources are efficient enough for this publication which aims to help teachers while forming new, open learning environments with ICT. However, the cover page image and watermark image in the first nine pages are not very relevant with use of ICT in education. Globe in the UNESCO Headquarter garden and the Eiffel Tower doesn’t make any sense with ICT. Instead of this image, more convenient image could have been selected.   This publication allows the reader to easily follow the use of ICT in the classroom by giving authentic examples. The book is divided into seven chapters and first chapter starts with the background information of the ICT. Second chapter explains very detailed ICT tools used for education. Some tools mentioned in this chapter under storage title have already been outdated. It shows that how fast technology changes and how fast it wears out the old technology. Third chapter mentions about the change in learning environment with the use of ICT by examining it from teachers’ and students’ view. In the fourth chapter, it proposes new pedagogical methods in learning and teaching. In my opinion, this chapter is foremost part of this publication. It explains the organization of the learning process with the use of ICT and examples are can easily be implemented in classrooms. Fifth Chapter describes the place of ICT in school learning activities. This chapter also defines how to structure ICT in school curricula. It gives very good examples but these examples do not relate directly to the teachers because

  1. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The School of Energy Research at Xiamen University(SER-XMU)was founded in 2007,to consolidate and expand research in the areas of Physical Energy,Chemical Energy,Bio-energy,Energy Efficiency and Energy Economics.

  2. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and ex-pand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Econom-ics.

  3. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007,to consolidate and expand research in the areas of Physical Energy,Chemical Energy,Bio-energy,Energy Efficiency and Energy Economics.

  4. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and expand research in the areas of Physical Energy, Chemical Energy, Bioenergy, Energy Efficiency and Energy Econom-

  5. Support for teaching technical subjects at high schools using an open robotic platform

    OpenAIRE

    PRŮCHA, Tomáš

    2015-01-01

    This diploma thesis deals with the use of robotic kits in teaching technical subject at high schools in the Czech Republic. The theoretical part describes the concepts of robotics and pedagogy. It deals with the history, types of robots, describes its components and provides an overview of the available robotic kits. It also examines the concepts and approaches in teaching, goals and activation methods. The results of research among students, alumni and teachers of high schools are summarized...

  6. Effect of Repeated Anthelminthic Treatment on Malaria in School Children in Kenya: A Randomized, Open-Label, Equivalence Trial.

    Science.gov (United States)

    Kepha, Stella; Nuwaha, Fred; Nikolay, Birgit; Gichuki, Paul; Mwandawiro, Charles S; Mwinzi, Pauline N; Odiere, Maurice R; Edwards, Tansy; Allen, Elizabeth; Brooker, Simon J

    2016-01-15

    School children living in the tropics are often concurrently infected with plasmodium and helminth parasites. It has been hypothesized that immune responses evoked by helminths may modify malaria-specific immune responses and increase the risk of malaria. We performed a randomized, open-label, equivalence trial among 2436 school children in western Kenya. Eligible children were randomized to receive either 4 repeated doses or a single dose of albendazole and were followed up during 13 months to assess the incidence of clinical malaria. Secondary outcomes were Plasmodium prevalence and density, assessed by repeat cross-sectional surveys over 15 months. Analysis was conducted on an intention-to-treat basis with a prespecified equivalence range of 20%. During 13 months of follow-up, the incidence rate of malaria was 0.27 episodes/person-year in the repeated treatment group and 0.26 episodes/person-year in the annual treatment group (incidence difference, 0.01; 95% confidence interval, -.03 to .06). The prevalence and density of malaria parasitemia did not differ by treatment group at any of the cross-sectional surveys. Our findings suggest that repeated deworming does not alter risks of clinical malaria or malaria parasitemia among school children and that school-based deworming in Africa may have no adverse consequences for malaria. NCT01658774. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America.

  7. e-Assessment in a Limited-Resources Dental School Using an Open-Source Learning Management System.

    Science.gov (United States)

    El Tantawi, Maha M A; Abdelsalam, Maha M; Mourady, Ahmed M; Elrifae, Ismail M B

    2015-05-01

    e-Assessment provides solutions to some problems encountered in dental students' evaluation. The aim of this study was to evaluate the experience of a limited-resources dental school with e-assessment provided through an open-source learning management system (LMS). Data about users' access and types of e-assessment activities at the Faculty of Dentistry, Alexandria University, Egypt, were obtained from the web-based LMS Moodle. A questionnaire developed to assess students' perceptions of the e-assessment was also sent to students registered in two courses (undergraduate and postgraduate) with the same instructor. The results showed that most e-courses at the school had one form of e-assessment (82%) and, of these, 16.7% had summative assessment activities. There were significant differences among departments in the number of e-courses with e-assessment. One-quarter of e-courses with e-assessment used Moodle quizzes. Of 285 students registered in the two courses that included the questionnaire, 170 responded (response rate=59.6%). The responding students positively perceived the impact of e-assessment on learning and its reliability and security, whereas technical issues and related stresses were negatively perceived. This study suggests that e-assessment can be used at minimal cost in dental schools with limited resources and large class sizes with the least demands on faculty members and teaching staff time. For these schools, an open-source LMS such as Moodle provides formative e-assessment not available otherwise and accommodates various question formats and varying levels of instructors' technical skills. These students seemed to have a positive impression of the e-assessment although technical problems and related stresses are issues that need to be addressed.

  8. CERN-Fermilab Hadron Collider Physics Summer School 2013 open for applications

    CERN Multimedia

    2013-01-01

    Mark your calendar for 28 August - 6 September 2013, when CERN will welcome students to the eighth CERN-Fermilab Hadron Collider Physics Summer School.   Experiments at hadron colliders will continue to provide our best tools for exploring physics at the TeV scale for some time. With the completion of the 7-8 TeV runs of the LHC, and the final results from the full Tevatron data sample becoming available, a new era in particle physics is beginning, heralded by the Higgs-like particle recently discovered at 125 GeV. To realize the full potential of these developments, CERN and Fermilab are jointly offering a series of "Hadron Collider Physics Summer Schools", to prepare young researchers for these exciting times. The school has alternated between CERN and Fermilab, and will return to CERN for the eighth edition, from 28 August to 6 September 2013. The CERN-Fermilab Hadron Collider Physics Summer School is an advanced school which particularly targets young postdocs in exper...

  9. K7del is a common TPM2 gene mutation associated with nemaline myopathy and raised myofibre calcium sensitivity.

    Science.gov (United States)

    Mokbel, Nancy; Ilkovski, Biljana; Kreissl, Michaela; Memo, Massimiliano; Jeffries, Cy M; Marttila, Minttu; Lehtokari, Vilma-Lotta; Lemola, Elina; Grönholm, Mikaela; Yang, Nan; Menard, Dominique; Marcorelles, Pascale; Echaniz-Laguna, Andoni; Reimann, Jens; Vainzof, Mariz; Monnier, Nicole; Ravenscroft, Gianina; McNamara, Elyshia; Nowak, Kristen J; Laing, Nigel G; Wallgren-Pettersson, Carina; Trewhella, Jill; Marston, Steve; Ottenheijm, Coen; North, Kathryn N; Clarke, Nigel F

    2013-02-01

    Mutations in the TPM2 gene, which encodes β-tropomyosin, are an established cause of several congenital skeletal myopathies and distal arthrogryposis. We have identified a TPM2 mutation, p.K7del, in five unrelated families with nemaline myopathy and a consistent distinctive clinical phenotype. Patients develop large joint contractures during childhood, followed by slowly progressive skeletal muscle weakness during adulthood. The TPM2 p.K7del mutation results in the loss of a highly conserved lysine residue near the N-terminus of β-tropomyosin, which is predicted to disrupt head-to-tail polymerization of tropomyosin. Recombinant K7del-β-tropomyosin incorporates poorly into sarcomeres in C2C12 myotubes and has a reduced affinity for actin. Two-dimensional gel electrophoresis of patient muscle and primary patient cultured myotubes showed that mutant protein is expressed but incorporates poorly into sarcomeres and likely accumulates in nemaline rods. In vitro studies using recombinant K7del-β-tropomyosin and force measurements from single dissected patient myofibres showed increased myofilament calcium sensitivity. Together these data indicate that p.K7del is a common recurrent TPM2 mutation associated with mild nemaline myopathy. The p.K7del mutation likely disrupts head-to-tail polymerization of tropomyosin, which impairs incorporation into sarcomeres and also affects the equilibrium of the troponin/tropomyosin-dependent calcium switch of muscle. Joint contractures may stem from chronic muscle hypercontraction due to increased myofibrillar calcium sensitivity while declining strength in adulthood likely arises from other mechanisms, such as myofibre decompensation and fatty infiltration. These results suggest that patients may benefit from therapies that reduce skeletal muscle calcium sensitivity, and we highlight late muscle decompensation as an important cause of morbidity.

  10. Steps to Promote Open and Authentic Dialogue between Teachers and School Management

    Science.gov (United States)

    Klein, Joseph

    2017-01-01

    Purpose: School principals must determine educational policies and make information-based decisions. Teachers have authentic information that they do not transmit in full to the principals. A theoretical model was tested that explains the factors behind this disconnection in communication. Design: Four hundred and forty-five teachers completed…

  11. Opening Schools to All (Women): Efforts to Overcome Gender Violence in Spain

    Science.gov (United States)

    Oliver, E.; Soler, M.; Flecha, R.

    2009-01-01

    This article shows how the dialogic approach adopted by some schools in Spain generates a shift in approaches to gender violence, an issue still not explored in the literature. The shift is from an approach determined mainly by female experts to a dialogic one in which all women, including teachers, mothers, students, sisters, stepsisters,…

  12. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and ex-pand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Econom-ics. SER-XMU is seeking senior scientists and experienced engineers to serve as Thrust Leaders and Principal Inves-tigators.

  13. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and ex-pand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Econom-ics. SER-XMU is seeking senior scientists and experienced engineers to serve as Thrust Leaders and Principal Inves-

  14. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and expand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Economics. SER-XMU is seeking senior scientists and experienced engineers to serve as Thrust Leaders and Principal Investiga-

  15. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and expand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Economics. SER-XMU is seeking senior scientists

  16. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and expand research in the areas of Physical Energy, Chemical Energy, Bio-energy, Energy Efficiency and Energy Economics. SER-XMU is seeking senior scientists and experi-enced engineers to serve as Thrust Leaders and Principal Investigators.

  17. Open Positions for Senior Scientists and Engineers in School of Energy Research at Xiamen University

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The School of Energy Research at Xiamen University (SER-XMU) was founded in 2007, to consolidate and expand research in the areas of Physical Energy, Chemical Energy,Bio-energy, Energy Efficiency and Energy Economics. SER-XMU is seeking senior scientists and experienced

  18. Cultural Connections: Open Your School to the World by Partnering with a Library Abroad

    Science.gov (United States)

    Mann, Carolyn

    2005-01-01

    What school library media coordinator could resist the opportunity to engage students in a cultural exchange with a library elsewhere in the world? Not this one. When the author saw she could use her library to inspire students in rural North Carolina to broaden their understanding of the world, she leaped at the opportunity. She linked the…

  19. Opening Schools to All (Women): Efforts to Overcome Gender Violence in Spain

    Science.gov (United States)

    Oliver, E.; Soler, M.; Flecha, R.

    2009-01-01

    This article shows how the dialogic approach adopted by some schools in Spain generates a shift in approaches to gender violence, an issue still not explored in the literature. The shift is from an approach determined mainly by female experts to a dialogic one in which all women, including teachers, mothers, students, sisters, stepsisters,…

  20. The New Information Literate: Open Collaboration and Information Production in Schools

    Science.gov (United States)

    Forte, Andrea

    2015-01-01

    Widespread participation in collaborative writing and public discourse on blogs, news sites, Wikipedia and other online information sources is creating a new class of information literacy skills. In a series of qualitative studies, I examined high school students' information assessment practices as they helped build a collaborative online…

  1. Religious Released Time Education: The Overlooked Open Door in Public Schools.

    Science.gov (United States)

    Ericsson, Samuel E.; And Others

    This paper presents arguments in favor of, and legal and constitutional guidelines for, religious released time education programs as a workable counterbalance for those concerned with the trend toward secularism in public education. The guidelines are necessarily general, because laws regarding the authority of school districts to adopt released…

  2. Opening the Black Box: Influential Elements of an Effective Urban Professional Development School

    Science.gov (United States)

    Taymans, Juliana; Tindle, Kathleen; Freund, Maxine; Ortiz, Deanna; Harris, Lindsay

    2012-01-01

    The George Washington University's Urban Initiative Professional Development School (UI-PDS) partnership used interviews, surveys, focus groups, and observations to research its effectiveness in preparing urban educators. The research conducted with UI-PDS preservice teachers and first year graduates, indicates they were well equipped to meet the…

  3. School Openness, Parent Participation and Satisfaction: An Exploration of Causal Models.

    Science.gov (United States)

    Spivak, Harriet

    This case study in policy research was prompted by: (1) concern about a methodological issue: how useful are cross-sectional, non-experimental data for answering policy questions?--and, (2) interest in some policy issues raised by the school decentralization/community control controversies and participatory reforms of the 1960s--are participatory…

  4.   Open Source E-learning for Medical Schools in Bosnia-Herzegovina

    DEFF Research Database (Denmark)

    Dørup, Jens; Dahl, Mads Ronald; Simunovic, V.

    2005-01-01

    difficulties and with "brain drainage" of young physicians to more developed countries. Five medical schools, Sarajevo, Banja Luka, Tuzzla, Mostar, and Serb Sarajevo are collaborating in an EU supported Tempus project, Dictum (www.rzuser.uni-heidelberg.de/˜r28/DICTUM/index.php) with the support of EU member...

  5. Opening Pathways for Underrepresented High School Students to Biomedical Research Careers: The Emory University RISE Program

    OpenAIRE

    Rohrbaugh, Margaret C.; Corces, Victor G.

    2011-01-01

    Increasing the college graduation rates of underrepresented minority students in science disciplines is essential to attain a diverse workforce for the 21st century. The Research Internship and Science Education (RISE) program attempts to motivate and prepare students from the Atlanta Public School system, where underrepresented minority (URM) students comprise a majority of the population, for biomedical science careers by offering the opportunity to participate in an original research proje...

  6. The role of the atypical kinases ABC1K7 and ABC1K8 in abscisic acid responses

    Directory of Open Access Journals (Sweden)

    Anna eManara

    2016-03-01

    Full Text Available The ABC1K family of atypical kinases (activity of bc1 complex kinase is represented in bacteria, archaea and eukaryotes. In plants they regulate diverse physiological processes in the chloroplasts and mitochondria, but their precise functions are poorly defined. ABC1K7 and ABC1K8 are probably involved in oxidative stress responses, isoprenyl lipid synthesis and distribution of iron within chloroplasts. Because reactive oxygen species take part in abscisic acid (ABA-mediated processes, we investigated the functions of ABC1K7 and ABC1K8 during germination, stomatal movement and leaf senescence. Both genes were upregulated by ABA treatment and some ABA-responsive physiological processes were affected in abc1k7 and abc1k8 mutants. Germination was more severely affected by ABA, osmotic stress and salt stress in the single and double mutants; the stomatal aperture was smaller in the mutants under standard growth conditions and was not further reduced by exogenous ABA application; ABA-induced senescence symptoms were more severe in the leaves of the single and double mutants compared to wild type leaves. Taken together, our results suggest that ABC1K7 and ABC1K8 might be involved in the cross-talk between ABA and ROS signaling.

  7. PREFACE: 1st International School and Conference "Saint Petersburg OPEN 2014" on Optoelectronics, Photonics, Engineering and Nanostructures

    Science.gov (United States)

    2014-09-01

    Dear Colleagues, 1st International School and Conference "Saint Petersburg OPEN 2014" on Optoelectronics, Photonics, Engineering and Nanostructures was held on March 25 - 27, 2014 at St. Petersburg Academic University - Nanotechnology Research and Education Centre of the Russian Academy of Sciences. The School and Conference included a series of invited talks given by leading professors with the aim to introduce young scientists with actual problems and major advances in physics and technology. The keynote speakers were: Mikhail Glazov (Ioffe Physico-Technical Institute RAS, Russia) Vladimir Dubrovskii (Saint Petersburg Academic University RAS, Russia) Alexey Kavokin (University of Southampton, United Kingdom and St. Petersburg State University, Russia) Vladimir Korenev (Ioffe Physico-Technical Institute RAS, Russia) Sergey Kukushkin (Institute of Problems of Mechanical Engineering RAS, Russia) Nikita Pikhtin (Ioffe Physico-Technical Institute RAS, Russia and "Elfolum" Ltd., Russia) Dmitry Firsov (Saint Petersburg State Polytechnical University, Russia) During the poster session all undergraduate and graduate students attending the conference presented their works. Sufficiently large number of participants with more than 160 student attendees from all over the world allowed the Conference to provide a fertile ground for the fruitful discussions between the young scientists as well as to become a perfect platform for the valuable discussions between student authors and highly experienced scientists. The best student papers, which were selected by the Program Committee and by the invited speakers basing on the theses and their poster presentation, were awarded with diplomas of the conference - see the photos. This year's School and Conference is supported by SPIE (The International Society for Optics and Photonics), OSA (The Optical Society), St. Petersburg State Polytechnical University and by Skolkovo Foundation. It is a continuation of the annual schools and

  8. Opening pathways for underrepresented high school students to biomedical research careers: the Emory University RISE program.

    Science.gov (United States)

    Rohrbaugh, Margaret C; Corces, Victor G

    2011-12-01

    Increasing the college graduation rates of underrepresented minority students in science disciplines is essential to attain a diverse workforce for the 21st century. The Research Internship and Science Education (RISE) program attempts to motivate and prepare students from the Atlanta Public School system, where underrepresented minority (URM) students comprise a majority of the population, for biomedical science careers by offering the opportunity to participate in an original research project. Students work in a research laboratory from the summer of their sophomore year until graduation, mentored by undergraduate and graduate students and postdoctoral fellows (postdocs). In addition, they receive instruction in college-level biology, scholastic assessment test (SAT) preparation classes, and help with the college application process. During the last 4 yr, RISE students have succeeded in the identification and characterization of a series of proteins involved in the regulation of nuclear organization and transcription. All but 1 of 39 RISE students have continued on to 4-year college undergraduate studies and 61% of those students are currently enrolled in science-related majors. These results suggest that the use of research-based experiences at the high school level may contribute to the increased recruitment of underrepresented students into science-related careers.

  9. Digital technologies and open educational resources for inclusion of learners with attention difficulties in mainstream schools

    DEFF Research Database (Denmark)

    Voldborg, Hanne; Sorensen, Elsebeth Korsgaard

    2017-01-01

    The potential of technology for supporting educational processes of participation, collaboration and creation is widely accepted. Likewise have digital tools proved to enhance learning processes for disabled learners. A currently topical group, politically and educationally, in the discourse...... of inclusion is learners with extensive developmental and attention deficit disorders. This paper investigates the potential of technology for supporting the inclusion of this group in the general school system, i.e. into mainstream classes, using technology as a tool to join, participate and contribute...... - and as a vehicle for general human growth in their learning community. The paper presents the primer results and describes and discusses the challenges of both teachers’ and learners’, involved in the inclusion process. Finally, on the basis of findings, a typology of tools is suggested, which may support...

  10. 34 CFR 76.791 - On what basis does an SEA determine whether a charter school LEA that opens or significantly...

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false On what basis does an SEA determine whether a charter school LEA that opens or significantly expands its enrollment is eligible to receive funds under a...? Allocation of Funds by State Educational Agencies § 76.791 On what basis does an SEA determine whether...

  11. Social Support Network for the Elderly Attending the Open University Program for Senior Citizens at the School of Arts, Sciences and Humanities, University of Sao Paulo, Brazil

    Science.gov (United States)

    Domingues, Marisa Accioly; Ordonez, Tiago Nascimento; Lima-Silva, Thais Bento; Torres, Maria Juliana; de Barros, Thabata Cruz; Cachioni, Meire

    2013-01-01

    This study describes the social support network of older adults enrolled in the Open University for Senior Citizens at the School of Arts, Sciences and Humanities, University of Sao Paulo. A cross-sectional study was conducted with a sample of 117 elderly or older adults, mostly female (78%), married (53%), retired (82%), and aged on average…

  12. Questões discursivas para avaliação escolar = Open-ended questions in school tests

    Directory of Open Access Journals (Sweden)

    Maria Auxiliadora Bezerra

    2008-07-01

    Full Text Available O objetivo deste artigo é descrever questões discursivas presentes em atividades escolares do Ensino Médio para avaliação da aprendizagem. Foram estudadas, à luz de teorias sobre atividades e tarefas escolares (Chartrand, 2002, sobre elaboração de provas eexercícios (Moretto, 2005; Bloom, 1973 e sobre perguntas de compreensão (Marcuschi, 1996, 93 questões recolhidas nas disciplinas Literatura Brasileira, História e Geografia. Foram descritas questões (descontextualizadas, propondo, do ponto de vista cognitivo,tarefas funcionais (predominantes, seguidas de formativas e metacognitivas. Seus comandos são dados por meio de pronomes interrogativos (principalmente e de verbos no imperativo ou no infinitivo. As questões focalizam os conteúdos específicos das disciplinas, privilegiando seus conceitos, e enfatizam o desenvolvimento cognitivo dos alunos, sem relação com aspectos sociais. Parece ser suficiente a demonstração passiva de conhecimentoscomo resultado de uma aprendizagem correspondente a acúmulo de informações e de um ensino entendido como repasse de dados.Open-ended questions in high school activities are described to evaluate the learning process. Ninety-three questions fromBrazilian Literature, History and Geography were analyzed, based on school activity and task theories (Chartrand, 2002, test and exercise theories (Moretto, 2005; Bloom, 1973, and comprehension question theories (Marcuschi, 1996. (Decontextualized questions,which propose (predominantly functional, formative and metacognitive tasks, were described from the cognitive point-of-view. Question instructions were given by using (mainly interrogative pronouns and verbs either in the infinitive or in the imperative. Questions focus on the specific contents of the subject matter, emphasizing concepts and the students’ cognitive development, regardless of social aspects. Passive demonstration of knowledge as a result of learning related to collected passive

  13. Study on Opening the School Sports Facilities in Shenyang%沈阳市开放中小学体育设施对策研究

    Institute of Scientific and Technical Information of China (English)

    胡毅军

    2015-01-01

    Shenyang sports facilities construction started late, the status quo of sports facilities can not meet people’s sports event needs. The sports facilities of the majority of schools in Shenyang are idle outside of teaching time. In this case, the paper analyzed the school sports facilities and its opening situation, summarized the experience and problems of opening the school sports facilities in Shenyang, analyzed the relevant researches and practice at home and abroad, put forward the countermeasures of opening school sports facilities in Shenyang.%沈阳市体育设施建设起步较晚,现状体育设施规模不能满足人民群众进行体育活动需求。沈阳市大多数中小学体育设施在教学时间以外,均处于空闲状态。在此情况下,本文对沈阳市中小学体育设施及其开放情况进行分析,总结沈阳市开放中小学体育设施的经验及问题,分析国内外相关研究及实践,提出沈阳市开放中小学体育设施的对策。

  14. Vertex-distinguishing E-total Coloring of Complete Bipartite Graph K7,n when 7≤n≤95

    Institute of Scientific and Technical Information of China (English)

    Chen Xiang-en

    2016-01-01

    Let G be a simple graph. A total coloring f of G is called an E-total coloring if no two adjacent vertices of G receive the same color, and no edge of G receives the same color as one of its endpoints. For an E-total coloring f of a graph G and any vertex x of G, let C (x) denote the set of colors of vertex x and of the edges incident with x, we call C(x) the color set of x. If C(u)=C(v) for any two different vertices u and v of V (G), then we say that f is a vertex-distinguishing E-total coloring of G or a VDET coloring of G for short. The minimum number of colors required for a VDET coloring of G is denoted by χevt(G) and is called the VDET chromatic number of G. The VDET coloring of complete bipartite graph K7,n (7≤n≤95) is discussed in this paper and the VDET chromatic number of K7,n (7≤n≤95) has been obtained.

  15. Leveraging on Easy Java Simulation tool and open source computer simulation library to create interactive digital media for mass customization of high school physics curriculum

    OpenAIRE

    Wee, Loo Kang; Mak, Wai Keong

    2012-01-01

    This paper highlights the diverse possibilities in the rich community of educators from the Conceptual Learning of Science (CoLoS) and Open Source Physics (OSP) movement to engage, enable and empower educators and students, to create interactive digital media through computer modeling. This concept revolves around a paradigmatic shift towards participatory learning through immersive computer modeling, as opposed to using technology for information transmission. We aim to engage high school ed...

  16. K7BM METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  17. Purification and amino acid sequence of a bacteriocins produced by Lactobacillus salivarius K7 isolated from chicken intestine

    Directory of Open Access Journals (Sweden)

    Kenji Sonomoto

    2006-03-01

    Full Text Available A bacteriocin-producing strain, Lactobacillus K7, was isolated from a chicken intestine. The inhibitory activity was determined by spot-on-lawn technique. Identification of the strain was performed by morphological, biochemical (API 50 CH kit and molecular genetic (16S rDNA basis. Bacteriocin purification processes were carried out by amberlite adsorption, cation exchange and reverse-phase high perform- ance liquid chromatography. N-terminal amino acid sequences were performed by Edman degradation. Molecular mass was determined by electrospray-ionization (ESI mass spectrometry (MS. Lactobacillus K7 showed inhibitory activity against Lactobacillus sakei subsp. sakei JCM 1157T, Leuconostoc mesenteroides subsp. mesenteroides JCM 6124T and Bacillus coagulans JCM 2257T. This strain was identified as Lb. salivarius. The antimicrobial substance was destroyed by proteolytic enzymes, indicating its proteinaceous structure designated as a bacteriocin type. The purification of bacteriocin by amberlite adsorption, cation exchange, and reverse-phase chromatography resulted in only one single active peak, which was designated FK22. Molecular weight of this fraction was 4331.70 Da. By amino acid sequence, this peptide was homology to Abp 118 beta produced by Lb. salivarius UCC118. In addition, Lb. salivarius UCC118 produced 2-peptide bacteriocin, which was Abp 118 alpha and beta. Based on the partial amino acid sequences of Abp 118 beta, specific primers were designed from nucleotide sequences according to data from GenBank. The result showed that the deduced peptide was high homology to 2-peptide bacteriocin, Abp 118 alpha and beta.

  18. Transduction of bone marrow cells by the AdZ.F(pK7) modified adenovirus demonstrates preferential gene transfer in myeloma cells.

    Science.gov (United States)

    Gonzalez, R; Vereecque, R; Wickham, T J; Facon, T; Hetuin, D; Kovesdi, I; Bauters, F; Fenaux, P; Quesnel, B

    1999-11-01

    Adenoviral vectors can efficiently infect myeloma cell lines, but transduction of fresh myeloma cells performed at low multiplicity of infections (MOIs) showed only partial efficacy. The modified adenoviral vector AdZ.F(pK7), through binding of polylysines to heparan sulfate-containing receptors, could increase virus adsorption and gene transfer efficiency in myeloma cells, which express heparan sulfate-containing receptors. Thus, we investigated the ability of AdZ.F(pK7) vector to achieve efficient gene transfer in primary cultured fresh myeloma cells. Transduction of 16 primary cultured myeloma samples showed that gene transfer was much more efficient with AdZ.F(pK7) than with control AdZ.F. Both addition of soluble heparin and cell treatment with heparinase I dramatically inhibited gene transfer in myeloma cells by AdZ.F(pK7) but had no effect with AdZ.F, while addition of recombinant fiber protein inhibited AdZ.F but not AdZ.F(pK7), confirming that AdZ.F(pK7) gene transfer in myeloma cells is mediated by the targeting of heparan sulfates. AdZ.F(pK7) transduction of bone marrow cells showed that myeloma cells and hematopoietic progenitor AC133-, CD34-, and CD33-positive cells were efficiently transduced at an MOI of 100, but that only myeloma cells were significantly transduced at an MOI of 12. Thus, AdZ.F(pK7) vector seems to be well suited for immunological approaches of gene therapy or bone marrow-purging applications in multiple myeloma.

  19. Poxvirus K7 protein adopts a Bcl-2 fold: biochemical mapping of its interactions with human DEAD box RNA helicase DDX3.

    Science.gov (United States)

    Kalverda, Arnout P; Thompson, Gary S; Vogel, Andre; Schröder, Martina; Bowie, Andrew G; Khan, Amir R; Homans, Steve W

    2009-01-23

    Poxviruses have evolved numerous strategies to evade host innate immunity. Vaccinia virus K7 is a 149-residue protein with previously unknown structure that is highly conserved in the orthopoxvirus family. K7 bears sequence and functional similarities to A52, which interacts with interleukin receptor-associated kinase 2 and tumor necrosis factor receptor-associated factor 6 to suppress nuclear factor kappaB activation and to stimulate the secretion of the anti-inflammatory cytokine interleukin-10. In contrast to A52, K7 forms a complex with DEAD box RNA helicase DDX3, thereby suppressing DDX3-mediated ifnb promoter induction. We determined the NMR solution structure of K7 to provide insight into the structural basis for poxvirus antagonism of innate immune signaling. The structure reveals an alpha-helical fold belonging to the Bcl-2 family despite an unrelated primary sequence. NMR chemical-shift mapping studies have localized the binding surface for DDX3 on a negatively charged face of K7. Furthermore, thermodynamic studies have mapped the K7-binding region to a 30-residue N-terminal fragment of DDX3, ahead of the core RNA helicase domains.

  20. Let Openness Return to Elementary School Mathematics Classroom Teaching%让开放性回归小学数学课堂教学

    Institute of Scientific and Technical Information of China (English)

    朱雯丽

    2012-01-01

    The new curriculum emphasizes mathematics classroom teaching should cultivate students' thinking ability, open teaching, let students fully, take the initiative to explore, so that every student to become masters of learning, let the classroom teaching alive. But now our primary school mathematics classroom teaching, still with agricultural economy and industrial economy class does not have fundamental change, still retains the" closed" education mode. The author in the long-term teaching foundation, puts forward the primary school mathematics classroom teaching open implementation approach and basic strategy, in order to open the regression of primary school mathematics teaching help.%新课程强调数学课堂教学应从培养学生的思维能力出发,开放教学,让学生全面地、主动地去探索,让每个学生成为学习的主人,让课堂教学焕发生命的活力。但是我们现在的小学数学课堂教学,仍然与农业经济和工业经济时代的课堂一样没有发生根本性的变化,还是保留了那种“封闭式”的教育模式。笔者在长期教学的基础上,提出了小学数学课堂教学开放性的实施途径和基本策略,以期对开放性回归小学数学课堂教学有所帮助。

  1. 开放性网络式高中信息教育的管理%Management of Open Network Information in High School Education

    Institute of Scientific and Technical Information of China (English)

    单祖辉

    2014-01-01

    围绕开放性网络式高中信息教育的管理这一话题展开讨论,阐述我国高中信息教育管理中存在的问题,并针对这些问题提出相应的管理方法,从而使我国高中信息教育的管理水平有所提升。%Around the open network in high school information teaching to discuss, and the author expounds the existing management problems in information education, then puts forward the corresponding management methods to solve problems, in order to improve information teaching management level in high school.

  2. A Far Cry from School History: Massive Online Open Courses as a Generative Source for Historical Research

    Science.gov (United States)

    Gallagher, Silvia; Wallace, Ciaran

    2016-01-01

    Current research into Massive Online Open Courses (MOOCs) has neglected the potential of using learner comments for discipline-specific analysis. This article explores how MOOCs, within the historical discipline, can be used to generate, investigate, and document personal narratives, and argues that they serve as a rich platform for historical…

  3. Free/Libre Open Source Software Implementation in Schools: Evidence from the Field and Implications for the Future

    Science.gov (United States)

    Lin, Yu-Wei; Zini, Enrico

    2008-01-01

    This empirical paper shows how free/libre open source software (FLOSS) contributes to mutual and collaborative learning in an educational environment. Unlike proprietary software, FLOSS allows extensive customisation of software to support the needs of local users better. This also allows users to participate more proactively in the development…

  4. Open Open Fo

    African Journals Online (AJOL)

    Division of Family Medicine and Primary Care, Stellenbosch University. Ainslie G ... Division of Nursing and Midwifery, School of Health and Rehabilitation Sciences, University of Cape Town. Bheekie A ... guidelines with attention to integrating.

  5. European community legislation concerning schools of specialisation in orthodontics: the inexplicable inertia of Italy--contradictions and open issues.

    Science.gov (United States)

    Maino, B Giuliano; Cabrini, Cesare

    2005-01-01

    Orthodontics was the first discipline to be acknowledged as such within the field of dentistry, initially in the USA and subsequently in Europe. The structural changes that led to the birth of the European Union (EU) laid the foundations for the free circulation of professions and services. Nevertheless a deep discrepancy in the quality of training of practitioners from different countries became apparent. It was necessary to address this issue and regulate the training process in order to guarantee a degree of uniformity. Up to this time only the duration of the School of Specialisation in Orthodontics has been set at a minimum of three years. While moving towards an increasing degree of integration of the various EU countries, it becomes paramount to be able to establish a School of Specialisation in Orthodontics with high academic standards based on the Erasmus Programme and above all to be able to award a specialisation degree which is acknowledged first of all in the country where it is issued and also on a wider European level. Freedom of circulation of intellectual activities requires the formal acknowledgement of a qualification, namely the Specialisation in Orthodontics. Also to that end, EFOSA (European Federation of Specialists in Orthodontics) was founded. Furthermore the European Community has, in the meantime, ruled that medical trainees should be remunerated for their work. Dentistry and its specialisations should not follow the model of Medicine given that the two are completely distinct, but many believe that the duration of the School of Specialisation in Orthodontics has to be set as the same as the medical specialisations.

  6. Leveraging on Easy Java Simulation tool and open source computer simulation library to create interactive digital media for mass customization of high school physics curriculum

    CERN Document Server

    Wee, Loo Kang

    2012-01-01

    This paper highlights the diverse possibilities in the rich community of educators from the Conceptual Learning of Science (CoLoS) and Open Source Physics (OSP) movement to engage, enable and empower educators and students, to create interactive digital media through computer modeling. This concept revolves around a paradigmatic shift towards participatory learning through immersive computer modeling, as opposed to using technology for information transmission. We aim to engage high school educators to professionally develop themselves by creating and customizing simulations possible through Easy Java Simulation (Ejs) and its learning community. Ejs allows educators to be designers of learning environments through modifying source codes of the simulation. Educators can conduct lessons with students' using these interactive digital simulations and rapidly enhance the simulation through changing the source codes personally. Ejs toolkit, its library of simulations and growing community contributed simulation cod...

  7. Earth Observation from the ISS Columbus Laboratory- An Open Education Approach to Foster Geographical Competences of Pupils in Secondary Schools

    Science.gov (United States)

    Rienow, Andreas; Graw, Valerie; Heinemann, Sascha; Schultz, Johannes; Seig, Fabian; Menz, Gunter

    2016-08-01

    Since spring 2014, four commercial off-the-shelf cam- eras (COTS) are attached to ESA's Columbus laboratory taking videos of the Earth 24/7. The only European partner of the NASA experiment 'High Definition Earth Viewing' (HDEV) is the educational project 'Columbus Eye - Live-Imagery from the ISS in Schools' (www.columbuseye.uni-bonn.de). In order to implement earth observation techniques for a sustainable use in secondary school lessons, the project develops interactive teaching materials. They enable pupils to apply professional remote sensing analyses. The paper explains the development paradigm of the project rooted in problem-based learning and moderate constructivism. It will be discussed how teachers are provided with didactical commentaries and trained in face-to-face workshops for an efficient and sustainable implementation of the material. In doing so, it is ensured that pupils can experience the value of earth observation and space technologies to monitor ongoing processes of coupled human-environment systems driving the future of the Earth.

  8. Advancing climate literacy in Idaho K-12 schools using STEM education approaches, open source electronics, and Maker culture as vehicles for teacher training

    Science.gov (United States)

    Flores, A. N.; Gelb, L.; Watson, K. A.; Steimke, A.; Chang, C.; Busche, C.; Breidenbach, J.

    2016-12-01

    A climate literate citizenry is essential to the long-term success of climate change adaptation and to enhancing resilience of communities to climate change impacts. In support of a National Science Foundation CAREER award, we developed a teacher training workshop on a project that engages students in creating functioning, low-cost weather stations using open source electronics. The workshop aims to improve climate literacy among K-12 students while providing an authentic opportunity to acquire and hone STEM skills. Each station measures temperature, humidity, barometric pressure, light level, soil moisture, and precipitation occurrence. Our day-long workshop focuses on three elements: (1) providing context on the scientific importance of climate observation, (2) equipping teachers with technical skills needed to assemble and use a station from provided components, and (3) highlighting relevant educational standards met by the weather station activities. The workshop was attended by twelve 4th-9th grade teachers from southwest Idaho, all of whom teach at rural and/or Title I schools. Attendees reported having minimal or no previous experience with open source electronics, but all were able to effectively use their weather station with less than two hours of hands-on training. In written and oral post-workshop reflections teachers expressed a strong desire to integrate these activities into classrooms, but also revealed barriers associated with rigid curricular constraints and risk-averse administrators. Continued evolution of the workshop will focus on: (1) extending the duration and exploratory depth of the workshop, (2) refining pre- and post-assessments and performing longitudinal monitoring of teacher participants to measure short- and long-term efficacy of the workshop, and (3) partnering with colleagues to engage school district administrators in dialog on how to integrate authentic activities like this one into K-12 curriculum.

  9. PREFACE: 17th International School on Condensed Matter Physics (ISCMP): Open Problems in Condensed Matter Physics, Biomedical Physics and their Applications

    Science.gov (United States)

    Dimova-Malinovska, Doriana; Nesheva, Diana; Pecheva, Emilia; Petrov, Alexander G.; Primatarowa, Marina T.

    2012-12-01

    We are pleased to introduce the Proceedings of the 17th International School on Condensed Matter Physics: Open Problems in Condensed Matter Physics, Biomedical Physics and their Applications, organized by the Institute of Solid State Physics of the Bulgarian Academy of Sciences. The Chairman of the School was Professor Alexander G Petrov. Like prior events, the School took place in the beautiful Black Sea resort of Saints Constantine and Helena near Varna, going back to the refurbished facilities of the Panorama hotel. Participants from 17 different countries delivered 31 invited lecturers and 78 posters, contributing through three sessions of poster presentations. Papers submitted to the Proceedings were refereed according to the high standards of the Journal of Physics: Conference Series and the accepted papers illustrate the diversity and the high level of the contributions. Not least significant factor for the success of the 17 ISCMP was the social program, both the organized events (Welcome and Farewell Parties) and the variety of pleasant local restaurants and beaches. Visits to the Archaeological Museum (rich in valuable gold treasures of the ancient Thracian culture) and to the famous rock monastery Aladja were organized for the participants from the Varna Municipality. These Proceedings are published for the second time by the Journal of Physics: Conference Series. We are grateful to the Journal's staff for supporting this idea. The Committee decided that the next event will take place again in Saints Constantine and Helena, 1-5 September 2014. It will be entitled: Challenges of the Nanoscale Science: Theory, Materials and Applications. Doriana Dimova-Malinovska, Diana Nesheva, Emilia Pecheva, Alexander G Petrov and Marina T Primatarowa Editors

  10. Evaluation of the passage of Lactobacillus gasseri K7 and bifidobacteria from the stomach to intestines using a single reactor model

    Directory of Open Access Journals (Sweden)

    von Ah Ueli

    2009-05-01

    Full Text Available Abstract Background Probiotic bacteria are thought to play an important role in the digestive system and therefore have to survive the passage from stomach to intestines. Recently, a novel approach to simulate the passage from stomach to intestines in a single bioreactor was developed. The advantage of this automated one reactor system was the ability to test the influence of acid, bile salts and pancreatin. Lactobacillus gasseri K7 is a strain isolated from infant faeces with properties making the strain interesting for cheese production. In this study, a single reactor system was used to evaluate the survival of L. gasseri K7 and selected bifidobacteria from our collection through the stomach-intestine passage. Results Initial screening for acid resistance in acidified culture media showed a low tolerance of Bifidobacterium dentium for this condition indicating low survival in the passage. Similar results were achieved with B. longum subsp. infantis whereas B. animalis subsp. lactis had a high survival. These initial results were confirmed in the bioreactor model of the stomach-intestine passage. B. animalis subsp. lactis had the highest survival rate (10% attaining approximately 5 × 106 cfu ml-1 compared to the other tested bifidobacteria strains which were reduced by a factor of up to 106. Lactobacillus gasseri K7 was less resistant than B. animalis subsp. lactis but survived at cell concentrations approximately 1000 times higher than other bifidobacteria. Conclusion In this study, we were able to show that L. gasseri K7 had a high survival rate in the stomach-intestine passage. By comparing the results with a previous study in piglets we could confirm the reliability of our simulation. Of the tested bifidobacteria strains, only B. animalis subsp. lactis showed acceptable survival for a successful passage in the simulation system.

  11. Metal ion determinants of conantokin dimerization as revealed in the X-ray crystallographic structure of the Cd(2+)/Mg (2+)-con-T[K7gamma] complex.

    Science.gov (United States)

    Cnudde, Sara E; Prorok, Mary; Castellino, Francis J; Geiger, James H

    2010-06-01

    Predatory sea snails from the Conus family produce a variety of venomous small helical peptides called conantokins that are rich in gamma-carboxyglutamic acid (Gla) residues. As potent and selective antagonists of the N-methyl-D: -aspartate receptor, these peptides are potential therapeutic agents for a variety of neurological conditions. The two most studied members of this family of peptides are con-G and con-T. Con-G has Gla residues at sequence positions 3, 4, 7, 10, and 14, and requires divalent cation binding to adopt a helical conformation. Although both Ca(2+) and Mg(2+) can fulfill this role, Ca(2+) induces dimerization of con-G, whereas the Mg(2+)-complexed peptide remains monomeric. A variant of con-T, con-T[K7gamma] (gamma is Gla), contains Gla residues at the same five positions as in con-G and behaves very similarly with respect to metal ion binding and dimerization; each peptide binds two Ca(2+) ions and two Mg(2+) ions per helix. To understand the difference in metal ion selectivity, affinity, and the dependence on Ca(2+) for dimer formation, we report here the structure of the monomeric Cd(2+)/Mg(2+)-con-T[K7gamma] complex, and, by comparison with the previously published con-T[K7gamma]/Ca(2+) dimer structure, we suggest explanations for both metal ion binding site specificity and metal-ion-dependent dimerization.

  12. Legal Analysis for the Sources of Funds when the School Sports Venues is Open%学校体育场馆开放后经费来源的法理分析

    Institute of Scientific and Technical Information of China (English)

    谭仲秋

    2011-01-01

    According to the results of the survey,one of the main reasons to influence the school sports venues opening to public is:there is no guarantee of funds for the sports facilities to update,maintain and manage.The sources of funds are lacking.Lacking of funds becomes the crucial factor to constrain the school sports venues opening to public.Based on the legal nature of school sports venues opening to public,this article attempts to argue the feasibility of acquiring the funds for the school sports venues opening to public according to current laws.%调查结果显示,影响学校体育场馆开放的主要原因之一是经费没有保障,这导致体育设施的更新、维修、管理等费用无法落实。缺少经费成为制约学校体育场馆开放的一个至关重要的因素。本文以学校体育场馆向社会开放的法律性质为切入点,论证依据现行法律法规获取场馆开放经费的可行性。

  13. SWOT analysis and countermeasure reasearch about the school sports venues(ground) opened to the public%学校体育场馆(地)向社会开放的SWOT分析与对策研究

    Institute of Scientific and Technical Information of China (English)

    梁丹; 董华

    2012-01-01

    Based on the SWOT(strengths,weaknesses,opportunities,threats) analysis about the school sports venues(ground) opened to the public,this paper proposes the establishment of strict management system,strengthening security,actively develop economic sources,handle the relationship between teaching and open to society,give full play of school sports fitness guidance personnel advantages,government-led,school and community participation.%通过对学校体育场馆(地)向社会开放的SWOT(优势、劣势、机遇、威胁)分析,提出了严格规范管理制度、加强安全防护、积极开拓经济来源、处理好教学和开放的关系、政府主导、学校与社区共同参与的对策.

  14. The changes in open inquiry understandings and teaching among pre-service secondary science teachers during their pre-service school practica and student teaching

    Science.gov (United States)

    Martin, Lisa Michelle

    2001-07-01

    The purpose of the study was to examine the development of pre-service science teachers' understandings of inquiry and their change in teaching abilities central to inquiry as they continued through the Secondary Science Teacher Education Program at The University of Iowa. The research procedures consisted of both qualitative and quantitative methods. Quantitatively, the Repeated Measure Multivariate Analysis of Variance (MANOVA) was utilized to check for statistical variance. The Open Inquiry Assessment Rubric was developed as along with the Modified Open Inquiry Framework. The Modified OIF was used to interpret the quantitative data obtained from the OIAR into categorical levels of inquiry. The interview data were assessed in many ways. Specific criteria were created in quantifying subjects' responses. Qualitative data were obtained through student teacher interviews. Qualitative data were used to assist the researcher in explaining results of quantitative data as well as measuring topics that are difficult to measure using quantitative methods. Major findings include: (1) Statistically significant positive trends in the means indicate that change is taking place over time in secondary science pre-service teachers' understanding and ability to teach using an inquiry method. (2) Pre-service teachers are generally in the developmental stage of actualization regarding inquiry teaching. They are able to teach an inquiry lesson yet it is not a regular part of their teaching. (3) Pre-service teachers indicate through interview responses that cooperating teachers do have an influence upon their views of inquiry, whether positive or negative. (4) Student teachers, during student teaching, revert somewhat to their former understandings of science teaching similar to their own high school learning experiences. (5) As additional science teaching methods courses are completed, there is a positive trend, statistically significant, in pre-service teachers' understandings of

  15. 关于中职学校开设数据库课程的思考%Reflections on Opening Database Application Course in Secondary Vocational Schools

    Institute of Scientific and Technical Information of China (English)

    陈宗林

    2013-01-01

      本文主要阐述中等职业学校计算机及相关专业开设数据库应用课程的几点思考。根据计算机及相关专业的特点,结合实际教学经验,以实际数据库应用课程为例,阐述数据库语言的选择、教材的选择、网络环境辅助教学以及常用的教学模式等。%This paper mainly expounds reflections on opening database application course in computer and related specialty in secondary vocational schools. According to the characteristics of computers and related specialty, combined with the practical teaching experience, with the actual database application course as an example, the paper elaborates the choice of the database language, the choice of teaching materials and network aided teaching as well as the commonly used teaching mode.

  16. Wisconsin Charter Schools, 2000.

    Science.gov (United States)

    Benson, John T.; Fortier, John; Allen, Lawrence; Wicklund, Dennis

    This report consists of a state summary of Wisconsin charter schools, a description of each charter school in operation, a description of charter schools opened in 2000, and appendixes listing teaching requirements for charter schools, Wisconsin Charter School law, and the chartering authority for each charter school. The state summary includes a…

  17. Van: An Open Letter

    Science.gov (United States)

    Tieman, John Samuel

    2011-01-01

    This essay is an open letter from a classroom teacher to a concerned citizen. The letter lists a variety of problems caused largely by standardization and the more corrosive effects of positivism. Many of these problems are unknown to those outside the immediate school setting. While the letter focuses on a specific setting, an inner city school…

  18. Prospective, naturalistic study of open-label OROS methylphenidate treatment in Chinese school-aged children with attention-deficit/hyperactivity disorder

    Institute of Scientific and Technical Information of China (English)

    ZHENG Yi; GONG Mei-en; YIN Qing-yun; MAI Jian-ning; JING Jin; LUO Xiang-yang; MA Hong-wei; LI Hai-bo; XIE Ling; LI Yan; Kuang Gui-fang; WANG Yu-feng; YI Ming-ji; WANG Feng; ZHU Xiao-hua; YAO Yah-bin; QIN Jiong; WANG Li-wen; ZOU Li-ping; JIN Xing-ming; XU Tong; WANG Yi; QI Yuan-li

    2011-01-01

    ).No serious adverse events were reported during the study.Conclusion This open-label,naturalistic study provides further evidence of effectiveness and safety of OROS-MPH in school-aged children under routine practice.

  19. Open access

    NARCIS (Netherlands)

    Valkenburg, P.M.

    2015-01-01

    Open access week Van 19 tot en met 25 oktober 2015 vond wereldwijd de Open Access Week plaats. Tijdens deze week werden er over de hele wereld evenementen georganiseerd waar open access een rol speelt. Ook in Nederland zijn er diverse symposia, workshops en debatten georganiseerd zoals het debat in

  20. K7R3 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  1. K7S1 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  2. K7R5 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  3. Synthesis and 183W NMR Characterization of a-K7GaW11(TiO2)O39×11H2O Heteropolyanion

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The peroxotitanium-substituted heteropolytungstate a-K7GaW11(TiO2)O39×11H2O has been synthesized and characterized by elemental analysis, IR, UV, 183W NMR and electrochemistry. 183W NMR spectrum consists of six lines with intensity ratio 2:2:1:2:2:2, indicated that the TiO2 occupied the empty octahedral site of the GaW11 anion forming a polyanion with Cs symmetry. The characteristic charge-transfer absorption band O22-?Ti at 385 nm occurs in the UV spectrum. The polarographic reduction potential of O22- at ca.+0.87 V has been found.

  4. Genetic mapping and biochemical characterization of suppressor mutations sukA and sukB for a dnaK7(Ts) mutation of Escherichia coli K-12.

    Science.gov (United States)

    Itikawa, H; Mishina, Y; Wada, M; Fujita, H

    1992-02-01

    Temperature-resistant pseudorevertants were isolated from a dnaK7(Ts) mutant of Escherichia coli K-12. Two of these pseudorevertants were shown to carry suppressor mutations, sukA and sukB, respectively. Genetic mapping by conjugation and P1-transduction revealed that these suppressor mutations were located at two distinct sites between 76 and 77 min close to the suhA and rpoH genes. Labeled cellular proteins were extracted from suppressor mutants grown at various temperatures and subjected to SDS-gel electrophoresis. Autoradiograms of the gels indicated that these suppressor mutations each resulted in increased synthesis of the heat shock protein Lon (an ATP-dependent protease, La) at both permissive and nonpermissive temperatures.

  5. Next Stop: OpenSim!

    Science.gov (United States)

    Korolov, Maria

    2011-01-01

    Unhappy with conditions in Second Life, educators are migrating to a developing virtual world that offers them greater autonomy and a safer platform for their students at far less a cost. OpenSimulator is an open source virtual world platform that schools can run for free on their own servers or can get cheaply and quickly--the space can be up and…

  6. Exploration of the Moon and Asteroids by Secondary Students (ExMASS): An Authentic, Open-Inquiry Research Experience for High School Students

    Science.gov (United States)

    Shaner, A. J.; Allen, J. S.; Shipp, S. S.; Kramer, G. Y.; Nahm, A.; Balazs, L.; Fuller, J.; Newland, J.; Snyder, R. D.; Kring, D. A.

    2014-12-01

    The National Research Council (2012) has expressed a need for participatory science experiences for students. Opportunities are needed for students which 1) allow them to understand how scientific knowledge develops and 2) can heighten their curiosity, capture their interest, and motivate their continued study of science. Studies (e.g., Aydeniz et al., 2011) have also recommend educators provide students with opportunities to do science through extracurricular work with scientists. In addition to being given the opportunity to fully participate in the scientific enterprise, students must also be explicitly guided in their attempts to develop a more appropriate understanding of the nature of the scientific enterprise (McDonald, 2010; Rudge & Howe, 2010; Yacoubian & BouJaoude, 2010). Exploration of the Moon and Asteroids by Secondary Students, or ExMASS, provides such an opportunity for students. The ExMASS program is an education effort managed by the LPI/NASA JSC-led Center for Lunar Science and Exploration (CLSE), one of nine teams comprising NASA's Solar System Exploration Research Virtual Institute (SSERVI). Over the course of one academic year, teams of high school students conduct their own scientific investigations of either Earth's Moon or asteroids, with guidance from a scientist mentor. The program includes two elements: 1) a guided inquiry introductory research activity that builds student knowledge of current lunar/asteroid science and lunar/asteroid data, and 2) an open inquiry research project in which the students apply their knowledge to a self-defined project. Evaluation data collected during the predecessor program to ExMASS revealed many successes, but also room for improvement. In response, an Advisory Group consisting of past teachers and mentors was formed to address the gaps revealed in the evaluation data. The ExMASS program will continue to collect similar evaluation data including assessment of changes in students' lunar/asteroid content

  7. Athletic Recruitment in Wisconsin Public and Non-Public High Schools: The Effect of Inter-District Open Enrollment and outside the Geographic Area on Varsity Basketball Participation

    Science.gov (United States)

    Refsland, Randall G.

    2009-01-01

    The Wisconsin Interscholastic Athletic Association is the governing body for high school athletics in the State of Wisconsin. For some time they have been concerned with the growing perception that there is recruitment occurring in varsity basketball within its member schools. The purpose of this mixed methods study was to determine what, if any,…

  8. Open hardware for open science

    CERN Multimedia

    CERN Bulletin

    2011-01-01

    Inspired by the open source software movement, the Open Hardware Repository was created to enable hardware developers to share the results of their R&D activities. The recently published CERN Open Hardware Licence offers the legal framework to support this knowledge and technology exchange.   Two years ago, a group of electronics designers led by Javier Serrano, a CERN engineer, working in experimental physics laboratories created the Open Hardware Repository (OHR). This project was initiated in order to facilitate the exchange of hardware designs across the community in line with the ideals of “open science”. The main objectives include avoiding duplication of effort by sharing results across different teams that might be working on the same need. “For hardware developers, the advantages of open hardware are numerous. For example, it is a great learning tool for technologies some developers would not otherwise master, and it avoids unnecessary work if someone ha...

  9. Open Access

    Science.gov (United States)

    Suber, Peter

    2012-01-01

    The Internet lets us share perfect copies of our work with a worldwide audience at virtually no cost. We take advantage of this revolutionary opportunity when we make our work "open access": digital, online, free of charge, and free of most copyright and licensing restrictions. Open access is made possible by the Internet and copyright-holder…

  10. Open Access

    Science.gov (United States)

    Suber, Peter

    2012-01-01

    The Internet lets us share perfect copies of our work with a worldwide audience at virtually no cost. We take advantage of this revolutionary opportunity when we make our work "open access": digital, online, free of charge, and free of most copyright and licensing restrictions. Open access is made possible by the Internet and copyright-holder…

  11. Investigation and Consideration on Opening School Affairs to the Public in Local College of Shaanxi%关于陕西地方高校校务公开问题的调查与思考

    Institute of Scientific and Technical Information of China (English)

    张亚强; 杨岩菊

    2011-01-01

    Opening school affairs to the public in the college have placed the public power under the supervision of the masses, so that the majority of staff really enjoy the power of democratic management and democratic supervision. It has been found that it is very necessary to define the opened content in college of Shaanxi. Opening school affairs is a long process, and many problems still exist, which requires the majority of staff to improve public service work, guiding by scientific thought of development.%校务公开将高校享有的公共权力置于群众的监督之下,使广大教职工真正地事有民主管理、民主监督的权力.实践证明,非常有必要对陕西地方高校校务公开的内容进行界定;校务公开是一个长期的过程,目前还存在着不少问题,需要广大教职工坚持不懈的用科学发展观来指导完善校务公开工作.

  12. Open secrets

    Science.gov (United States)

    Holzman, Malcolm; Beglarian, Eve; Bahn, Curtis

    2004-05-01

    In 1998, the Schools of Architecture and Humanities at the Rensselaer Polytechnic Institute initiated a collaborative project between students of both schools to develop a musical performance piece that would be presented in an environment to be designed and built in the Art Gallery of the School of Architecture. Students from both Schools were to work together on developing the content and conceptualizing the built environment. Architects Malcolm Holzman and Nestor Bottino of the firm of HHPA were brought in as advisors to the project, as was Composer Eve Beglarian of Twisted Tutu. Curtis Bahn, Director of the iEAR Studio at RPI, was Academic Coordinator for the project, together with Beth Weinstein, Professor, School of Architecture, and Grethe Holby, who directed the performance. This paper will review the academic raison d'etre for organizing such a program, discuss the history of the project as it developed, and present a video tape of portions of the finished performance.

  13. The radii of the nearby K5V and K7V stars 61 Cyg A & B - CHARA/FLUOR interferometry and CESAM2k modeling

    CERN Document Server

    Kervella, Pierre; Pichon, Bernard; Thévenin, Frédéric; Heiter, Ulrike; Bigot, Lionel; Brummelaar, Theo A Ten; Mcalister, Harold A; Ridgway, Stephen T; Turner, Nils; Sturmann, Judit; Sturmann, Laszlo; Goldfinger, P J; Farrington, Christopher

    2008-01-01

    Context: The main sequence binary star 61 Cyg (K5V+K7V) is our nearest stellar neighbour in the northern hemisphere. This proximity makes it a particularly well suited system for very high accuracy interferometric radius measurements. Aims: Our goal is to constrain the poorly known evolutionary status and age of this bright binary star. Methods: We obtained high accuracy interferometric observations in the infrared K' band, using the CHARA/FLUOR instrument. We then computed evolutionary models of 61 Cyg A & B with the CESAM2k code. As model constraints, we used a combination of observational parameters from classical observation methods (photometry, spectroscopy) as well as our new interferometric radii. Results: The measured limb darkened disk angular diameters are theta_LD(A) = 1.775 +/- 0.013 mas and theta_LD(B) = 1.581 +/- 0.022 mas, respectively for 61 Cyg A and B. Considering the high accuracy parallaxes available, these values translate into photospheric radii of R(A) = 0.665 +/- 0.005 Rsun and R(B...

  14. TWO PLANETARY COMPANIONS AROUND THE K7 DWARF GJ 221: A HOT SUPER-EARTH AND A CANDIDATE IN THE SUB-SATURN DESERT RANGE

    Energy Technology Data Exchange (ETDEWEB)

    Arriagada, Pamela; Minniti, Dante [Department of Astronomy, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Anglada-Escude, Guillem; Butler, R. Paul [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015-1305 (United States); Crane, Jeffrey D.; Shectman, Stephen A.; Thompson, Ian [The Observatories of the Carnegie Institution of Washington, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Wende, Sebastian, E-mail: parriaga@astro.puc.cl [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, D-37077 Goettingen (Germany)

    2013-07-01

    We report two low-mass companions orbiting the nearby K7 dwarf GJ 221 that have emerged from reanalyzing 4.4 yr of publicly available HARPS spectra complemented with 2 years of high-precision Doppler measurements with Magellan/PFS. The HARPS measurements alone contain the clear signal of a low-mass companion with a period of 125 days and a minimum mass of 53.2 M{sub Circled-Plus} (GJ 221b), falling in a mass range where very few planet candidates have been found (sub-Saturn desert). The addition of 17 PFS observations allows the confident detection of a second low-mass companion (6.5 M{sub Circled-Plus }) in a hot orbit (3.87 day period, GJ 221c). Spectroscopic and photometric calibrations suggest that GJ 221 is slightly depleted ([Fe/H] {approx} -0.1) compared to the Sun, so the presence of two low-mass companions in the system confirms the trend that slightly reduced stellar metallicity does not prevent the formation of planets in the super-Earth to sub-Saturn mass regime.

  15. Open Source and Open Standards

    NARCIS (Netherlands)

    Koper, Rob

    2006-01-01

    Publication reference: Koper, R. (2008). Open Source and Open Standards. In J. M. Spector, M. Merrill, J. van Merriënboer & M. P. Driscol (Eds.), Handbook of Research on Educational Communications and Technology (3rd ed., pp. 355-368). New York: Routledge.

  16. 上海市试点中小学体育场馆对外开放现状%The Current Situations of Opening-up of the Sports Venues of Experimental Middle and Primary Schools in Shanghai

    Institute of Scientific and Technical Information of China (English)

    王哲; 梁红霞; 舒盛芳

    2011-01-01

    The questionnaire and interview surveys of the present situation of the sports venues' opening up to the public in some experimental middle and primary schools in Shanghai were conducted to explore and analyze the effect of the sports resource sharing with the society.The results show: the school leaders have high theoretical level of awareness and positive attitudes towards the opening up to the public of the school sports venues,not enough support to the further and larger opening up;those which have opened up are mainly outdoor sports venues,and the opening time and items are far away from the demand of the public;the organizing of the mass activities and management of the sports venues still need solving;the operation mode of the government buying the service,the market sharing the risk and the society involving in the management is the system guarantee to promote the school sports venues to open up to the public.The paper suggests: make a further study of the policies and measures of the public sports resources and strengthen publicity;speed up the construction and integration of urban sports resources and gradually realize the balance of regional sports resources in the development;give great support to the non-profit and profit public sports and culture service institutions in charge of the management of the school sports venues opening up.%运用问卷调查法和访谈法等方法,对上海市试点中小学校体育场馆对外开放现状进行调查,探析学校体育场馆资源与社会共享的效果.结果表明:学校领导对开放学校体育场馆具有较高的理论认识水平和较积极的态度,但对进一步加大体育场馆对外开放力度的支持不够;对外开放主要是室外体育场馆,对外开放的时间和项目与群众需求有较大差别;群众活动的组织与体育场馆的管理问题仍是需要进一步解决的问题;政府购买服务、市场分担风险、社会参与管理的运作模式是推动

  17. Open IS

    DEFF Research Database (Denmark)

    Germonprez, Matt; Crowston, Kevin; Avital, Michel

    2013-01-01

    The collective intelligence and collective action of “open” communities have produced a variety of complex knowledge goods and radical social change. The Information Systems (IS) community has invested significant effort into researching open communities and the ecosystems in which they operate...... therefore seeks to stimulate a thoughtful and dynamic discussion around the proposition that becoming a more open community will enhance the IS discipline’s scholarly inquiry and global impact....

  18. Open IS

    DEFF Research Database (Denmark)

    Germonprez, Matt; Crowston, Kevin; Avital, Michel

    2013-01-01

    The collective intelligence and collective action of “open” communities have produced a variety of complex knowledge goods and radical social change. The Information Systems (IS) community has invested significant effort into researching open communities and the ecosystems in which they operate...... therefore seeks to stimulate a thoughtful and dynamic discussion around the proposition that becoming a more open community will enhance the IS discipline’s scholarly inquiry and global impact....

  19. School Competition and Efficiency with Publicly Funded Catholic Schools

    OpenAIRE

    David Card; Martin Dooley; Abigail Payne

    2010-01-01

    The province of Ontario has two publicly funded school systems: secular schools (known as public schools) that are open to all students, and separate schools that are open to children with Catholic backgrounds. The systems are administered independently and receive equal funding per student. In this paper we use detailed school and student-level data to assess whether competition between the systems leads to improved efficiency. Building on a simple model of school choice, we argue that incen...

  20. Open access

    CERN Document Server

    Suber, Peter

    2012-01-01

    The Internet lets us share perfect copies of our work with a worldwide audience at virtually no cost. We take advantage of this revolutionary opportunity when we make our work "open access": digital, online, free of charge, and free of most copyright and licensing restrictions. Open access is made possible by the Internet and copyright-holder consent, and many authors, musicians, filmmakers, and other creators who depend on royalties are understandably unwilling to give their consent. But for 350 years, scholars have written peer-reviewed journal articles for impact, not for money, and are free to consent to open access without losing revenue. In this concise introduction, Peter Suber tells us what open access is and isn't, how it benefits authors and readers of research, how we pay for it, how it avoids copyright problems, how it has moved from the periphery to the mainstream, and what its future may hold. Distilling a decade of Suber's influential writing and thinking about open access, this is the indispe...

  1. Open Brief

    Directory of Open Access Journals (Sweden)

    Andrew Leach

    2013-11-01

    Full Text Available To commence the thirtieth annual conference of the Society of Architectural Historians, Australia and New Zealand (SAHANZ, held on Australia’s Gold Coast in July 2013, ten delegates were invited with very little warning to take five minutes and one image to offer a provocation on the open matters of architectural history in the present moment. The term “open” was taken as the conference theme—a device used by SAHANZ meetings not so much to define the scope of papers presented as to declare the conference flavour year by year. It was not, therefore, an open conference (anything goes so much as a conference on open issues (where, indeed, to go.  The ten interlocutors were invited after the conference to document their interventions and they are presented here as a record of the preoccupations of a specific moment and institutional geography with all the idiosyncrasies and commonalities it might reveal to a broader audience.

  2. Development of Open-Ended Problems for Measuring The Higher-Order-Thinking-Skills of High School Students on Global Warming Phenomenon

    Science.gov (United States)

    Fianti; Najwa, F. L.; Linuwih, S.

    2017-04-01

    Higher-order-thinking-skills can not be developed directly, except by training which is employing open-ended problems for measuring and developing critics, creativeness, and problem-solving thinking-skills of students. This study is a research and development producing open-ended problems. The purpose of this study is to measure the properness and effectiveness of the developed product and to observe the profile of higher-order-thinking-skills of students on global warming phenomenon. The result of properness test of open-ended problems according to the experts is 92,59% on the first stage and 97,53% on the second stage, so we can assume that the product isvery proper. The result of effectiveness test shows the coefficient of correlation between student’s midterm test scores and open-ended questions is 0,634 which is in the category of strong. Higher-order-thinking-skills of SMA Negeri 1 Salatiga students is in the category of good with the average achievement scores 61,28.

  3. Open Field Test; Technical Report 14. Disadvantaged Children and Their First School Experiences. ETS-Head Start Longitudinal Study. Technical Report Series.

    Science.gov (United States)

    Ward, William C.

    The Open Field Test was used to assess variables that might not be manifested in a more standard testing situation. In this test, the child was shown 10 standard play objects in the room, and was told to do anything he wished with the toys. The tester initiated no interaction with the child and responded minimally to any overture made by the…

  4. Open Education and the Open Science Economy

    Science.gov (United States)

    Peters, Michael A.

    2009-01-01

    Openness as a complex code word for a variety of digital trends and movements has emerged as an alternative mode of "social production" based on the growing and overlapping complexities of open source, open access, open archiving, open publishing, and open science. This paper argues that the openness movement with its reinforcing structure of…

  5. The Open

    Directory of Open Access Journals (Sweden)

    Saitya Brata Das

    2009-12-01

    Full Text Available In the Open darkness and light, remembrance and oblivion, coming into existence and disappearing in death play their originary co-belonging, or co-figuration. Existence belongs to this opening and is exposed to its coming to presence: it is on the basis of this originary opening, this originary historical which is revealed to this mortal being called ‘man,’ on the basis of this revelation, man founds something like politics and history. There thus comes into existence out of this freedom, out of this “play space”2, this field called ‘polis’3 where there takes place war and festival, where historical revolutions tear apart history, brings ruptures and discontinuities in the very mode of his existence, where man seeks the foundation of his own foundation (which is his metaphysical task , where occurs the dialectics of negativity between man and man, where man puts at stake his own death, his own dissolution, and by the power of his own dissolution stands in relation to the total world that he seeks to dominate. This means that man’s attempts to metaphysically found his own political and historical existence must presuppose a far more originary non-foundation, the differentiating revealing of the open, the ungrounded spacing play, or playing space of natality and mortality.

  6. Open innovation

    DEFF Research Database (Denmark)

    West, Joel; Bogers, Marcel

    2017-01-01

    by small, new, and not-for-profit organizations, as well as the linkage of individual actions and motivations to open innovation. Other opportunities include better measuring the costs, benefits, antecedents, mediators and moderators of the effects of OI on performance, and understanding why and how OI...

  7. Administration of probiotics Lactobacillus rhamnosus GG and Lactobacillus gasseri K7 during pregnancy and lactation changes mouse mesenteric lymph nodes and mammary gland microbiota.

    Science.gov (United States)

    Treven, P; Mrak, V; Bogovič Matijašić, B; Horvat, S; Rogelj, I

    2015-04-01

    The milk and mammary gland (MG) microbiome can be influenced by several factors, such as mode of delivery, breastfeeding, maternal lifestyle, health status, and diet. An increasing number of studies show a variety of positive effects of consumption of probiotics during pregnancy and breastfeeding on the mother and the newborn. The aim of this study was to investigate the effect of oral administration of probiotics Lactobacillus gasseri K7 (LK7) and Lactobacillus rhamnosus GG (LGG) during pregnancy and lactation on microbiota of the mouse mesenteric lymph nodes (MLN), MG, and milk. Pregnant FVB/N mice were fed skim milk or probiotics LGG or LK7 resuspended in skim milk during gestation and lactation. On d 3 and 8 postpartum, blood, feces, MLN, MG, and milk were analyzed for the presence of LGG or LK7. The effects of probiotics on MLN, MG, and milk microbiota was evaluated by real-time PCR and by 16S ribosomal DNA 454-pyrosequencing. In 5 of 8 fecal samples from the LGG group and in 5 of 8 fecal samples from the LK7 group, more than 1 × 10(3) of live LGG or LK7 bacterial cells were detected, respectively, whereas no viable LGG or LK7 cells were detected in the control group. Live lactic acid bacteria but no LGG or LK7 were detected in blood, MLN, and MG. Both probiotics significantly increased the total bacterial load as assessed by copies of 16S ribosomal DNA in MLN, and a similar trend was observed in MG. Metagenomic sequencing revealed that both probiotics increased the abundance of Firmicutes in MG, especially the abundance of lactic acid bacteria. The Lactobacillus genus appeared exclusively in MG from probiotic groups. Both probiotics influenced MLN microbiota by decreasing diversity (Chao1) and increasing the distribution of species (Shannon index). The LGG probiotic also affected the MG microbiota as it increased diversity and distribution of species and proportions of the genera Lactobacillus and Bifidobacterium. These results provide evidence that

  8. Open Enrollment: Overview and 2016 Legislative Update. Policy Analysis

    Science.gov (United States)

    Wixom, Micah Ann

    2017-01-01

    Open-enrollment policies allow students to transfer from one public school to another of their choice. While open-enrollment policies involve students transferring to another school or district, the specifics of these policies vary significantly across states. States' open-enrollment policies may allow for voluntary or mandatory participation at…

  9. Open Source, Open Access, Open Review, Open Data. Initiativen zu mehr Offenheit in der digitalen Welt

    OpenAIRE

    Herb, Ulrich

    2011-01-01

    The article discusses the principles of openess, open access and open availability of information based on the examples of open access to scientific information, open government data, open geographical data and open source software.

  10. Open Source, Open Access, Open Review, Open Data. Initiativen zu mehr Offenheit in der digitalen Welt

    OpenAIRE

    Herb, Ulrich

    2011-01-01

    The article discusses the principles of openess, open access and open availability of information based on the examples of open access to scientific information, open government data, open geographical data and open source software.

  11. OpenAPC. Open-Access-Publikationskosten als Open Data

    OpenAIRE

    Tullney, Marco

    2015-01-01

    Präsentationsfolien zum Vortrag „OpenAPC. Open-Access-Publikationskosten als Open Data“ in der Session „Ausgestaltung eines wissenschaftsadäquaten APC-Marktes: Grundsätze, Finanzierungsansätze und Management“ der Open-Access-Tage 2015 in Zürich (https://www.open-access.net/community/open-access-tage/open-access-tage-2015-zuerich/programm/#c1974)

  12. Charter School Replication. Policy Guide

    Science.gov (United States)

    Rhim, Lauren Morando

    2009-01-01

    "Replication" is the practice of a single charter school board or management organization opening several more schools that are each based on the same school model. The most rapid strategy to increase the number of new high-quality charter schools available to children is to encourage the replication of existing quality schools. This policy guide…

  13. Open Educational Resources in Denmark

    DEFF Research Database (Denmark)

    Harlung, Asger

    2010-01-01

    The report presents an overview of accessibility, content types,and educational levels of open Educational Resources for public school, high shcool, higher education, and citizen empowerment and enlightenment offered from educational institutions or via other internet sources in Denmark in late...

  14. Project Open Door. Final Report.

    Science.gov (United States)

    Verheyden-Hilliard, Mary Ellen

    The major purpose of Project Open Door was to design, develop, test, and disseminate a portable module for vocational educators and others to use with junior high school students in pre-vocational exploration free of sex stereotyping. The module produced contained a slide presentation with accompanying cassette tape and a leader's guide. An…

  15. Open Images

    DEFF Research Database (Denmark)

    Sanderhoff, Merete

    2013-01-01

    Museums around the world hold enormous troves of public domain artworks. In digitized form, they can be powerful tools for research and learning, as well as building blocks, in the hands of students, teachers, scholars, developers, and creative people. By opening up their digitized assets for reuse......, museums have a unique opportunity to broaden the scope of their public mission to serve and educate the public on 21st century media terms. What could be controversial about that? Art museums have a long legacy of restricting access to high quality images of artworks in order to protect them from improper...

  16. Open University

    CERN Document Server

    Pentz,M

    1975-01-01

    Michel Pentz est née en Afrique du Sud et venu au Cern en 1957 comme physicien et président de l'associaion du personnel. Il est également fondateur du mouvement Antiapartheid de Genève et a participé à la fondation de l'Open University en Grande-Bretagne. Il nous parle des contextes pédagogiques, culturels et nationaux dans lesquels la méthode peut s'appliquer.

  17. School-based mindfulness intervention for stress reduction in adolescents: Design and methodology of an open-label, parallel group, randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Jeanette M. Johnstone

    2016-12-01

    Full Text Available Adolescents are in a high-risk period developmentally, in terms of susceptibility to stress. A mindfulness intervention represents a potentially useful strategy for developing cognitive and emotion regulation skills associated with successful stress coping. Mindfulness strategies have been used successfully for emotional coping in adults, but are not as well studied in youth. This article details a novel proposal for the design of an 8-week randomized study to evaluate a high school-based mindfulness curriculum delivered as part of a two semester health class. A wellness education intervention is proposed as an active control, along with a waitlist control condition. All students enrolled in a sophomore (10th grade health class at a private suburban high school will be invited to participate (n = 300. Pre-test assessments will be obtained by youth report, parent ratings, and on-site behavioral testing. The assessments will evaluate baseline stress, mood, emotional coping, controlled attention, and working memory. Participants, divided into 13 classrooms, will be randomized into one of three conditions, by classroom: A mindfulness intervention, an active control (wellness education, and a passive control (waitlist. Waitlisted participants will receive one of the interventions in the following term. Intervention groups will meet weekly for 8 weeks during regularly scheduled health classes. Immediate post-tests will be conducted, followed by a 60-day post-test. It is hypothesized that the mindfulness intervention will outperform the other conditions with regard to the adolescents' mood, attention and response to stress.

  18. Do Open Floor Plans Invite Overeating?

    Science.gov (United States)

    ... among American adults. Rollings and Wells suggested that future studies might explore the effect of floor plan openness in settings where overeating can occur, such as residential kitchens; college, school and workplace cafeterias; and buffet-style ...

  19. Ensino de psicologia e o ensino fundamental: abrindo janelas a novos horizontes/The teaching of psychology vis-à-vis elementary schools: opening windowsto new horizons

    Directory of Open Access Journals (Sweden)

    Ana Maria Falcão de Aragão Sadalla

    2007-01-01

    Full Text Available Buscando reagir a uma Psicologia burocrática, elitista e encastelada, psicólogos procuram traduzir os conhecimentos que esta ciência tem produzido em relação ao processo ensino-aprendizagem para professores, intentando promover sua compreensão. Reagindo a uma visão de ciência que se dizia capaz de identificar origens de problemas apenas a partir da aplicação de testes psicológicos, análise de desenho ou de material escolar, sem analisar o contexto e as relações que nele se estabelecem, psicólogos buscam mostrar aos professores que não há apenas uma possibilidade de análise e que, dependendo do referencial teórico que se utiliza, podem ser levantadas várias hipóteses de um mesmo problema. Temos sido testemunhas de reações de professores à ação da Psicologia na escola. Mas, perguntamos: é a ação da Psicologia que gera estas reações, ou é ao uso que se faz da Psicologia nas escolas? Em parceria junto aos professores e profissionais que atuam em contextos educativos, bem como com outras ciências da educação, temos a possibilidade de constituir e construir um conjunto de saberes e conhecimentos pedagógicos e educacionais para promover a qualidade de ensino que atenda a novas demandas dos sujeitos que freqüentam as escolas do ensino fundamental. In searching for a reaction against a bureaucratic, elitist and walled in psychology, psychologists try to translate the knowledge this science has been producing regarding the teaching-learning process with the purpose of promoting its comprehension. In reacting to a view of science which is said to be able to identify the origins of the problems from the simple application of psychological tests, analyses of drawings or school materials, without taking into account the context and the relations that are established, psychologists try to show teachers that there is not just one possibility of analyses and that, depending on the theoretical framework adopted, several

  20. K 7- x- yBa yNb 14P 9O 60( x= 0.27(5), y= 0.63(3)), a Niobium Phosphate Bronze: Synthesis, Structure, and Physical Properties

    Science.gov (United States)

    Xu, J.; Emge, T.; Ramanujachary, K. V.; Höhn, P.; Greenblatt, M.

    1996-09-01

    Large dark blue plate-like single crystals of K7-x-yBayNb14P9O60(x= 0.27(5),y= 0.63(3)) have been synthesized by a solid state technique. A single crystal X-ray diffraction study shows that it crystallizes in the orthorhombic space groupPmma(#51) with the lattice parametersa= 36.809(3),b= 10.596(1), andc= 6.459(1) Å andz= 2. A full matrix least-squares refinement based on 2451 reflections forI> 2σ(I) yieldedR(F) = 0.047 andRw(F2) = 0.114. The title compound is isostructural with the previously reported K7Nb14+xP9-xO60(x= 0.13). Among the five unique K atoms in the crystal structure of K7Nb14.13P8.87O60, only K(5) appears to be predominantly substituted by barium. K6.10Ba0.63Nb14P9O60shows semiconducting behavior with an activation energy of 0.16(1) eV. Magnetic susceptibility measurements on a collection of randomly oriented single crystals indicated Curie behavior with an effective magnetic moment of μeff= 1.30 μB/Nb4+. A comparison of the structure as well as the electrical transport and magnetic properties of K6.10Ba0.63Nb14P9O60with that of K7Nb14.13P8.87O60is presented.

  1. OpenER, a Dutch Initiative in Open Educational Resources

    Science.gov (United States)

    Schuwer, Robert; Mulder, Fred

    2009-01-01

    Over the period 2006-2008, the Dutch Open Universiteit Nederland conducted an experiment in which Open Educational Resources (OER) were offered in an effort to bridge the gap between informal and formal learning and to establish a new style of entry portal to higher education with no barriers at all. OpenER received considerable attention both in…

  2. The crystal structures of the calcium-bound con-G and con-T[K7gamma] dimeric peptides demonstrate a metal-dependent helix-forming motif.

    Science.gov (United States)

    Cnudde, Sara E; Prorok, Mary; Dai, Qiuyun; Castellino, Francis J; Geiger, James H

    2007-02-14

    Short peptides that have the ability to form stable alpha-helices in solution are rare, and a number of strategies have been used to produce them, including the use of metal chelation to stabilize folding of the backbone. However, no example exists of a structurally well-defined helix stabilized exclusively through metal ion chelation. Conantokins (con)-G and -T are short peptides that are potent antagonists of N-methyl-D-aspartate receptor channels. While con-G exhibits no helicity alone, it undergoes a structural transition to a helical conformation in the presence of a variety of multivalent cations, especially Mg2+ and Ca2+. This complexation also results in antiparallel dimerization of two peptide helices in the presence of Ca2+, but not Mg2+. A con-T variant, con-T[K7gamma], displays very similar behavior. We have solved the crystal structures of both Ca2+/con-G and Ca2+/con-T [K7gamma] at atomic resolution. These structures clearly show the nature of the metal-dependent dimerization and helix formation and surprisingly also show that the con-G dimer interface is completely different from the con-T[K7gamma] interface, even though the metal chelation is similar in the two peptides. This represents a new paradigm in helix stabilization completely independent of the hydrophobic effect, which we define as the "metallo-zipper."

  3. O lazer eclipsado: registros sobre o programa “Escola Aberta” The eclipsed leisure: records about “Escola Aberta” (Open school program

    Directory of Open Access Journals (Sweden)

    Jonatas Maia da Costa

    2011-12-01

    Full Text Available Este estudo aborda uma experiência do programa “Escola Aberta”, buscando identificar as suas principais características e destacar aspectos que se referem ao lugar que o lazer ocuparia na proposta em ação. Trata-se de uma política coordenada pelo Ministério da Educação, que visa proporcionar a alunos de escolas públicas e suas comunidades, atividades no tempo livre dos finais de semana, para o desenvolvimento de oficinas de cultura, esporte, lazer e trabalho, como ações complementares às de educação formal. A investigação foi realizada por meio de análise documental e observação de campo. Selecionou-se para a pesquisa uma escola da Região Administrativa do Itapoã (DF, que se caracteriza por baixas condições socioeconômicas. Percebeu-se que as carências da população local por emprego e renda produzem efeito instrumental sobre as oficinas. Atividades voltadas à aprendizagem de ofícios tendem a subordinar as experiências de lazer, limitando a identidade do programa.This study is about an experience within “Escola Aberta” program, attempting to identify its main features and highlighting the points referring to the importance that the leisure would have within this offer. It is a policy that is coordinated by Education Department, which objective is giving activities for students from public schools and their communities, accomplished during weekend free time, in order to develop workshops of culture, sports, leisure and work, as complementary actions out of formal education. The research was accomplished by documental analysis and field observation. A school from Região Administrativa do Itapoã (DF, of low social-economic level, was selected for this research. We found that the local population’s lack of work positions and income produces an instrumental effect on workshops. Training activities for work tend to subordinate the leisure experiences, limiting the program identity.

  4. Virtual School Counseling

    Science.gov (United States)

    Osborn, Debra S.; Peterson, Gary W.; Hale, Rebecca R.

    2015-01-01

    The advent of virtual schools opens doors to opportunity for delivery of student services via the Internet. Through the use of structured interviews with four practicing Florida virtual school counselors, and a follow-up survey, the authors examined the experiences and reflections of school counselors who are employed full time in a statewide…

  5. Virtual School Counseling

    Science.gov (United States)

    Osborn, Debra S.; Peterson, Gary W.; Hale, Rebecca R.

    2015-01-01

    The advent of virtual schools opens doors to opportunity for delivery of student services via the Internet. Through the use of structured interviews with four practicing Florida virtual school counselors, and a follow-up survey, the authors examined the experiences and reflections of school counselors who are employed full time in a statewide…

  6. Openness initiative

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, S.S. [Los Alamos National Lab., NM (United States)

    1995-12-31

    Although antinuclear campaigns seem to be effective, public communication and education efforts on low-level radioactive waste have mixed results. Attempts at public information programs on low-level radioactive waste still focus on influencing public opinion. A question then is: {open_quotes}Is it preferable to have a program focus on public education that will empower individuals to make informed decisions rather than trying to influence them in their decisions?{close_quotes} To address this question, a case study with both quantitative and qualitative data will be used. The Ohio Low-Level Radioactive Waste Education Program has a goal to provide people with information they want/need to make their own decisions. The program initiated its efforts by conducting a statewide survey to determine information needed by people and where they turned for that information. This presentation reports data from the survey and then explores the program development process in which programs were designed and presented using the information. Pre and post data from the programs reveal attitude and knowledge shifts.

  7. Gallbladder removal - open

    Science.gov (United States)

    Cholecystectomy - open; Surgery - gallbladder - open ... a medical instrument called a laparoscope ( laparoscopic cholecystectomy ). Open gallbladder surgery is used when laparoscopic surgery cannot ...

  8. The Open Service Study of University and School Libraries at Home and Abroad from the Perspective of Public Cultural Service%公共文化服务视角下国内外学校图书馆开放服务研究

    Institute of Scientific and Technical Information of China (English)

    叶莎莎; 倪晓建

    2012-01-01

    From the perspective of public cultural service, this paper compares the current situation of open service at home and abroad of university and school libraries, and analyses the social value of university and school libraries opening to the public. On the basis, it discusses some constraints of open service of university and school libraries in China, and suggests some corresponding strategies as well. In addition, it would prompt more references for the study of open service of Chinese university and school libraries in the future.%从公共文化服务的视角出发,对比了国内外学校图书馆开放服务现状,分析了学校图书馆面向公众开放的社会价值。在此基础上,探讨我国学校图书馆开放服务的制约因素,并给出相应的解决对策,旨在为今后我国学校图书馆开放服务提供借鉴。

  9. Hypothesis Formation, Paradigms, and Openness

    Directory of Open Access Journals (Sweden)

    Conrad P. Pritscher

    2008-01-01

    Full Text Available A part of hypothesis formation, while necessary for scientific investigation, is beyond direct observation. Powerful hypothesis formation is more than logical and is facilitated by mind­opening. As Percy Bridgeman, Nobel laureate, said, science is: “Nothing more than doing one's damnedest with one's mind, no holds barred.” This paper suggests more open schooling helps generate more open hypothesizing which helps one do one's damnedest with one's mind. It is hypothesized that a more open process of hypothesis formation may help schools and society forge new ways of living and learning so that more people more often can do their damnedest with their mind. This writing does not offer a new paradigm but rather attempts to elaborate on the notion that new paradigms are difficult to form without openness to what was previously quasi­unthinkable. More on these topics and issues is included in the author's Reopening Einstein's Thought: About What Can't Be Learned From Textbooks ­­to be published by Sense Publishers in June 2008.

  10. Opening Address

    Science.gov (United States)

    Crovini, L.

    1994-01-01

    Ladies and Gentlemen To quote Mr Jean Terrien: "Physics must be one step ahead of metrology". A long-serving Director of the BIPM, he said these words when visiting the IMGC in 1970 as a member of the scientific board of our Institute. At that time it was still an open question whether the IMGC should start research work on the absolute measurement of silicon lattice spacing. Mr Terrien underlined the revolutionary character of x-ray interferometry and, eventually, he caused the balance needle to lean towards the ... right direction. Mr Terrien correctly foresaw that, like Michelson's interferometer of 1880, x-ray interferometry could have a prominent place in today's science and technology. And while, in the first case, after more than a century we can see instruments based on electromagnetic wave interaction within every one's reach in laboratories and, sometimes, in workshops, in the second case, twenty-five years since the first development of an x-ray interferometer we can witness its role in nanometrology. Today and tomorrow we meet to discuss how to go beyond the sixth decimal place in the value of the Avogadro constant. We are aware that the quest for this achievement requires the cooperation of scientists with complementary capabilities. I am sure that the present workshop is a very good opportunity to present and discuss results and to improve and extend existing cooperation. The new adjustment of fundamental constants envisaged by the CODATA Task Group is redoubling scientists' efforts to produce competitive values of NA. The results of the measurements of the silicon lattice spacing in terms of an optical wavelength, which were available for the 1986 adjustment, combined with the determination of silicon molar volume, demonstrate how such an NA determination produces a consistent set of other constants and opens the way to a possible redefinition of the kilogram. We shall see in these two days how far we have progressed along this road. For us at the

  11. 河南省城市中小学体育场馆向社会开放的现状与对策研究%Henan Province City Middle and Primary School Sports Venues Open to the Society of Present Situation and Countermeasure Research

    Institute of Scientific and Technical Information of China (English)

    宋清华; 许荣梅

    2015-01-01

    通过查阅文献及问卷调查等方法,对河南省城市中小学体育场馆向社会开放的现状资料进行梳理,尤其通过实地调研等方法对向社会开放效果较好的试点学校的开放管理措施进行了挖掘。研究认为,充分开发利用现有学校体育场馆设施,是解决人均场馆资源不足的重要途径,但目前开放对象多圈囿于本校师生,还未实现真正意义上的面向社会开放;学校体育场馆对外开放的过程中,应综合考虑自身周边环境等因素及学校自身的经济利益,制定符合自身的对外开放方案。建议:上级主管部门加强政策导向和管理引导,以最大化提高学校体育场馆的使用率及创造必要的经济效益。%Through the methods of literature and questionnaire survey, the present situation of Henan province city middle and primary school sports venues open to the public information on the comb , especially through the field research methods such as open to the social effect of good pilot schools open management measures for mining. Research considers that fully developing and utilizing the existing school sports facilities , will be the important ways to solve venues inadequate resources per capita , but the object more open circle conditioned by the school teachers and students , has yet to achieve open to society in the true sense; In the process of school sports venues open to the public , they should consider their own surroundings and other factors and the school's own economic interests , formulated in accordance with its opening to the outside. Suggestion: the competent department should strengthen policy guidance and management guidance , to maximally improve the utilization rate of school sports venues and create the necessary economic benefits.

  12. School library services and students' satisfaction in the school library ...

    African Journals Online (AJOL)

    School library services and students' satisfaction in the school library of Federal Government Girls College Owerri. ... Open Access DOWNLOAD FULL TEXT ... The data collected were analyzed using descriptive statistics and Chi-square ...

  13. Open life science research, open software and the open century

    Institute of Scientific and Technical Information of China (English)

    Youhua Chen

    2015-01-01

    At the age of knowledge explosion and mass scientific information, I highlighted the importance of conducting open science in life and medical researches through the extensive usage of open software and documents. The proposal of conducting open science is to reduce the limited repeatability of researches in life science. I outlined the essential steps for conducting open life science and the necessary standards for creating, reusing and reproducing open materials. Different Creative Commons licenses were presented and compared of their usage scope and restriction. As a conclusion, I argued that open materials should be widely adopted in doing life and medical researches.

  14. Randomized open-label pilot study of the influence of probiotics and the gut microbiome on toxic metal levels in Tanzanian pregnant women and school children.

    Science.gov (United States)

    Bisanz, Jordan E; Enos, Megan K; Mwanga, Joseph R; Changalucha, John; Burton, Jeremy P; Gloor, Gregory B; Reid, Gregor

    2014-10-07

    Exposure to environmental toxins is a 21st century global health problem that is often the result of dietary intake. Although efforts are made to reduce dietary toxin levels, they are often unsuccessful, warranting research into novel methods to reduce host exposure. Food-grade microbes that can be delivered to the gastrointestinal tract and that are capable of sequestering toxins present a safe and cost-effective intervention. We sought to investigate the potential for probiotic-supplemented yogurt to lower heavy metal levels in at-risk populations of pregnant women and in children in Mwanza, Tanzania, and to examine the microbiome in relation to toxin levels. Two populations suspected to have high toxic metal exposures were studied. A group of 44 school-aged children was followed over 25 days, and 60 pregnant women were followed over their last two trimesters until birth. A yogurt containing 10(10) CFU Lactobacillus rhamnosus GR-1 per 250 g was administered, while control groups received either whole milk or no intervention. Changes in blood metal levels were assessed, and the gut microbiomes of the children were profiled by analyzing 16S rRNA sequencing via the Ion Torrent platform. The children and pregnant women in the study were found to have elevated blood levels of lead and mercury compared to age- and sex-matched Canadians. Consumption of probiotic yogurt had a protective effect against further increases in mercury (3.2 nmol/liter; P = 0.035) and arsenic (2.3 nmol/liter; P = 0.011) blood levels in the pregnant women, but this trend was not statistically significant in the children. Elevated blood lead was associated with increases in Succinivibrionaceae and Gammaproteobacteria relative abundance levels in stool. Importance: Probiotic food produced locally represents a nutritious and affordable means for people in some developing countries to counter exposures to toxic metals. Further research and field trials are warranted to explore this approach in

  15. Open life science research, open software and the open century

    National Research Council Canada - National Science Library

    Youhua Chen

    2015-01-01

    At the age of knowledge explosion and mass scientific information, I highlighted the importance of conducting open science in life and medical researches through the extensive usage of open software and documents...

  16. Open Standards, Open Source, and Open Innovation: Harnessing the Benefits of Openness

    Science.gov (United States)

    Committee for Economic Development, 2006

    2006-01-01

    Digitization of information and the Internet have profoundly expanded the capacity for openness. This report details the benefits of openness in three areas--open standards, open-source software, and open innovation--and examines the major issues in the debate over whether openness should be encouraged or not. The report explains each of these…

  17. Inspiring the Next Generation of Scientists: Building on 52 Years of Tradition in Diatom Research with Open-Source, Web-Based Collaboration Tools and Online Resources in a Field Course for High School Students

    Science.gov (United States)

    Howard, K. L.; Lee, S. S.

    2015-12-01

    Open-source, web-based forums and online resources can be used to develop a collaborative, active-learning approach for engaging and training students in the scientific process. We used the Diatoms of the United States website as an online resource for diatom taxonomy and developed a Google+ class community to serve as a platform for high school students to learn about research in diatom taxonomy, community ecology and diatom applications to the earth sciences. Ecology and Systematics of Diatoms is a field course that has been taught at the undergraduate and graduate levels at the Iowa Lakeside Lab field station for 52 years, beginning with the Diatom Clinic in 1963. Freshwater diatom education at Lakeside Lab has since evolved into a foundational training course attracting budding diatomists from all over the world, and has grown to include a week-long course for high school students. Successful since 2012, the high school course is now offered for college credit (University of Iowa), and covers methods of diatom specimen collection and preparation, microscopy, identification of diatom genera, diatom ecology, applications of diatom research, and an introduction to data analysis incorporating multivariate statistics (ordination) using the R statistical program, as well as primary scientific literature. During the 2015 course, students contributed to a Google+ class community where they posted images, data, and questions. The web-based platform allowed students to easily share information and to give and receive feedback from both peers and instructors. Students collaborated via the Google+ community and used the Diatoms of the United States website to develop a taxonomic reference for a field-based group research project, simulating how an actual diatom research program would develop a region or project-specific flora harmonized across analysts. Students investigated the taxonomy and ecology of diatom epiphytes on the green alga Cladophora from the littoral zone of

  18. Comprehensive Schools or Specialized Schools: A Wide Niche for "Core Knowledge"?

    Science.gov (United States)

    Clavel, Matthew; Merrifield, John

    2008-01-01

    One of the key claims of choice advocates is that it will take diverse schooling options to engage all children in learning. In a school system truly open to new providers of instruction and diverse schooling options, private schools and public schools of choice can vie for customers by trying different subject themes and pedagogies. If a school's…

  19. Improving Adaptive and Memory Immune Responses of an HIV/AIDS Vaccine Candidate MVA-B by Deletion of Vaccinia Virus Genes (C6L and K7R) Blocking Interferon Signaling Pathways.

    Science.gov (United States)

    García-Arriaza, Juan; Arnáez, Pilar; Gómez, Carmen E; Sorzano, Carlos Óscar S; Esteban, Mariano

    2013-01-01

    Poxvirus vector Modified Vaccinia Virus Ankara (MVA) expressing HIV-1 Env, Gag, Pol and Nef antigens from clade B (termed MVA-B) is a promising HIV/AIDS vaccine candidate, as confirmed from results obtained in a prophylactic phase I clinical trial in humans. To improve the immunogenicity elicited by MVA-B, we have generated and characterized the innate immune sensing and the in vivo immunogenicity profile of a vector with a double deletion in two vaccinia virus (VACV) genes (C6L and K7R) coding for inhibitors of interferon (IFN) signaling pathways. The innate immune signals elicited by MVA-B deletion mutants (MVA-B ΔC6L and MVA-B ΔC6L/K7R) in human macrophages and monocyte-derived dendritic cells (moDCs) showed an up-regulation of the expression of IFN-β, IFN-α/β-inducible genes, TNF-α, and other cytokines and chemokines. A DNA prime/MVA boost immunization protocol in mice revealed that these MVA-B deletion mutants were able to improve the magnitude and quality of HIV-1-specific CD4(+) and CD8(+) T cell adaptive and memory immune responses, which were mostly mediated by CD8(+) T cells of an effector phenotype, with MVA-B ΔC6L/K7R being the most immunogenic virus recombinant. CD4(+) T cell responses were mainly directed against Env, while GPN-specific CD8(+) T cell responses were induced preferentially by the MVA-B deletion mutants. Furthermore, antibody levels to Env in the memory phase were slightly enhanced by the MVA-B deletion mutants compared to the parental MVA-B. These findings revealed that double deletion of VACV genes that act blocking intracellularly the IFN signaling pathway confers an immunological benefit, inducing innate immune responses and increases in the magnitude, quality and durability of the HIV-1-specific T cell immune responses. Our observations highlighted the immunomodulatory role of the VACV genes C6L and K7R, and that targeting common pathways, like IRF3/IFN-β signaling, could be a general strategy to improve the immunogenicity

  20. Improving Adaptive and Memory Immune Responses of an HIV/AIDS Vaccine Candidate MVA-B by Deletion of Vaccinia Virus Genes (C6L and K7R Blocking Interferon Signaling Pathways.

    Directory of Open Access Journals (Sweden)

    Juan García-Arriaza

    Full Text Available Poxvirus vector Modified Vaccinia Virus Ankara (MVA expressing HIV-1 Env, Gag, Pol and Nef antigens from clade B (termed MVA-B is a promising HIV/AIDS vaccine candidate, as confirmed from results obtained in a prophylactic phase I clinical trial in humans. To improve the immunogenicity elicited by MVA-B, we have generated and characterized the innate immune sensing and the in vivo immunogenicity profile of a vector with a double deletion in two vaccinia virus (VACV genes (C6L and K7R coding for inhibitors of interferon (IFN signaling pathways. The innate immune signals elicited by MVA-B deletion mutants (MVA-B ΔC6L and MVA-B ΔC6L/K7R in human macrophages and monocyte-derived dendritic cells (moDCs showed an up-regulation of the expression of IFN-β, IFN-α/β-inducible genes, TNF-α, and other cytokines and chemokines. A DNA prime/MVA boost immunization protocol in mice revealed that these MVA-B deletion mutants were able to improve the magnitude and quality of HIV-1-specific CD4(+ and CD8(+ T cell adaptive and memory immune responses, which were mostly mediated by CD8(+ T cells of an effector phenotype, with MVA-B ΔC6L/K7R being the most immunogenic virus recombinant. CD4(+ T cell responses were mainly directed against Env, while GPN-specific CD8(+ T cell responses were induced preferentially by the MVA-B deletion mutants. Furthermore, antibody levels to Env in the memory phase were slightly enhanced by the MVA-B deletion mutants compared to the parental MVA-B. These findings revealed that double deletion of VACV genes that act blocking intracellularly the IFN signaling pathway confers an immunological benefit, inducing innate immune responses and increases in the magnitude, quality and durability of the HIV-1-specific T cell immune responses. Our observations highlighted the immunomodulatory role of the VACV genes C6L and K7R, and that targeting common pathways, like IRF3/IFN-β signaling, could be a general strategy to improve the

  1. Sandia OpenSHMEM

    Energy Technology Data Exchange (ETDEWEB)

    2016-03-15

    Sandia OpenSHMEM is an implementation of the OpenSHMEM Standard over the Portals 4 Networking API and the OpenFabrics Interface (OFI). Sandia OpenSHMEM is designed to be a low-overhead implementation of the OpenSHMEM standard which takes advantage of the many features of the Portals 4 specification.

  2. Open access, open education resources and open data in Uganda.

    Science.gov (United States)

    Salvo, Ivana Di; Mwoka, Meggie; Kwaga, Teddy; Rukundo, Priscilla Aceng; Ernest, Dennis Ssesanga; Osaheni, Louis Aikoriogie; John, Kasibante; Shafik, Kasirye; de Sousa, Agostinho Moreira

    2015-01-01

    As a follow up to OpenCon 2014, International Federation of Medical Students' Associations (IFMSA) students organized a 3 day workshop Open Access, Open Education Resources and Open Data in Kampala from 15-18 December 2014. One of the aims of the workshop was to engage the Open Access movement in Uganda which encompasses the scientific community, librarians, academia, researchers and students. The IFMSA students held the workshop with the support of: Consortium for Uganda University Libraries (CUUL), The Right to Research Coalition, Electronic Information for Libraries (EIFL), Makerere University, International Health Sciences University (IHSU), Pan African Medical Journal (PAMJ) and the Centre for Health Human Rights and Development (CEHURD). All these organizations are based or have offices in Kampala. The event culminated in a meeting with the Science and Technology Committee of Parliament of Uganda in order to receive the support of the Ugandan Members of Parliament and to make a concrete change for Open Access in the country.

  3. School choice : challenge to Sharpeville public primary school principals

    OpenAIRE

    2012-01-01

    M.Ed. This qualitative phenomenological study focuses on school choice as challenge to principals of Sharpeville public primary schools. Different aspects of these choices are explored. School choice is an important component of parental involvement in the education of their children. Parents and learners tend to be open about their right through the support of the Schools Act 84 of 1996. You may not discriminate on the basis of race trough the language policy at your school. This means th...

  4. Open heart surgery

    Science.gov (United States)

    Heart surgery - open ... lung machine is used in most cases during open heart surgery. While the surgeon works on the ... with these procedures, the surgeon may have to open the chest to do the surgery.

  5. Open school - challenges and opportunities in Skive

    DEFF Research Database (Denmark)

    Mikkelsen, Sidse Hølvig

    2017-01-01

    national population survey. Urban Forestry & Urban Greening, 20, 277–281. https://doi.org/10.1016/j.ufug.2016.09.012Eggersen, D. V. (2016). Afsted med jer!: Stedbaseret læsning som litteraturpædagogisk metode, 20 jul. 2016 in Genrepædagogik: - og andre nye veje i læse- og skriveundervisningen. Christensen...

  6. Apraxia of lid opening

    Directory of Open Access Journals (Sweden)

    Jebasingh Y

    2006-01-01

    Full Text Available Apraxia of lid opening is a condition where patients do not have ptosis but have difficulty in overcoming levator palpebrae inhibition. We report a patient who presented with difficulty in opening eyelids with out diurnal variation, ptosis or blepharospasm. The diagnosis of Apraxia of lid opening is confirmed by electro physiology. The possibility of apraxia of lid opening should be considered in patients who present with difficulty in opening eyes. Various causes of Apraxia of lid opening are discussed.

  7. Evaluation of Quality of Life, Functioning, Disability, and Work/School Productivity Following Treatment with an Extended-Release Hydrocodone Tablet Formulated with Abuse-Deterrence Technology: A 12-month Open-label Study in Patients with Chronic Pain.

    Science.gov (United States)

    Hale, Martin E; Zimmerman, Thomas R; Ma, Yuju; Malamut, Richard

    2017-02-01

    This phase 3 study evaluated quality of life, functioning, and productivity after treatment with extended-release (ER) hydrocodone formulated with CIMA(®) Abuse-Deterrence Technology platform. Patients with chronic pain were rolled over from a 12-week placebo-controlled hydrocodone ER study or were newly enrolled. Hydrocodone ER doses were titrated (15 to 90 mg every 12 hours) to an analgesic dose, and patients received up to 52 weeks of open-label treatment. Assessments included Clinician Assessment of Patient Function (CAPF), Patient Assessment of Function (PAF), Brief Pain Inventory-Short Form (BPI-SF), 36-item Short-Form Health Survey (SF-36), Sheehan Disability Scale (SDS), and World Health Organization Health and Work Performance Questionnaire-Short Form (HPQ-SF). Of 330 enrolled patients, 291 composed the full analysis population. By week 4, ≥ 50% of patients showed improvement from baseline in all 5 CAPF domains (general activities, walking, work/daily living, relationships, and enjoyment of life) and 6 of 7 PAF domains (work attendance, work performance, walking, exercise, socializing, and enjoying life). Mean decreases from baseline of 2 to 3 points were noted for BPI-SF pain interference questions from week 4 through endpoint. Mean improvements from baseline to endpoint in SF-36 subscales ranged from 3.3 to 22.3, and SDS scores improved from moderate (4.8 to 5.1) to mild (2.5 to 2.8) disruptions in work/school, social life, and family life. At endpoint, mean HPQ-SF absolute absenteeism scores decreased from 13.6 to 10.0 hours lost/month and absolute presenteeism scores improved from 67.0 to 77.1. Patients receiving hydrocodone ER showed early numeric improvements in functioning that continued throughout this 12-month study. © 2016 World Institute of Pain.

  8. Glaucoma, Open-Angle

    Science.gov (United States)

    ... Programs Home > Statistics and Data > Glaucoma, Open-angle Glaucoma, Open-angle Open-angle Glaucoma Defined In open-angle glaucoma, the fluid passes ... 2010 2010 U.S. Age-Specific Prevalence Rates for Glaucoma by Age and Race/Ethnicity The prevalence of ...

  9. JISC Open Access Briefing Paper

    OpenAIRE

    Swan, Alma

    2005-01-01

    What Open Access is. What Open Access is not. How is Open Access provided? Open Access archives or repositories. Open Access journals. Why should authors provide Open Access to their work? Further information and resources

  10. JISC Open Access Briefing Paper

    OpenAIRE

    Swan, Alma

    2005-01-01

    What Open Access is. What Open Access is not. How is Open Access provided? Open Access archives or repositories. Open Access journals. Why should authors provide Open Access to their work? Further information and resources

  11. OpenGL Insights

    CERN Document Server

    Cozzi, Patrick

    2012-01-01

    Get Real-World Insight from Experienced Professionals in the OpenGL Community With OpenGL, OpenGL ES, and WebGL, real-time rendering is becoming available everywhere, from AAA games to mobile phones to web pages. Assembling contributions from experienced developers, vendors, researchers, and educators, OpenGL Insights presents real-world techniques for intermediate and advanced OpenGL, OpenGL ES, and WebGL developers. Go Beyond the Basics The book thoroughly covers a range of topics, including OpenGL 4.2 and recent extensions. It explains how to optimize for mobile devices, explores the design

  12. Dimensions of Openness

    DEFF Research Database (Denmark)

    Dalsgaard, Christian; Thestrup, Klaus

    2015-01-01

    as a matter of engaging educational activities in sociocultural practices of a surrounding society. Openness is not only a matter of opening up the existing, but of developing new educational practices that interact with society. The paper outlines three pedagogical dimensions of openness: transparency...... practices. Openness as joint engagement in the world aims at establishing interdependent collaborative relationships between educational institutions and external practices. To achieve these dimensions of openness, educational activities need to change and move beyond the course as the main format...... for openness. With examples from a university case, the paper discusses how alternative pedagogical formats and educational technologies can support the three dimensions of openness....

  13. Christian School Leaders and Spirituality

    Science.gov (United States)

    Banke, Susan; Maldonado, Nancy; Lacey, Candace H.

    2012-01-01

    This phenomenological study examined the spiritual experiences of Christian school leaders who are the spiritual leaders of their schools. A purposeful, nominated sample of 12 Christian school leaders was selected. In-depth, open-ended interviews were conducted, audio taped, and then transcribed verbatim. Data analysis was based on Rudestam and…

  14. A Full Plate for Schools.

    Science.gov (United States)

    Marlowe, John

    2002-01-01

    As of summer 2001, at least 12 states are deep-sixing junk foods in schools. Schools face an uphill battle on nutrition education. Commercials promoting junk food seem ubiquitous, and children are spending too many inactive hours watching television. Major challenges include the open-campus lunch period and cash-strapped schools using profits from…

  15. Calgary Girls' School: 600 Computers for 600 Scientists

    Science.gov (United States)

    Education Canada, 2009

    2009-01-01

    This article features Calgary Girls' School (CGS), a charter school including grades four through nine that opened with 188 students in 2003. The school was aligned with Alberta Education's charter-school mandate at that time to offer parents a broad range of school choices. Today the Alberta charter school mandate is to focus on innovation and…

  16. Open access and open source in chemistry

    Directory of Open Access Journals (Sweden)

    Todd Matthew H

    2007-02-01

    Full Text Available Abstract Scientific data are being generated and shared at ever-increasing rates. Two new mechanisms for doing this have developed: open access publishing and open source research. We discuss both, with recent examples, highlighting the differences between the two, and the strengths of both.

  17. Een boekje open over Open Source ERP

    NARCIS (Netherlands)

    Sneller, A.C.W.(L.)

    2009-01-01

    Er zijn vele ERP-systemen die met behulp van open source worden ontwikkeld. Organisaties die open source ERP willen implementeren staan voor twee strategische keuzes: hoe zit het met de continuïteit en wie gaat het systeem onderhouden?

  18. Open Government and (Linked (Open (Government (Data

    Directory of Open Access Journals (Sweden)

    Christian Philipp Geiger

    2012-12-01

    Full Text Available This article explores the opening and the free usage of stored public sector data, supplied by state. In the age of Open Government and Open Data it’s not enough just to put data online. It should be rather weighed out whether, how and which supplied public sector data can be published. Open Data are defined as stored data which could be made accessible in a public interest without any restrictions for usage and distribution. These Open Data can possibly be statistics, geo data, maps, plans, environmental data and weather data in addition to materials of the parliaments, ministries and authorities. The preparation and the free access to existing data permit varied approaches to the reuse of data, discussed in the article. In addition, impulses can be given for Open Government – the opening of state and administration, to more transparency, participation and collaboration as well as to innovation and business development. The Open Data movement tries to get to the bottom of current publication processes in the public sector which could be formed even more friendly to citizens and enterprises.

  19. An Open Letter to Ninth Graders

    Science.gov (United States)

    Sullivan, Patrick

    2009-01-01

    Many studies and reports in recent years have argued that there's an important "expectations gap" between the skills students are typically bringing to college and what college teachers think students should be bringing with them to college. This article, presented in the form of an open letter to first-year high school students, is an attempt…

  20. State Implementation and Perceptions of Title I School Improvement Grants under the Recovery Act: One Year Later. Online Appendix--State Responses to Open-Ended Questions about the ARRA SIG Program

    Science.gov (United States)

    Center on Education Policy, 2012

    2012-01-01

    To learn more about states' experiences with implementing school improvement grants (SIGs) funded through the American Recovery and Reinvestment Act (ARRA), the Center on Education Policy (CEP) administered a survey to state Title I directors. (Title I of the Elementary and Secondary Education Act provides federal funds to schools in low-income…

  1. Open Payments Data

    Data.gov (United States)

    U.S. Department of Health & Human Services — Open Payments (otherwise known as the Sunshine Act) - Open Payments is a Congressionally-mandated transparency program that increases awareness of financial...

  2. Open Payments Data

    Data.gov (United States)

    U.S. Department of Health & Human Services — Open Payments (otherwise known as the Sunshine Act) - Open Payments is a Congressionally-mandated transparency program that increases awareness of financial...

  3. OpenCities Project

    Data.gov (United States)

    US Agency for International Development — The Open Cities Project aims to catalyze the creation, management and use of open data to produce innovative solutions for urban planning and resilience challenges...

  4. Contemporary Scientists Discuss the Need for Openness and Open-Mindedness in Science and Society

    Science.gov (United States)

    Mulhall, Pamela J.; Smith, Dorothy V.; Hart, Christina E.; Gunstone, Richard F.

    2016-09-01

    We report on findings from a qualitative study of Australian scientists whose work brings them into contact with the public. This research sought to understand how a school science curriculum could better represent the work of scientists today. We discuss the views expressed by our participant scientists about the importance of openness and open-mindedness in their work, including their engagement with the public. They described openness as an important characteristic of science. Our participants also see open-mindedness on the part of both scientists and members of the public as important for productive relationships. They see the development of such relationships as an essential facet of their work. The views expressed by these scientists provide a provocative insight into the ways in which contemporary scientists see their work and relationships with their communities. Their perspectives have important implications for approaches to teaching science in schools.

  5. Contemporary Scientists Discuss the Need for Openness and Open-Mindedness in Science and Society

    Science.gov (United States)

    Mulhall, Pamela J.; Smith, Dorothy V.; Hart, Christina E.; Gunstone, Richard F.

    2017-10-01

    We report on findings from a qualitative study of Australian scientists whose work brings them into contact with the public. This research sought to understand how a school science curriculum could better represent the work of scientists today. We discuss the views expressed by our participant scientists about the importance of openness and open-mindedness in their work, including their engagement with the public. They described openness as an important characteristic of science. Our participants also see open-mindedness on the part of both scientists and members of the public as important for productive relationships. They see the development of such relationships as an essential facet of their work. The views expressed by these scientists provide a provocative insight into the ways in which contemporary scientists see their work and relationships with their communities. Their perspectives have important implications for approaches to teaching science in schools.

  6. A School for the Common Good

    Science.gov (United States)

    Baines, Lawrence; Foster, Hal

    2006-01-01

    This article examines the history and the concept of the common school from the Common School Movement reformers of the 1850s to the present. These reformers envisioned schools that were to be tuition free and open to everyone, places where rich and poor met and learned together on equal terms. Central to the concept of the common school is its…

  7. Douglas Taylor School: Rooted in Community

    Science.gov (United States)

    Rourke, James; Boone, Elizabeth

    2009-01-01

    Inspiring students to become teachers and community leaders is a goal of Douglas Taylor School's leadership team. A feeling of continuity and connection are important to the school, which opened in the 19th century. Housed in a beautiful old school building in Chicago's South Side, Douglas Taylor School contains grades preK-8. To maintain the…

  8. A Unifying Curriculum for Museum-Schools

    Science.gov (United States)

    Povis, Kaleen E.

    2011-01-01

    There are over two dozen schools in the United States with the word "museum" in their names. However, the philosophy and pedagogy that tie these schools together is unclear. A consistent definition, criteria for classification, and a unifying curriculum to guide museum- schools is lacking. Yet, museum-schools continue to open across the country.…

  9. Open Hardware Business Models

    Directory of Open Access Journals (Sweden)

    Edy Ferreira

    2008-04-01

    Full Text Available In the September issue of the Open Source Business Resource, Patrick McNamara, president of the Open Hardware Foundation, gave a comprehensive introduction to the concept of open hardware, including some insights about the potential benefits for both companies and users. In this article, we present the topic from a different perspective, providing a classification of market offers from companies that are making money with open hardware.

  10. School gardens in Denmark

    DEFF Research Database (Denmark)

    Dyg, Pernille Malberg

    2016-01-01

    ). School gardens are sprouting in rural and urban areas across Denmark. This case study research sheds new light on various school garden models under the Gardens for Bellies program in Denmark, including school-, community-based and central school gardens. This study aims to document the organization......Studies show that school gardening helps children enhance their understanding of science and promotes their interaction with the environment gaining historical, cultural and ecological understandings (Dyg 2014; Chenhall 2010; Green 2013; Johnson 2012; Sloan 2013; McCarty 2010; Hess & Trexler 2011...... of school gardens, which is not studied in international research. It also analyses immediate effects according to pupils and other stakeholders. The research is based on five explorative case studies, involving observations and interviews. The findings show that school gardens open up opportunities...

  11. Open Source Business Solutions

    Directory of Open Access Journals (Sweden)

    Ion IVAN

    2008-01-01

    Full Text Available This analyses the Open source movement. Open source development process and management is seen different from the classical point of view. This focuses on characteristics and software market tendencies for the main Open source initiatives. It also points out the labor market future evolution for the software developers.

  12. OpenFlow cookbook

    CERN Document Server

    Smiler S, Kingston

    2015-01-01

    This book is intended for network protocol developers, SDN controller application developers, and academics who would like to understand and develop their own OpenFlow switch or OpenFlow controller in any programming language. With basic understanding of OpenFlow and its components, you will be able to follow the recipes in this book.

  13. Open Rotor Development

    Science.gov (United States)

    Van Zante, Dale E.; Rizzi, Stephen A.

    2016-01-01

    The ERA project executed a comprehensive test program for Open Rotor aerodynamic and acoustic performance. System studies used the data to estimate the fuel burn savings and acoustic margin for an aircraft system with open rotor propulsion. The acoustic measurements were used to produce an auralization that compares the legacy blades to the current generation of open rotor designs.

  14. Openness as infrastructure

    Directory of Open Access Journals (Sweden)

    Wilbanks John

    2011-10-01

    Full Text Available Abstract The advent of open access to peer reviewed scholarly literature in the biomedical sciences creates the opening to examine scholarship in general, and chemistry in particular, to see where and how novel forms of network technology can accelerate the scientific method. This paper examines broad trends in information access and openness with an eye towards their applications in chemistry.

  15. These Doors Are Open!

    Science.gov (United States)

    Achinstein, Betty; Athanases, Steven Z.; Curry, Marnie W.; Ogawa, Rodney T.; de Oliveira, Luciana C.

    2013-01-01

    Lower-income students of color in California are often underserved, as evidenced by low-resourced schools, an achievement gap, and low college-going rates. Educators increasingly call for "community schools" that link schools with community members and agencies to promote educational achievement and to access communities as resources for…

  16. Close stellar conjunctions of alpha Centauri A and B until 2050 - An mK = 7.8 star may enter the Einstein ring of alpha Cen A in 2028

    CERN Document Server

    Kervella, P; Mérand, A; Thévenin, F

    2016-01-01

    The rapid proper motion of the alpha Cen pair (3.7 arcsec/yr) and its location close to the galactic plane on a rich stellar background combine to make them excellent candidates for stellar conjunctions with distant stars. Adding new astrometry to archival data, we have refined the orbital parameters, barycentric proper motion and parallax of alpha Cen and compute its apparent trajectory on sky over the coming decades. We present a catalog of the expected close conjunctions until 2050. An exceptional event will take place in early May 2028, when alpha Cen A will come within 0.015 +/- 0.135 arcseconds of the mK = 7.8 star 2MASS 14392160-6049528 (hereafter S5). In terms of impact parameter and contrast, this is the most favorable stellar conjunction of alpha Cen within at least the next three decades. With an angular diameter of LD = 0.47 +/- 0.05 mas, it is likely that S5 is a red giant or supergiant located at several kiloparsecs. The approached stars will act as moving light probes in transmission through th...

  17. Implementing OpenShift

    CERN Document Server

    Miller, Adam

    2013-01-01

    A standard tutorial-based approach to using OpenShift and deploying custom or pre-built web applications to the OpenShift Online cloud.This book is for software developers and DevOps alike who are interested in learning how to use the OpenShift Platform-as-a-Service for developing and deploying applications, how the environment works on the back end, and how to deploy their very own open source Platform-as-a-Service based on the upstream OpenShift Origin project.

  18. Deploying OpenStack

    CERN Document Server

    Pepple, Ken

    2011-01-01

    OpenStack was created with the audacious goal of being the ubiquitous software choice for building public and private cloud infrastructures. In just over a year, it's become the most talked-about project in open source. This concise book introduces OpenStack's general design and primary software components in detail, and shows you how to start using it to build cloud infrastructures. If you're a developer, technologist, or system administrator familiar with cloud offerings such as Rackspace Cloud or Amazon Web Services, Deploying OpenStack shows you how to obtain and deploy OpenStack softwar

  19. OpenSubspace

    DEFF Research Database (Denmark)

    Müller, Emmanuel; Assent, Ira; Günnemann, Stephan

    2009-01-01

    Subspace clustering and projected clustering are recent research areas for clustering in high dimensional spaces. As the field is rather young, there is a lack of comparative studies on the advantages and disadvantages of the different algorithms. Part of the underlying problem is the lack...... of available open source implementations that could be used by researchers to understand, compare, and extend subspace and projected clustering algorithms. In this paper, we discuss the requirements for open source evaluation software. We propose OpenSubspace, an open source framework that meets...... these requirements. OpenSubspace integrates state-of-the-art performance measures and visualization techniques to foster research in subspace and projected clustering....

  20. Openness, Web 2.0 Technology, and Open Science

    Science.gov (United States)

    Peters, Michael A.

    2010-01-01

    Open science is a term that is being used in the literature to designate a form of science based on open source models or that utilizes principles of open access, open archiving and open publishing to promote scientific communication. Open science increasingly also refers to open governance and more democratized engagement and control of science…

  1. Open-ended education

    DEFF Research Database (Denmark)

    Nørgård, Rikke Toft; Paaskesen, Rikke Berggreen

    2016-01-01

    THE ARTICLE DESCRIBES OPEN-ENDED EDUCATION FOR 21ST CENTURY LEARNING AS THE COMING TOGETHER OF OPEN-ENDED TECHNOLOGY, OPEN-ENDED PROJECTS, AND OPEN-ENDED INSTITUTIONS IN WAYS THAT FOSTER AND PROMOTE FUTURE EDUCATION FOR CITIZENSHIP IN SOCIETY. THROUGH THE CASE OF THE CODING PIRATES FUTURE ISLAND......, THE ARTICLE DEMONSTRATES HOW OPEN-ENDED EDUCATION CAN BE PRACTICED TO FOSTER AND PROMOTE TECHNOLOGICAL IMAGINATION, ENTERPRISING, AND PARTICIPATION. THIS PRACTICE IS THEN DEVELOPED INTO A THEORETICAL MODEL FOR THE CONCEPT OF OPEN-ENDED EDUCATION AS A WAY OF AND FRAMEWORK FOR PRACTICING FUTURE EDUCATION FOR 21......ST CENTURY LEARNING WITH NEW TECHNOLOGIES. THE ARTICLE PRESENTS AN ANSWER TO THE CALL FOR 21ST CENTURY LEARNING AS THOROUGHLY COLLABORATIVE, COMMUNICATIVE, CREATIVE, AND CRITICALLY REFLECTIVE THROUGH THE CASE AND THE CONCEPT OF OPEN-ENDED EDUCATION. IT OUTLINES THE IMPLICATIONS OF THIS CALL...

  2. Open algebraic surfaces

    CERN Document Server

    Miyanishi, Masayoshi

    2000-01-01

    Open algebraic surfaces are a synonym for algebraic surfaces that are not necessarily complete. An open algebraic surface is understood as a Zariski open set of a projective algebraic surface. There is a long history of research on projective algebraic surfaces, and there exists a beautiful Enriques-Kodaira classification of such surfaces. The research accumulated by Ramanujan, Abhyankar, Moh, and Nagata and others has established a classification theory of open algebraic surfaces comparable to the Enriques-Kodaira theory. This research provides powerful methods to study the geometry and topology of open algebraic surfaces. The theory of open algebraic surfaces is applicable not only to algebraic geometry, but also to other fields, such as commutative algebra, invariant theory, and singularities. This book contains a comprehensive account of the theory of open algebraic surfaces, as well as several applications, in particular to the study of affine surfaces. Prerequisite to understanding the text is a basic b...

  3. Open Access @ DTU

    DEFF Research Database (Denmark)

    Ekstrøm, Jeannette

    Open Access is high on the agenda in Denmark and internationally. Denmark has announced a national strategy for Open Access that aims to achieve Open Access to 80% in 2017 and 100% in 2022 to peer review research articles. All public Danish funders as well as H2020 requires that all peer review...... articles that is an outcome of their funding will be Open Access. Uploading your full texts (your final author manuscript after review ) to DTU Orbit is a fundamental part of providing Open Access to your research. We are here to answer all your questions with regards to Open Access and related topics...... such as copyright, DTU Orbit, Open Access journals, APCs, Vouchers etc....

  4. Open-ended education

    DEFF Research Database (Denmark)

    Nørgård, Rikke Toft; Paaskesen, Rikke Berggreen

    2016-01-01

    THE ARTICLE DESCRIBES OPEN-ENDED EDUCATION FOR 21ST CENTURY LEARNING AS THE COMING TOGETHER OF OPEN-ENDED TECHNOLOGY, OPEN-ENDED PROJECTS, AND OPEN-ENDED INSTITUTIONS IN WAYS THAT FOSTER AND PROMOTE FUTURE EDUCATION FOR CITIZENSHIP IN SOCIETY. THROUGH THE CASE OF THE CODING PIRATES FUTURE ISLAND......, THE ARTICLE DEMONSTRATES HOW OPEN-ENDED EDUCATION CAN BE PRACTICED TO FOSTER AND PROMOTE TECHNOLOGICAL IMAGINATION, ENTERPRISING, AND PARTICIPATION. THIS PRACTICE IS THEN DEVELOPED INTO A THEORETICAL MODEL FOR THE CONCEPT OF OPEN-ENDED EDUCATION AS A WAY OF AND FRAMEWORK FOR PRACTICING FUTURE EDUCATION FOR 21......ST CENTURY LEARNING WITH NEW TECHNOLOGIES. THE ARTICLE PRESENTS AN ANSWER TO THE CALL FOR 21ST CENTURY LEARNING AS THOROUGHLY COLLABORATIVE, COMMUNICATIVE, CREATIVE, AND CRITICALLY REFLECTIVE THROUGH THE CASE AND THE CONCEPT OF OPEN-ENDED EDUCATION. IT OUTLINES THE IMPLICATIONS OF THIS CALL...

  5. OpenSHS: Open Smart Home Simulator

    Directory of Open Access Journals (Sweden)

    Nasser Alshammari

    2017-05-01

    Full Text Available This paper develops a new hybrid, open-source, cross-platform 3D smart home simulator, OpenSHS, for dataset generation. OpenSHS offers an opportunity for researchers in the field of the Internet of Things (IoT and machine learning to test and evaluate their models. Following a hybrid approach, OpenSHS combines advantages from both interactive and model-based approaches. This approach reduces the time and efforts required to generate simulated smart home datasets. We have designed a replication algorithm for extending and expanding a dataset. A small sample dataset produced, by OpenSHS, can be extended without affecting the logical order of the events. The replication provides a solution for generating large representative smart home datasets. We have built an extensible library of smart devices that facilitates the simulation of current and future smart home environments. Our tool divides the dataset generation process into three distinct phases: first design: the researcher designs the initial virtual environment by building the home, importing smart devices and creating contexts; second, simulation: the participant simulates his/her context-specific events; and third, aggregation: the researcher applies the replication algorithm to generate the final dataset. We conducted a study to assess the ease of use of our tool on the System Usability Scale (SUS.

  6. Open Textbooks and Increased Student Access and Outcomes

    Science.gov (United States)

    Feldstein, Andrew; Martin, Mirta; Hudson, Amy; Warren, Kiara; Hilton, John, III; Wiley, David

    2012-01-01

    This study reports findings from a year-long pilot study during which 991 students in 9 core courses in the Virginia State University School of Business replaced traditional textbooks with openly licensed books and other digital content. The university made a deliberate decision to use open textbooks that were copyrighted under the Creative…

  7. Open-Book Assessment: A Contribution to Improved Learning?

    Science.gov (United States)

    Eilertsen, Tor Vidar; Valdermo, Odd

    2000-01-01

    Studied the effects of open-book testing on instruction and student learning in an action research project involving 13 teachers and approximately 350 secondary school students in Norway. Results show open-book testing to be instrumental in strengthening understanding in both cooperative learning and more traditional classrooms. (SLD)

  8. The Need to Change Education towards Open Learning

    NARCIS (Netherlands)

    Stracke, Christian M.

    2015-01-01

    The need to change education is discussed and Open Learning Concept is presented and adapted for improving school education. Open Learning aims at the balance between learning innovation and quality for modernizing learning, education and training. Learning innovation and learning quality are very

  9. The Impact of Open Textbooks on Secondary Science Learning Outcomes

    Science.gov (United States)

    Robinson, T. Jared; Fischer, Lane; Wiley, David; Hilton, John, III

    2014-01-01

    Given the increasing costs associated with commercial textbooks and decreasing financial support of public schools, it is important to better understand the impacts of open educational resources on student outcomes. The purpose of this quantitative study is to analyze whether the adoption of open science textbooks significantly affects science…

  10. The Need to Change Education towards Open Learning

    NARCIS (Netherlands)

    Stracke, Christian M.

    2015-01-01

    The need to change education is discussed and Open Learning Concept is presented and adapted for improving school education. Open Learning aims at the balance between learning innovation and quality for modernizing learning, education and training. Learning innovation and learning quality are very o

  11. Details from the Dashboard: Estimated Number of Public Charter Schools & Students, 2014-2015

    Science.gov (United States)

    National Alliance for Public Charter Schools, 2015

    2015-01-01

    During the 2014-15 school year, almost 500 new public charter schools opened. An estimated 348,000 additional students were attending public charter schools in the 2014-15 school year compared with the previous school year. With the addition of new charter schools and students, there are now more than 6,700 public charter schools enrolling about…

  12. Open Data and Beyond

    Directory of Open Access Journals (Sweden)

    Frederika Welle Donker

    2016-04-01

    Full Text Available In recent years, there has been an increasing trend of releasing public sector information as open data. Governments worldwide see the potential benefits of opening up their data. The potential benefits are more transparency, increased governmental efficiency and effectiveness, and external benefits, including societal and economic benefits. The private sector also recognizes potential benefits of making their datasets available as open data. One such company is Liander, an energy network administrator in the Netherlands. Liander views open data as a contributing factor to energy conservation. However, to date there has been little research done into the actual effects of open data. This research has developed a monitoring framework to assess the effects of open data, and has applied the framework to Liander’s small-scale energy consumption dataset.

  13. Open port sampling interface

    Energy Technology Data Exchange (ETDEWEB)

    Van Berkel, Gary J

    2017-04-25

    A system for sampling a sample material includes a probe which can have an outer probe housing with an open end. A liquid supply conduit within the housing has an outlet positioned to deliver liquid to the open end of the housing. The liquid supply conduit can be connectable to a liquid supply for delivering liquid at a first volumetric flow rate to the open end of the housing. A liquid exhaust conduit within the housing is provided for removing liquid from the open end of the housing. A liquid exhaust system can be provided for removing liquid from the liquid exhaust conduit at a second volumetric flow rate, the first volumetric flow rate exceeding the second volumetric flow rate, wherein liquid at the open end will receive sample, liquid containing sample material will be drawn into and through the liquid exhaust conduit, and liquid will overflow from the open end.

  14. Open-mindedness

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Open-mindness1 is a much-valued2 quality of human being. We value such a quality, because it is good to society as a whole. Almost all the great men are marked with such a quality. It is the openness to things new and strange. Open-minded person is willing toconsider new opinions, new arguments and new way of doing things.

  15. Opening and Closing in Open Systems.

    Science.gov (United States)

    Klapp, Orrin E.

    In open information systems, such as in the case of human interchange with the self and the environment, input quantities have no upper limits. The human information utilization system, however, is psychologically and behaviorally unable to accept ever increasing loads of information. Because of this apparent fact, human information systems should…

  16. Visitors speak openly on the Open Day

    CERN Multimedia

    2004-01-01

    On Open Day, CERN was filled with visitors from around Europe—and beyond—who toured the LHC detector sites and visited a multitude of experimental halls and workshops across the Meyrin and Prevessin sites, the vast majority in buildings normally closed to the public.

  17. Closing a School: The Life and Death of Innovate Manhattan Charter School

    Science.gov (United States)

    Penberg, David

    2016-01-01

    Most articles about schools and what goes on inside of them address issues of currency--instructional core, evaluation, standards, teacher development, leadership, or opening a new school--but what about the closing of one? This, too, is part of the life span and reality of many schools. Are there best practices for closing schools? In this…

  18. Public School Choice and Student Mobility in Metropolitan Phoenix

    Science.gov (United States)

    Powers, Jeanne M.; Topper, Amelia M.; Silver, Michael

    2012-01-01

    Arizona's interdistrict open enrollment and charter schools laws allow families to send their children to the public schools of their choice. We assessed how public school choice affected elementary school enrollments in 27 metropolitan Phoenix school districts. Student mobility rates varied widely between districts and by location. The higher…

  19. Case Study: International High School at Langley Park

    Science.gov (United States)

    Wassl, Frishtah; Wilkin, Christine; Ward, Maggie

    2017-01-01

    The International High School at Langley Park (IHSLP) opened during the 2015-2016 school year. By the fourth year of operation, the school will be home to 400 English language learners (ELLs) new to the United States. Working in partnership with the Internationals Network for Public Schools, the school is designed around the "HELLO…

  20. Public School Choice and Student Mobility in Metropolitan Phoenix

    Science.gov (United States)

    Powers, Jeanne M.; Topper, Amelia M.; Silver, Michael

    2012-01-01

    Arizona's interdistrict open enrollment and charter schools laws allow families to send their children to the public schools of their choice. We assessed how public school choice affected elementary school enrollments in 27 metropolitan Phoenix school districts. Student mobility rates varied widely between districts and by location. The higher…

  1. Open3DQSAR

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    Open3DQSAR is a freely available open-source program aimed at chemometric analysis of molecular interaction fields. MIFs can be imported from different sources (GRID, CoMFA/CoMSIA, quantum-mechanical electrostatic potential or electron density grids) or generated by Open3DQSAR itself. Much focus...... has been put on automation through the implementation of a scriptable interface, as well as on high computational performance achieved by algorithm parallelization. Flexibility and interoperability with existing molecular modeling software make Open3DQSAR a powerful tool in pharmacophore assessment...

  2. Open data for citizens

    DEFF Research Database (Denmark)

    Götzen, Amalia De; Morelli, Nicola

    2016-01-01

    A large quantity of open data is now available to institutions, business and citizens. The potential of such new resource, though, has not been explored yet, also because of a lack of perspectives and scenarios on how open data can be used. The workshop aims at broadening the perspectives...... on the use of open data by investigating new scenarios for a wide use of open data, where citizens without any IT skills can be involved in a co-design session with the relevant stakeholders....

  3. Open data assessment

    Science.gov (United States)

    Trifonov, Roumen; Yoshinov, Radoslav; Jekov, Boyan; Pavlova, Galya

    2017-06-01

    The last decade together with rapidly developing of Information and Communication Technologies data and its variety of application fields gaining in popularity. Initially the data becomes Big. Everyday accumulation of so big amount of data and the possibility to analyze it contributes to the ease of modern life. The curiosity of the world enforces the Big Data to become Open and then to connect the available open data in linked. This article presents the Open data and their implication in different fields. Detailed is examined the quality of Open data as the methodology for its evaluation is presented.

  4. Allegheny County School District Boundaries

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset demarcates the school district boundaries within Allegheny County If viewing this description on the Western Pennsylvania Regional Data Center’s open...

  5. Allegheny County School District Boundaries

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset demarcates the school district boundaries within Allegheny County If viewing this description on the Western Pennsylvania Regional Data Center’s open...

  6. Opening up education - some pedagogical considerations

    DEFF Research Database (Denmark)

    Bang, Jørgen; Dalsgaard, Christian; Kjær, Arne

    2016-01-01

    would we need universities? Libraries could do the job!” In order to open up education, we need to develop a pedagogical framework for knowledge building to supplement the tradition for knowledge acquisition in higher education. In this article we present our strategic considerations for organising...... at universities and university colleges, but also teachers at high schools and primary schools, and staff involved with informal learning at museums and/or educational planning in companies, plus prospective future students. The focus in this article is on the strategic pedagogical considerations, whereas...

  7. SEMI-OPENNESS AND ALMOST-OPENNESS OF INDUCED MAPPINGS

    Institute of Scientific and Technical Information of China (English)

    HuangXianjiu; ZengFanping; ZhangGengrong

    2005-01-01

    Given a mapping f between continua. Let 2f and C(f) mean the induced mappings between hyperspaces. Relations are studied under the conditions :f is semi-open (almost open, respectively), 2f is semi-open (almost open, respectively) and C(f) is semi-open (almost open, respectively).

  8. Exploration on the Feasibility of Opening Chinese Chess Characteristic Course in Primary Schools at Mountain ;Areas%山村小学创设中国象棋特色课程的可行性探索

    Institute of Scientific and Technical Information of China (English)

    应汉良

    2015-01-01

    应店街镇云石完小以中国象棋为特色,以棋育人,取得了实实在在的成效。通过多年实践和探索,制订了科学的课程体系、实用的校本教材、完善的实施方案,为农村学校的棋类特色教育、教学提供了经验。%With Chinese chess as the feature and educating stu-dents with chess, real results have been achieved in Yunshi Complete Primary School of Yingdianjie Town. Through many years of practice and exploration, a scientific curriculum system and useful school-based textbooks were formulated, and the im-plementation scheme was improved. Our experience has provided experience for chess-based characteristic education and teaching in rural schools.

  9. Pro OpenSSH

    CERN Document Server

    Stahnke, Michael

    2006-01-01

    SSH, acronym for Secure Socket Shell, is for users and administrators wishing to establish secure communication between disparate networks. 'Pro OpenSSH', authored by two Fortune 100 system administrators, provides readers with a highly practical reference for configuring and deploying OpenSSH in their own environment.

  10. OpenShift cookbook

    CERN Document Server

    Gulati, Shekhar

    2014-01-01

    If you are a web application developer who wants to use the OpenShift platform to host your next big idea but are looking for guidance on how to achieve this, then this book is the first step you need to take. This is a very accessible cookbook where no previous knowledge of OpenShift is needed.

  11. Open Data and Beyond

    NARCIS (Netherlands)

    Welle Donker, Frederika; Loenen, Van Bastiaan; Bregt, Arnold

    2016-01-01

    In recent years, there has been an increasing trend of releasing public sector information as open data. Governments worldwide see the potential benefits of opening up their data. The potential benefits are more transparency, increased governmental efficiency and effectiveness, and external

  12. OpenJDK cookbook

    CERN Document Server

    Kasko, Alex; Mironchenko, Alexey

    2015-01-01

    If you are an experienced Java developer using Java 7 platform and want to get your grips on OpenJDK for Java development, this is the book for you. JDK users who wish to migrate to OpenJDK will find this book very useful.

  13. Open Rotor Aeroacoustic Modelling

    Science.gov (United States)

    Envia, Edmane

    2012-01-01

    Owing to their inherent fuel efficiency, there is renewed interest in developing open rotor propulsion systems that are both efficient and quiet. The major contributor to the overall noise of an open rotor system is the propulsor noise, which is produced as a result of the interaction of the airstream with the counter-rotating blades. As such, robust aeroacoustic prediction methods are an essential ingredient in any approach to designing low-noise open rotor systems. To that end, an effort has been underway at NASA to assess current open rotor noise prediction tools and develop new capabilities. Under this effort, high-fidelity aerodynamic simulations of a benchmark open rotor blade set were carried out and used to make noise predictions via existing NASA open rotor noise prediction codes. The results have been compared with the aerodynamic and acoustic data that were acquired for this benchmark open rotor blade set. The emphasis of this paper is on providing a summary of recent results from a NASA Glenn effort to validate an in-house open noise prediction code called LINPROP which is based on a high-blade-count asymptotic approximation to the Ffowcs-Williams Hawkings Equation. The results suggest that while predicting the absolute levels may be difficult, the noise trends are reasonably well predicted by this approach.

  14. Open Data and Beyond

    NARCIS (Netherlands)

    Welle Donker, Frederika; Loenen, Van Bastiaan; Bregt, Arnold

    2016-01-01

    In recent years, there has been an increasing trend of releasing public sector information as open data. Governments worldwide see the potential benefits of opening up their data. The potential benefits are more transparency, increased governmental efficiency and effectiveness, and external benefits

  15. Open G(2) strings

    NARCIS (Netherlands)

    de Boer, J.; de Medeiros, P.; El-Showk, S.; Sinkovics, A.

    2008-01-01

    We consider an open string version of the topological twist previously proposed for sigma-models with G(2) target spaces. We determine the cohomology of open strings states and relate these to geometric deformations of calibrated submanifolds and to flat or anti-self-dual connections on such submani

  16. Bisimilarity of Open Terms

    NARCIS (Netherlands)

    Rensink, Arend; Palamidessi, C.; Parrow, J.

    1997-01-01

    The standard way of lifting a binary relation, R, from closed terms of an algebra to open terms is to define its closed-instance extension, R_{ci}, which holds for a given pair of open terms if and only if R holds for all their closed instantiations. In this paper, we study alternatives for the case

  17. Creating Open Source Conversation

    Science.gov (United States)

    Sheehan, Kate

    2009-01-01

    Darien Library, where the author serves as head of knowledge and learning services, launched a new website on September 1, 2008. The website is built with Drupal, an open source content management system (CMS). In this article, the author describes how she and her colleagues overhauled the library's website to provide an open source content…

  18. Open source community organization

    CSIR Research Space (South Africa)

    Molefe, Onkgopotse M

    2009-05-01

    Full Text Available Open Source communities (OSCs), sometimes referred to as virtual or online communities play a significant role in terms of the contribution they continue to make in producing user-friendly Open Source Software (OSS) solutions. Many projects have...

  19. Open Verlinde line operators

    CERN Document Server

    Gaiotto, Davide

    2014-01-01

    We reformulate the action of Verlinde line operators on conformal blocks in a 3d TFT language and extend it to line operators labelled by open paths joining punctures on the Riemann surface. We discuss the possible applications of open Verlinde line operators to quantum Teichm\\"uller theory, supersymmetric gauge theory and quantum groups

  20. All channels open

    NARCIS (Netherlands)

    Frank Huysmans; Jos de Haan

    2010-01-01

    Original title: Alle kanalen staan open. The rapid changes taking place in the media landscape in the Netherlands - characterised by digitisation and convergence of media technologies - raise the question of how the Dutch are dealing with the many new opportunities that have opened up. All channels

  1. Mastering OpenStack

    CERN Document Server

    Khedher, Omar

    2015-01-01

    This book is intended for system administrators, cloud engineers, and system architects who want to deploy a cloud based on OpenStack in a mid- to large-sized IT infrastructure. If you have a fundamental understanding of cloud computing and OpenStack and want to expand your knowledge, then this book is an excellent checkpoint to move forward.

  2. OpenStack essentials

    CERN Document Server

    Radez, Dan

    2015-01-01

    If you need to get started with OpenStack or want to learn more, then this book is your perfect companion. If you're comfortable with the Linux command line, you'll gain confidence in using OpenStack.

  3. Open Access policy effectiveness

    OpenAIRE

    Swan, Alma

    2015-01-01

    This presentation discusses the policy elements that are necessary for an effective open access policy, according to the findings of the analysis of the revamped ROARMAP tool for open access policies by PASTEUR4OA. It contains graphs, charts and numbers for evidence-based arguments

  4. Creating Open Source Conversation

    Science.gov (United States)

    Sheehan, Kate

    2009-01-01

    Darien Library, where the author serves as head of knowledge and learning services, launched a new website on September 1, 2008. The website is built with Drupal, an open source content management system (CMS). In this article, the author describes how she and her colleagues overhauled the library's website to provide an open source content…

  5. The Open Access Divide

    Directory of Open Access Journals (Sweden)

    Jingfeng Xia

    2013-10-01

    Full Text Available This paper is an attempt to review various aspects of the open access divide regarding the difference between those academics who support free sharing of data and scholarly output and those academics who do not. It provides a structured description by adopting the Ws doctrines emphasizing such questions as who, what, when, where and why for information-gathering. Using measurable variables to define a common expression of the open access divide, this study collects aggregated data from existing open access as well as non-open access publications including journal articles and extensive reports. The definition of the open access divide is integrated into the discussion of scholarship on a larger scale.

  6. Open-Minded Cognition.

    Science.gov (United States)

    Price, Erika; Ottati, Victor; Wilson, Chase; Kim, Soyeon

    2015-11-01

    The present research conceptualizes open-minded cognition as a cognitive style that influences how individuals select and process information. An open-minded cognitive style is marked by willingness to consider a variety of intellectual perspectives, values, opinions, or beliefs-even those that contradict the individual's opinion. An individual's level of cognitive openness is expected to vary across domains (such as politics and religion). Four studies develop and validate a novel measure of open-minded cognition, as well as two domain-specific measures of religious and political open-minded cognition. Exploratory and confirmatory factor analysis (controlling for acquiescence bias) are used to develop the scales in Studies 1 to 3. Study 4 demonstrates that these scales possess convergent and discriminant validity. Study 5 demonstrates the scale's unique predictive validity using the outcome of Empathic Concern (Davis, 1980). Study 6 demonstrates the scale's unique predictive validity using the outcomes of warmth toward racial, religious, and sexual minorities.

  7. Where "Sign Language Studies" Has Led Us in Forty Years: Opening High School and University Education for Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation

    Science.gov (United States)

    Woodward, James; Hoa, Nguyen Thi

    2012-01-01

    This paper discusses how the Nippon Foundation-funded project "Opening University Education to Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation," also known as the Dong Nai Deaf Education Project, has been implemented through sign language studies from 2000 through 2012. This project has provided deaf…

  8. Excellence, Equity, and Access: Educators' Perceptions of Students in Open Access Advanced Placement Courses

    Science.gov (United States)

    King, Justyna Plichta

    2010-01-01

    This dissertation examines educators' perceptions regarding open access Advanced Placement (AP) program courses and their impact on non-traditional AP students in one suburban school district. The data were collected during the 2009-2010 school year through a 15-item Likert scale (and one open-ended item) survey which was disseminated during…

  9. Excellence, Equity, and Access: Educators' Perceptions of Students in Open Access Advanced Placement Courses

    Science.gov (United States)

    King, Justyna Plichta

    2010-01-01

    This dissertation examines educators' perceptions regarding open access Advanced Placement (AP) program courses and their impact on non-traditional AP students in one suburban school district. The data were collected during the 2009-2010 school year through a 15-item Likert scale (and one open-ended item) survey which was disseminated during…

  10. Health and Physique of School Children. Bulletin, 1925, No. 21

    Science.gov (United States)

    Rogers, James Frederick

    1925-01-01

    This bulletin reports on the changes and progress in practice and conditions in: (1) School Housing; (2) Playgrounds; (3) Medical inspection; (4) Dental work; (5) Nutrition; (6) Open-air schools and open-window rooms; (7) The summer camp; (8) Other special schools and classes; (9) Health education; (10) Physical training; (11) Safety and first…

  11. Close stellar conjunctions of α Centauri A and B until 2050 . An mK = 7.8 star may enter the Einstein ring of α Cen A in 2028

    Science.gov (United States)

    Kervella, P.; Mignard, F.; Mérand, A.; Thévenin, F.

    2016-10-01

    The rapid proper motion of the α Cen pair (≈3.7 arcsec yr-1) and its location close to the galactic plane on a rich stellar background combine constructively to make them excellent candidates for close stellar conjunctions with more distant stars. Adding new differential astrometry to archival data, we have refined the orbital parameters, barycentric proper motion and parallax of α Cen and compute its apparent trajectory on sky over the coming decades. Based on NTT/SUSI2, NTT/SOFI, and VLT/NACO maps of the field stars around the trajectories of α Cen A and B, we present a catalog of the expected close conjunctions until 2050. An exceptional event will take place in early May 2028, when α Cen A will come within ρmin = 0.015 ± 0.135 arcsec of the mK = 7.8 star 2MASS 14392160-6049528 (hereafter S5). In terms of impact parameter and contrast, this is the most favorable stellar conjunction of α Cen within at least the next three decades. With an angular diameter of θLD = 0.47 ± 0.05 mas, it is likely that S5 is a red giant or supergiant located at several kiloparsecs. The approached stars will act as moving light probes in transmission through the environment of α Cen. The observation of these close conjunctions holds great promises to search for planets and other low mass objects in the α Cen system using photometry and astrometry. The relativistic displacement of the approached star images will be observable, with significant deflection angles in the milliarcsecond range. The small impact parameter of the conjunction with S5 means that this star has a probability of 45% of entering the Einstein ring of α Cen A. The gravitational amplification of the flux of S5 could reach a factor five for the combination of the two lensed images. The proper motion, orbital parameters and parallax of α Cen will be measurable with an extreme accuracy from differential astrometry with the S stars. This will be valuable, for example to prepare the recently announced

  12. Open innovation with an effective open innovation team.

    OpenAIRE

    Vanvoorden, Jonas

    2014-01-01

    This master's thesis explores how open innovation teams can successfully support open innovation inside of an organisation. Open innovation is a paradigm introduced by Henry Chesbrough (2003) a decade ago. It expands the innovation potential of organisations by opening them up to new ways of working with external partners. To implement open innovation, many companies rely on a small group of managers named open innovation teams. Although open innovation teams can potentially be vital for impl...

  13. Demystifying Open Access

    Energy Technology Data Exchange (ETDEWEB)

    Mele, Salvatore (CERN)

    2007-05-30

    The tenets of Open Access are to grant anyone, anywhere and anytime free access to the results of scientific research. HEP spearheaded the Open Access dissemination of scientific results with the mass mailing of preprints in the pre-WWW era and with the launch of the arXiv preprint system at the dawn of the '90s. The HEP community is now ready for a further push to Open Access which retains all the advantages of the peer-review system and, at the same time, brings the spiraling cost of journal subscriptions under control. I will present a possible plan for the conversion to Open Access of HEP peer-reviewed journals, through a consortium of HEP funding agencies, laboratories and libraries: SCOAP3 (Sponsoring Consortium for Open Access Publishing in Particle Physics). SCOAP3 will engage with scientific publishers towards building a sustainable model for Open Access publishing, which is as transparent as possible for HEP authors. In this talk I will present a short overview of the history of Open Access in HEP, the details of the SCOAP3 model and the outlook for its implementation.

  14. OpenNI cookbook

    CERN Document Server

    Falahati, Soroush

    2013-01-01

    This is a Cookbook with plenty of practical recipes enriched with explained code and relevant screenshots to ease your learning curve. If you are a beginner or a professional in NIUI and want to write serious applications or games, then this book is for you. Even OpenNI 1 and OpenNI 1.x programmers who want to move to new versions of OpenNI can use this book as a starting point. This book uses C++ as the primary language but there are some examples in C# and Java too, so you need to have about a basic working knowledge of C or C++ for most cases.

  15. Linking open vocabularies

    CERN Document Server

    Greifender, Elke; Seadle, Michael

    2013-01-01

    Linked Data (LD), Linked Open Data (LOD) and generating a web of data, present the new knowledge sharing frontier. In a philosophical context, LD is an evolving environment that reflects humankinds' desire to understand the world by drawing on the latest technologies and capabilities of the time. LD, while seemingly a new phenomenon did not emerge overnight; rather it represents the natural progression by which knowledge structures are developed, used, and shared. Linked Open Vocabularies is a significant trajectory of LD. Linked Open Vocabularies targets vocabularies that have traditionally b

  16. Open Media Science

    DEFF Research Database (Denmark)

    Møller Moltke Martiny, Kristian; Pedersen, David Budtz; Hansted, Allan Alfred Birkegaard

    2016-01-01

    In this article, we present three challenges to the emerging Open Science (OS) movement: the challenge of communication, collaboration and cultivation of scientific research. We argue that to address these challenges OS needs to include other forms of data than what can be captured in a text...... and extend into a fully-fledged Open Media movement engaging with new media and non-traditional formats of science communication. We discuss two cases where experiments with open media have driven new collaborations between scientists and documentarists. We use the cases to illustrate different advantages...

  17. Open3DGRID

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    Description Open3DGRID is an open-source software aimed at high-throughput generation of molecular interaction fields (MIFs). Open3DGRID can generate steric potential, electron density and MM/QM electrostatic potential fields; furthermore, it can import GRIDKONT binary files produced by GRID and Co......, Solaris x86 32/64-bit, FreeBSD 32/64-bit, Intel Mac OS X 32/64-bit), source code is portable and can be compiled under any *NIX platform supporting POSIX threads. The modular nature of the code allows for easy implementation of new features, so that the core application can be customized to meet...

  18. Open Access Policy

    OpenAIRE

    University of East London, .

    2013-01-01

    The University of East London is committed to and supports open access to its research publications.\\ud There is a worldwide move towards free and unrestricted access to research publications, with benefits\\ud for researchers, universities and wider society. UEL supports this initiative and recognises the\\ud importance of open access in increasing the visibility and impact of research. This policy is aligned with\\ud and supports HEFCE’s Policy for Open Access in the Post‐2014 REF, and is alig...

  19. Open Media Science

    DEFF Research Database (Denmark)

    Møller Moltke Martiny, Kristian; Pedersen, David Budtz; Hansted, Allan Alfred Birkegaard

    2016-01-01

    In this article, we present three challenges to the emerging Open Science (OS) movement: the challenge of communication, collaboration and cultivation of scientific research. We argue that to address these challenges OS needs to include other forms of data than what can be captured in a text...... and extend into a fully-fledged Open Media movement engaging with new media and non-traditional formats of science communication. We discuss two cases where experiments with open media have driven new collaborations between scientists and documentarists. We use the cases to illustrate different advantages...

  20. 2014 CERN Accelerator Schools

    CERN Multimedia

    2014-01-01

    A specialised school on Power Converters will be held in Baden, Switzerland, from 7 to 14 May 2014. Please note that the deadline for applications is 7 FEBRUARY 2014. A course on Introduction to Accelerator Physics will be held in Prague, Czech Republic, from 31 August to 12 September 2014. Applications are now open for this school; the application deadline is 25 APRIL 2014. Further information on these schools and other CAS events can be found on the CAS website and on the Indico page. For further information please contact Barbara.strasser@cern.ch

  1. THE OPEN EDUCATION SYSTEM: FORMATION AND FUNCTIONING

    Directory of Open Access Journals (Sweden)

    Julia A. Mamonova

    2014-01-01

    Full Text Available The study is aimed at developing the basic principles of foundation and functioning of the open educational system, its relevance results from the strategic goal of knowledge integration facing the modern universities.The research findings and novelty: The author identifies the general needs of the users of open educational resources and proves the advantages of organizing the institutional repositories, based on sociological surveys targeting the university students of Nizhny Novgorod and academic staff of several Russian higher schools. The basic principles of the unified educational information and communications environment were developed, and a feasible structure of educational portal presented.The practical significance: The research outcomes, complying with the new ≪consumer strategies≫, can be used by the higher educational institutions for developing the distance system of education and implementing the open educational resources in academic process.

  2. State-of-the-Art in Open Courseware Initiatives Worldwide

    Directory of Open Access Journals (Sweden)

    Monica VLADOIU

    2011-06-01

    Full Text Available We survey here the state-of-the-art in open courseware initiatives worldwide. First, the MIT OpenCourseWare project is overviewed, as it has been the real starting point of the OCW movement. Usually, open courseware refers to a free and open digital publication of high quality university level educational materials that are organized as courses, and include course planning materials, evaluation tools, and thematic content, under a Creative Commons license. OCW is free and open, accessible to anyone, anywhere, and anytime via the Internet. The OCW initiative started in 2002, and it has been followed by many more programs that offer open access to courseware: Carnegie Mellon Open Learning Initiative, Harvard Medical School's MyCourses, Webcast.Berkeley, Rice University's Connexions, OpenCourseWare Consortium, Open Education Resources Commons, and The Saylor Foundation's Free Education Initiative, along with other major open courseware projects worldwide. The prospects for futur development of open courseware are taken into consideration, while its potential to provide for both social construction of knowledge and for development of open educational models, and therefore for E-Learning 2.0 and Web 2.0 is emphasized.

  3. Commentary: open access, open business, closed fairness!

    Science.gov (United States)

    Moustafa, Khaled

    2015-01-01

    A strong trend to move from print to online publication is largely perceived in scientific and nonscientific fields. A growing number of publishers increasingly opt for online publication as an option or a compulsory alternative. From readers' perspective, this is a highly appreciated facility, but from the author's, things are different mainly because of excessive article processing charges (APC) that make the open access system sometimes as a hindrance for many authors but a lucrative enterprise for many shareholders, enticing the most traditional and conservative publishers.

  4. On Practice and Reflection of Opening Course of“Positive Psychology”in General High Schools%普通高中开设幸福课的实践与反思

    Institute of Scientific and Technical Information of China (English)

    王艳秋

    2015-01-01

    幸福课是基于学生成长迫切需要而开设的校本课程,它可以引导学生学会如何“更幸福”。要根据学校的条件和需求,探索其开设的内容和实施手段,并不断地进行反思,积累经验。%“Positive psychology”is one of the school-based courses in light of students’urgent growth needs.It can guide the students to learn how to be “happier”.Based on the conditions and needs of school, teachers should explore the content and implementation measures,reflect and accumulate experience.

  5. THE NATION'S SCHOOL OF THE MONTH, HITHERGREEN MIDDLE SCHOOL, CENTERVILLE, OHIO. NATION'S SCHOOLS, AUGUST, 1967.

    Science.gov (United States)

    1967

    THE NATION'S SCHOOLS SCHOOL OF THE MONTH IS A BUILDING DESIGNED WITH AN OPEN INTERIOR. THERE ARE NO SEPARATE CLASSROOMS. THE MAIN SPACE IS DIVIDED INTO THREE LEARNING AREAS, PRACTICAL ARTS, ADMINISTRATIVE, AND COMMONS. FLEXIBLE PARTITIONS AND MOBILE CHALKBOARDS ACT AS VISUAL BARRIERS TO LIMIT DISTRACTIONS WHILE CARPETING AND ACOUSTIC BAFFLES…

  6. Reframing Open Big Data

    DEFF Research Database (Denmark)

    Marton, Attila; Avital, Michel; Jensen, Tina Blegind

    2013-01-01

    ’, these developments introduce an unprecedented level of societal and organizational engagement with the potential of computational data to generate new insights and information. Based on the commonalities shared by open data and big data, we develop a research framework that we refer to as open big data (OBD......Recent developments in the techniques and technologies of collecting, sharing and analysing data are challenging the field of information systems (IS) research let alone the boundaries of organizations and the established practices of decision-making. Coined ‘open data’ and ‘big data......) by employing the dimensions of ‘order’ and ‘relationality’. We argue that these dimensions offer a viable approach for IS research on open and big data because they address one of the core value propositions of IS; i.e. how to support organizing with computational data. We contrast these dimensions with two...

  7. Special restaurant opening times

    CERN Multimedia

    HR Department

    2008-01-01

    1-EASTER Restaurant No. 1 (Novae) will be closed from Friday, 21 March to Monday, 24 March inclusive and will re-open at 7.00 a.m. on Tuesday, 25 March. Restaurant No. 2 (DSR) will remain open during the four days in question (the opening hours can be consulted at: http://resto2.web.cern.ch/resto2/Events/easter2008.html 2-ASCENSION Restaurant No. 2 (DSR) will be closed from Thursday, 1st May to Friday, 2 May. Restaurant No. 2 (Novae) will remain open during the two days in question (from 7.00 a.m. to 10.00 p.m. on the Thursday and from 7.00 till midnight, as usual, on the Friday).

  8. Open Hardware at CERN

    CERN Multimedia

    CERN Knowledge Transfer Group

    2015-01-01

    CERN is actively making its knowledge and technology available for the benefit of society and does so through a variety of different mechanisms. Open hardware has in recent years established itself as a very effective way for CERN to make electronics designs and in particular printed circuit board layouts, accessible to anyone, while also facilitating collaboration and design re-use. It is creating an impact on many levels, from companies producing and selling products based on hardware designed at CERN, to new projects being released under the CERN Open Hardware Licence. Today the open hardware community includes large research institutes, universities, individual enthusiasts and companies. Many of the companies are actively involved in the entire process from design to production, delivering services and consultancy and even making their own products available under open licences.

  9. Open cycle thermoacoustics

    Energy Technology Data Exchange (ETDEWEB)

    Reid, Robert Stowers [Georgia Inst. of Technology, Atlanta, GA (United States)

    2000-01-01

    A new type of thermodynamic device combining a thermodynamic cycle with the externally applied steady flow of an open thermodynamic process is discussed and experimentally demonstrated. The gas flowing through this device can be heated or cooled in a series of semi-open cyclic steps. The combination of open and cyclic flows makes possible the elimination of some or all of the heat exchangers (with their associated irreversibility). Heat is directly exchanged with the process fluid as it flows through the device when operating as a refrigerator, producing a staging effect that tends to increase First Law thermodynamic efficiency. An open-flow thermoacoustic refrigerator was built to demonstrate this concept. Several approaches are presented that describe the physical characteristics of this device. Tests have been conducted on this refrigerator with good agreement with a proposed theory.

  10. Privacy and Open Government

    Directory of Open Access Journals (Sweden)

    Teresa Scassa

    2014-06-01

    Full Text Available The public-oriented goals of the open government movement promise increased transparency and accountability of governments, enhanced citizen engagement and participation, improved service delivery, economic development and the stimulation of innovation. In part, these goals are to be achieved by making more and more government information public in reusable formats and under open licences. This paper identifies three broad privacy challenges raised by open government. The first is how to balance privacy with transparency and accountability in the context of “public” personal information. The second challenge flows from the disruption of traditional approaches to privacy based on a collapse of the distinctions between public and private sector actors. The third challenge is that of the potential for open government data—even if anonymized—to contribute to the big data environment in which citizens and their activities are increasingly monitored and profiled.

  11. Summer Restaurant opening times

    CERN Multimedia

    2015-01-01

    Restaurant No. 1: Open as usual in July and August. Open from 7 a.m. to 10 p.m. on Thursday, 10 September (Jeûne genevois).   Restaurant No. 2: Open as usual in July and August. Closed on Thursday, 10 September (Jeûne genevois) and Friday, 11 September. The Brasserie (table service) will be closed from Monday, 4 August to Friday, 11 September.   Restaurant No. 3: Open as usual in July and August, but closed on Saturday, 1 August; Saturday, 15 August; Thursday, 10 September (Jeûne genevois); and Friday, 11 September.   Snack bar in Building 54: Closed from Monday, 4 August to Friday, 11 September.   Snack bars in Buildings 13, 30 and 6: Closed on Thursday, 10 September (Jeûne genevois) and Friday, 11 September.

  12. Reframing Open Big Data

    DEFF Research Database (Denmark)

    Marton, Attila; Avital, Michel; Jensen, Tina Blegind

    2013-01-01

    Recent developments in the techniques and technologies of collecting, sharing and analysing data are challenging the field of information systems (IS) research let alone the boundaries of organizations and the established practices of decision-making. Coined ‘open data’ and ‘big data......’, these developments introduce an unprecedented level of societal and organizational engagement with the potential of computational data to generate new insights and information. Based on the commonalities shared by open data and big data, we develop a research framework that we refer to as open big data (OBD......) by employing the dimensions of ‘order’ and ‘relationality’. We argue that these dimensions offer a viable approach for IS research on open and big data because they address one of the core value propositions of IS; i.e. how to support organizing with computational data. We contrast these dimensions with two...

  13. Trade Openness and Inequality

    Directory of Open Access Journals (Sweden)

    Nasfi Fkili Wahiba

    2013-12-01

    Full Text Available This paper is intended to test the effect of trade openness on inequality of wage distribution in Tunisia. The study through econometric estimates showed that the impact of openness on inequality is remarkable in the period marked by an intensive integration into the global economy. However, investment in human capital can have a positive effect and leas to reduce wage disparities. Opening to the world economy is able to achieve positive economic performance, except that one of the challenges for Tunisia is to find the best equilibrium between the benefits and costs of this policy. Globalization can be beneficial for the economy, but the debate is open about its impact on the social level, many are those who accuse it of increasing disparities and inequalities between workers.

  14. The Open Access Divide

    National Research Council Canada - National Science Library

    Jingfeng Xia

    2013-01-01

      This paper is an attempt to review various aspects of the open access divide regarding the difference between those academics who support free sharing of data and scholarly output and those academics who do...

  15. ON REICH'S OPEN QUESTION

    Institute of Scientific and Technical Information of China (English)

    张石生

    2003-01-01

    Under more general form and more general conditions an affirmative answer to Reich's open question is given. The results presented also extend and improve some recent results of Reich, Shioji, Takahashi and Wittmann.

  16. Opening the Floodgates

    DEFF Research Database (Denmark)

    Wessel, Michael; Thies, Ferdinand; Benlian, Alexander

    2017-01-01

    Managing platform ecosystems requires providers to govern the permeability of platform boundaries in order to strike a balance between openness and control. But is it worthwhile for platform providers to conduct screening processes for third-party offerings, or should they rather apply a laissez......,000 crowdfunding campaigns with a combined funding of over $1.9 billion that cover a 4-year period around the policy change, we find that increasing platform openness was a double-edged sword for the platform’s ecosystem. While Kickstarter’s revenue from commissions surged after the policy change due...... uncertainties as project creators invest less in reducing information asymmetries. Our evidence from this natural experiment therefore suggests that increasing platform openness for third-party offerings can destabilize a platform’s ecosystem. We thus extend the literature on platform openness...

  17. Open3DALIGN

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    of the dataset either the single conformation originally imported or the conformational databases previously obtained by QMD. Additionally, SDF conformational databases can be easily imported from external conformational engines such as MOE and OMEGA. In the latter case, the conformers which best fit...... application can be customized to meet individual needs. A detailed ChangeLog is kept to keep track of the additions and modifications during Open3DALIGN's development.......Description Open3DALIGN is an open-source software aimed at unsupervised molecular alignment. Open3DALIGN is a command-line tool which is operated by means of a few commands which can be entered interactively from a command prompt, read from a batch script or piped through standard input. If Py...

  18. Official Antimonopoly Website Opens

    Institute of Scientific and Technical Information of China (English)

    Guo Liqin

    2011-01-01

    @@ China's antimonopoly law website opened in December 19, 2009.Netizens can log in at http://www.antimonopolylaw.org to see the update information of indepth anti-monopoly law theory and case studies, according to the organizer.

  19. Open to Suggestion.

    Science.gov (United States)

    Journal of Reading, 1984

    1984-01-01

    Contributors offer suggestions concerning parents as reading stimulators, book discussions, a test bank for the secondary school/college reading lab, standardized reading tests, television reading, plagiarism, vocabulary development, and book reports. (FL)

  20. Opening up codings?

    DEFF Research Database (Denmark)

    Steensig, Jakob; Heinemann, Trine

    2015-01-01

    We welcome Tanya Stivers’s discussion (Stivers, 2015/this issue) of coding social interaction and find that her descriptions of the processes of coding open up important avenues for discussion, among other things of the precise ad hoc considerations that researchers need to bear in mind, both when....... Instead we propose that the promise of coding-based research lies in its ability to open up new qualitative questions....

  1. Funding open access

    Science.gov (United States)

    Sprouse, Gene D.; Zimmermann, Frank

    2009-03-01

    We were happy to see the 10-year anniversary of our open-access journal Physical Review Special Topics: Accelerators and Beams (PRST-AB) mentioned in your news article on open-access publishing (December 2008 pp13-14). However, your statement that PRST-AB "is funded by US national labs, whose researchers publish about 150 papers per year in the journal" is not entirely correct.

  2. Open source molecular modeling.

    Science.gov (United States)

    Pirhadi, Somayeh; Sunseri, Jocelyn; Koes, David Ryan

    2016-09-01

    The success of molecular modeling and computational chemistry efforts are, by definition, dependent on quality software applications. Open source software development provides many advantages to users of modeling applications, not the least of which is that the software is free and completely extendable. In this review we categorize, enumerate, and describe available open source software packages for molecular modeling and computational chemistry. An updated online version of this catalog can be found at https://opensourcemolecularmodeling.github.io.

  3. Demystifying Open Access

    Energy Technology Data Exchange (ETDEWEB)

    Mele, Salvatore

    2007-05-14

    The tenets of Open Access are to grant anyone, anywhere and anytime free access to the results of scientific research. HEP spearheaded the Open Access dissemination of scientific results with the mass mailing of preprints in the pre-WWW era and with the launch of the arXiv preprint system at the dawn of the '90s. The HEP community is now ready for a further push to Open Access while retaining all the advantages of the peer-review system and, at the same time, bring the spiralling cost of journal subscriptions under control. I will present a possible plan for the conversion to Open Access of HEP peer-reviewed journals, through a consortium of HEP funding agencies, laboratories and libraries: SCOAP3 (Sponsoring Consortium for Open Access Publishing in Particle Physics). SCOAP3 will engage with scientific publishers towards building a sustainable model for Open Access publishing, which is as transparent as possible for HEP authors. The current system in which journals income comes from subscription fees is replaced with a scheme where SCOAP3 compensates publishers for the costs incurred to organise the peer-review service and give Open Access to the final version of articles. SCOAP3 will be funded by all countries active in HEP under a 'fair share' scenario, according to their production of HEP articles. In this talk I will present a short overview of the history of Open Access in HEP, the details of the SCOAP3 model and the outlook for its implementation.

  4. Open Access Publishing

    Directory of Open Access Journals (Sweden)

    Amelia Hadfield

    2013-07-01

    Full Text Available The rise of open source online journals, free online courses, and other changes in the research and education environment, coined the "academic spring" by some commentators, represents an increasing trend in opening up the rules of access for research. Universities, libraries, publishers and even govern­ments are paying attention to this new movement often referred to with the acronym A2K (access to knowledge.

  5. Open for Entrepreneurship

    DEFF Research Database (Denmark)

    Eftekhari, Nazanin; Bogers, Marcel

    2015-01-01

    This paper explores how an open approach to new venture creation - purposefully managing knowledge flows across the venture's organizational boundary - can be beneficial for start-up entrepreneurs. Our inductive case study, of both failure and success, identifies the key attributes of this open...... for entrepreneurship and innovation research and practice, providing some attention points for researchers, entrepreneurs, investors and policy makers interested in developing successful new ventures....

  6. The Open AUC Project.

    Science.gov (United States)

    Cölfen, Helmut; Laue, Thomas M; Wohlleben, Wendel; Schilling, Kristian; Karabudak, Engin; Langhorst, Bradley W; Brookes, Emre; Dubbs, Bruce; Zollars, Dan; Rocco, Mattia; Demeler, Borries

    2010-02-01

    Progress in analytical ultracentrifugation (AUC) has been hindered by obstructions to hardware innovation and by software incompatibility. In this paper, we announce and outline the Open AUC Project. The goals of the Open AUC Project are to stimulate AUC innovation by improving instrumentation, detectors, acquisition and analysis software, and collaborative tools. These improvements are needed for the next generation of AUC-based research. The Open AUC Project combines on-going work from several different groups. A new base instrument is described, one that is designed from the ground up to be an analytical ultracentrifuge. This machine offers an open architecture, hardware standards, and application programming interfaces for detector developers. All software will use the GNU Public License to assure that intellectual property is available in open source format. The Open AUC strategy facilitates collaborations, encourages sharing, and eliminates the chronic impediments that have plagued AUC innovation for the last 20 years. This ultracentrifuge will be equipped with multiple and interchangeable optical tracks so that state-of-the-art electronics and improved detectors will be available for a variety of optical systems. The instrument will be complemented by a new rotor, enhanced data acquisition and analysis software, as well as collaboration software. Described here are the instrument, the modular software components, and a standardized database that will encourage and ease integration of data analysis and interpretation software.

  7. Reframing the English Grammar Schools Debate

    Science.gov (United States)

    Morris, Rebecca; Perry, Thomas

    2017-01-01

    In October 2015 the Department for Education (DfE) permitted a grammar school in Tonbridge, Kent, to open up an annexe in Sevenoaks, 10 miles away. Amidst claims that the annexe was essentially a new grammar school, the decision reignited an old debate about the value of academically-selective "grammar" schools in England. The intensity…

  8. Polish Complementary Schools in Iceland and England

    Science.gov (United States)

    Zielinska, Malgorzata; Kowzan, Piotr; Ragnarsdóttir, Hanna

    2014-01-01

    Since 2004, the opening of labour markets has spurred a considerable number of Poles to emigrate e.g. to Iceland and England. Families with school age children have had the challenge of adapting to foreign environments and school systems. Polish complementary schools have played an important, albeit ambivalent, role in this process. Through focus…

  9. Extending School Hours: A Capital Idea.

    Science.gov (United States)

    Jones, John Hodge

    1995-01-01

    The Murfreesboro, Tennessee, City Schools have doubled the amount of time schools are open without raising taxes. Instead of going home to empty houses, kids participate in an extended school program offering over 100 courses in recreation, academics, arts, and life skills. Parents and organizations foot the costs; no child is excluded for…

  10. School Social Work Worldwide.

    Science.gov (United States)

    Huxtable, Marion, Ed.; Blyth, Eric, Ed.

    This book, with sequentially arranged chapters, allow practitioners, educators, and students to follow the expansion of school social work practice around the world. Leaders in the field from 12 countries provide eye-opening perspectives and interventions, selected for their range and application. Additionally, the book looks ahead to policy and…

  11. From Learning in Coffee Houses to Learning with Open Educational Resources

    Science.gov (United States)

    Peter, Sandra; Farrell, Lesley

    2013-01-01

    What is "open" about Open Educational Resources? How does education become "open" when it is removed from the institutional housing of the school or the university and develops in public social settings? Has the Internet, in providing educational content without cost and free of copyright restrictions, provoked a unique and…

  12. Effectiveness of Different Medium of Education to Imparting Knowledge at Bangladesh Open University

    Science.gov (United States)

    Islam, Anwarul; Islam, Nasirul

    2008-01-01

    Open and distance learning system meanly based on different types of media to impart education to the learners. Bangladesh Open University (BOU) offered education through open and distance learning system. There are two largest programs one is Secondary School Certificate (SSC) and another one is Higher Secondary Certificate (HSC) offered by BOU…

  13. From Learning in Coffee Houses to Learning with Open Educational Resources

    Science.gov (United States)

    Peter, Sandra; Farrell, Lesley

    2013-01-01

    What is "open" about Open Educational Resources? How does education become "open" when it is removed from the institutional housing of the school or the university and develops in public social settings? Has the Internet, in providing educational content without cost and free of copyright restrictions, provoked a unique and…

  14. Business Models for Open Innovation

    DEFF Research Database (Denmark)

    Saebi, Tina; Foss, Nicolai Juul

    of open business models by systematically linking open innovation strategies to core business model dimensions, notably the content, structure, governance of transactions. We further illustrate a continuum of open innovativeness, differentiating between four types of open business models. We contribute......Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies’ business models are not attuned to open strategies. Accordingly, we propose a contingency model...... to the open innovation literature by specifying the conditions under which business models are conducive to the success of open innovation strategies....

  15. Business Models for Open Innovation

    DEFF Research Database (Denmark)

    Saebi, Tina; Foss, Nicolai J.

    2015-01-01

    of open business models by systematically linking open innovation strategies to core business model dimensions, notably the content, structure, governance of transactions. We further illustrate a continuum of open innovativeness, differentiating between four types of open business models. We contribute......Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies' business models are not attuned to open strategies. Accordingly, we propose a contingency model...... to the open innovation literature by specifying the conditions under which business models are conducive to the success of open innovation strategies....

  16. UK Open Access Policy Landscape

    OpenAIRE

    Picarra, Mafalda

    2014-01-01

    Two distinct paths for open access are being promoted in UK open access policies: open access publishing (gold open access) by RCUK (Gold OA) and self-archiving (green open access) by HEFCE. This requires continuous and coordinated efforts to support universities, academic libraries and researchers in achieving compliance.

  17. Open Educational Resources and Informational Ecosystems: «Edutags» as a connector for open learning

    Directory of Open Access Journals (Sweden)

    Michael Kerres

    2014-10-01

    Full Text Available Teaching and learning in school essentially relies on analogous and digital media, artefacts and tools of all kinds. They are supported and provided by various players. The role of these players for providing learning infrastructures and the interaction between them are discussed in the following paper. Increasingly, Open Educational Resources (OER become available and the question arises how the interaction between these players is impacted. On the one hand, some players implement closed informational ecosystems that might provide a rich and coherent environment for learning, but also lock the users into a defined and often restricted environment. On the other hand, other players are interested in developing an infrastructure that supports open learning without the boundaries of closed informational ecosystems. Such open informational ecosystems must provide interconnections to numerous, in principal, unlimited number of platforms for learning contents. In the context of the project «Edutags» a reference platform is being implemented by way in which the contents of various providers are being connected and enriched through user-generated tags, commentaries and evaluations. The discussion points out that such an independent reference platform, operated separately from content platforms, must be considered as an important element in an open and truly distributed infrastructure for learning resources. Hence, we do not only need open educational resources to support open learning, we also need to establish an open informational ecosystem that supports such approaches.

  18. School bullying

    DEFF Research Database (Denmark)

    of open-ended, social, discursive, material and subjective forces. Instead of approaching bullying as a phenomenon that can be explained and defined in terms of one factor (e.g., aggression), the authors in this anthology focus on a range of different forces that are central in bullying: teachers (Hansen......), school principals and parents (Hein), classroom culture with its particular experiences and histories (Hansen, Henningsen and Kofoed) and the virtual experiences of children – both in terms of their electronically mediated communications and the media products with and through which they play...... and interact (Kofoed; Søndergaard). Other chapters focus on social factors in relation to gender, sexuality, race and class (Meyer) and the role of normativity in understanding bullying more generally (Ellwood and Davies; Laustsen). These chapters by no means exhaust the range of intra-acting forces at work...

  19. Healthy Schools

    Science.gov (United States)

    ... Wellness Policy Opportunities to create and support a healthy school environment. More Whole School, Whole Community, Whole Child A collaborative approach to learning and health Healthy Schools School Nutrition Environment Childhood Nutrition Facts Energy Drinks Obesity Prevention Youth ...

  20. Open Day: General Information

    CERN Multimedia

    2004-01-01

    http://www.cern.ch/cern50/ With 50 visit points, including theatre performances, debates and visits to installations that have never before been opened to the public, CERN's 50th anniversary Open Day is set to be a day to remember. Seven hundred volunteers have signed up to help for the day. The Open Day team truly appreciates this wonderful show of support! The Open Day would not be possible without their help. Car parking and Access Cars with a CERN sticker can access all CERN sites as normal. However, to avoid congestion on Meyrin site, we ask you to park in areas that will not be open to the public (see below) and to use the shuttle services wherever possible for your transport during the day. Private cars on the French side of the border without a CERN sticker will be diverted to a car park area in the Prévessin site. There is a shuttle service connecting the Meyrin and Prévessin sites via SM18 every 20 minutes. Private cars on the Swiss side of the border without a CERN sticker will be diverte...

  1. CERN: Digitally open, too

    CERN Multimedia

    Computer Security Team

    2013-01-01

    The Open Days are here!! From tomorrow onwards, we will be welcoming thousands of people to CERN. No barriers, no boundaries!   For decades, we have welcomed researchers and visitors from around the world to work at CERN, discuss physics research and attend our training sessions, lectures and conferences. This is how fundamental research should be conducted!!! But have you ever noticed how you are welcome at CERN in the digital world, too? Once you are affiliated and are registered with CERN, you receive a CERN computing account and e-mail address.  You can register your laptops, PCs and smartphones to use our (wireless) network, you can easily create your personal webpage, and profit from a vast disk space for file storage (AFS and DFS). CERN is indeed an Open Campus and not only during the Open Days. CERN is an Open Campus in the digital world. This digital Open Campus culture is exactly the reason why “computer security” has been dele...

  2. Global OpenSearch

    Science.gov (United States)

    Newman, D. J.; Mitchell, A. E.

    2015-12-01

    At AGU 2014, NASA EOSDIS demonstrated a case-study of an OpenSearch framework for Earth science data discovery. That framework leverages the IDN and CWIC OpenSearch API implementations to provide seamless discovery of data through the 'two-step' discovery process as outlined by the Federation for Earth Sciences (ESIP) OpenSearch Best Practices. But how would an Earth Scientist leverage this framework and what are the benefits? Using a client that understands the OpenSearch specification and, for further clarity, the various best practices and extensions, a scientist can discovery a plethora of data not normally accessible either by traditional methods (NASA Earth Data Search, Reverb, etc) or direct methods (going to the source of the data) We will demonstrate, via the CWICSmart web client, how an earth scientist can access regional data on a regional phenomena in a uniform and aggregated manner. We will demonstrate how an earth scientist can 'globalize' their discovery. You want to find local data on 'sea surface temperature of the Indian Ocean'? We can help you with that. 'European meteorological data'? Yes. 'Brazilian rainforest satellite imagery'? That too. CWIC allows you to get earth science data in a uniform fashion from a large number of disparate, world-wide agencies. This is what we mean by Global OpenSearch.

  3. Open Source Telecommunication Companies

    Directory of Open Access Journals (Sweden)

    Peter Liu

    2007-08-01

    Full Text Available Little is known about companies whose core business is selling telecommunications products that lever open source projects. Open source telecommunications (OST companies operate in markets that are very different from typical software product markets. The telecommunications market is regulated, vertically integrated, and proprietary designs and special chips are widely used. For a telecommunications product to be useful, it must interact with both access network products and core network products. Due to specifications in Service Agreements Levels, penalties for failures of telecommunications products are very high. This article shares information that is not widely known, including a list of OST companies and the open source projects on which they depend, the size and diversity of venture capital investment in OST companies, the nature of the commercial product-open source software and company-project relationships, ways in which OST companies make money, benefits and risks of OST companies, and competition between OST companies. Analysis of this information provides insights into the ways in which companies can build business models around open source software. These findings will be of interest to entrepreneurs, top management teams of incumbent companies that sell telecommunications products, and those who care about Ontario's ability to compete globally.

  4. Open Biomedical Engineering education in Africa.

    Science.gov (United States)

    Ahluwalia, Arti; Atwine, Daniel; De Maria, Carmelo; Ibingira, Charles; Kipkorir, Emmauel; Kiros, Fasil; Madete, June; Mazzei, Daniele; Molyneux, Elisabeth; Moonga, Kando; Moshi, Mainen; Nzomo, Martin; Oduol, Vitalice; Okuonzi, John

    2015-08-01

    Despite the virtual revolution, the mainstream academic community in most countries remains largely ignorant of the potential of web-based teaching resources and of the expansion of open source software, hardware and rapid prototyping. In the context of Biomedical Engineering (BME), where human safety and wellbeing is paramount, a high level of supervision and quality control is required before open source concepts can be embraced by universities and integrated into the curriculum. In the meantime, students, more than their teachers, have become attuned to continuous streams of digital information, and teaching methods need to adapt rapidly by giving them the skills to filter meaningful information and by supporting collaboration and co-construction of knowledge using open, cloud and crowd based technology. In this paper we present our experience in bringing these concepts to university education in Africa, as a way of enabling rapid development and self-sufficiency in health care. We describe the three summer schools held in sub-Saharan Africa where both students and teachers embraced the philosophy of open BME education with enthusiasm, and discuss the advantages and disadvantages of opening education in this way in the developing and developed world.

  5. Open3DALIGN

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    Description Open3DALIGN is an open-source software aimed at unsupervised molecular alignment. Open3DALIGN is a command-line tool which is operated by means of a few commands which can be entered interactively from a command prompt, read from a batch script or piped through standard input. If Py...... systems (Windows 32/64-bit, Linux 32/64-bit, Solaris x86 32/64-bit, FreeBSD 32/64-bit, Intel Mac OS X 32/64-bit), source code is portable and can be compiled under any *NIX platform supporting POSIX threads. The modular nature of the code allows for easy implementation of new features, so that the core...

  6. Support open access publishing

    DEFF Research Database (Denmark)

    Ekstrøm, Jeannette

    2013-01-01

    Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante tidsskriftsinformati......Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante...... tidsskriftsinformationer (faglig disciplin, BFI niveau, Impact Factor, Open Access) vil kunne danne sig et hurtigt overblik, for derved at kunne træffe et kvalificeret valg om, hvor og hvordan man skal publicere sine forskningsresultater....

  7. Strategies for Fostering the Efficacy of School-Based Management ...

    African Journals Online (AJOL)

    Strategies for Fostering the Efficacy of School-Based Management Committee Practice for Quality ... Generally, the stakeholders identified apathy, lack of time, poor ... headmasters should create an open environment for school community and ...

  8. New gate opening hours

    CERN Multimedia

    GS Department

    2009-01-01

    Please note the new opening hours of the gates as well as the intersites tunnel from the 19 May 2009: GATE A 7h - 19h GATE B 24h/24 GATE C 7h - 9h\t17h - 19h GATE D 8h - 12h\t13h - 16h GATE E 7h - 9h\t17h - 19h Prévessin 24h/24 The intersites tunnel will be opened from 7h30 to 18h non stop. GS-SEM Group Infrastructure and General Services Department

  9. Open Day at SHMI.

    Science.gov (United States)

    Jarosova, M.

    2010-09-01

    During the World Meteorological Day there has been preparing "Open Day" at Slovak Hydrometeorological Institute. This event has more than 10 years traditions. "Open Day" is one of a lot of possibilities to give more information about meteorology, climatology, hydrology too to public. This "Day" is executed in whole Slovakia. People can visit the laboratories, the forecasting room....and meteo and clima measuring points. The most popular is visiting forecasting room. Visitors are interested in e.g. climatologic change in Slovakia territory, preparing weather forecasting, dangerous phenomena.... Every year we have more than 500 visitors.

  10. Using OpenRefine

    CERN Document Server

    Verborgh, Ruben

    2013-01-01

    The book is styled on a Cookbook, containing recipes - combined with free datasets - which will turn readers into proficient OpenRefine users in the fastest possible way.This book is targeted at anyone who works on or handles a large amount of data. No prior knowledge of OpenRefine is required, as we start from the very beginning and gradually reveal more advanced features. You don't even need your own dataset, as we provide example data to try out the book's recipes.

  11. Gates Wide Open

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    China vows to further open up its market to spur international and domestic economic development China’s entry into the WTO 10 years a go was a major step in the country’s reform and opening up. It indicated the "beginning of a new historic stage"in the country’s interaction with the rest of the world, said Chinese President Hu Jintao, at a high-level forum marking the 10th anniversary of China’s accession to the

  12. Ready to be Open?

    DEFF Research Database (Denmark)

    Monteiro, L. Felipe; Mol, Michael J.; Birkinshaw, Julian

    2016-01-01

    suggest that a firm's lack of resources and absorptive capacity, as well as its use of secrecy, are significant barriers to benefiting from openness to external knowledge. Using responses from 12,152 firms to the fourth and fifth UK versions of the Community Innovation Survey (CIS), we generate findings......This paper provides new theory and evidence about the benefits of openness on a firm's innovation performance and, more importantly, the specific firm-level contingencies under which those benefits are more (or less) likely to be observed. Building on Dyer and Singh's (1998) relational view, we...

  13. Ready to be Open?

    DEFF Research Database (Denmark)

    Monteiro, L. Felipe; Mol, Michael J.; Birkinshaw, Julian

    suggest that a firm's lack of resources and absorptive capacity, as well as its use of secrecy, are significant barriers to benefiting from openness to external knowledge. Using responses from 12,152 firms to the fourth and fifth UK versions of the Community Innovation Survey (CIS) we generate findings......This paper provides new theory and evidence about the benefits of openness on a firm's innovation performance and, more importantly, the specific firm-level contingencies under which those benefits are more (or less) likely to be observed. Building on Dyer and Singh's (1998) relational view, we...

  14. Religious Charter Schools: Gaining Ground yet Still Undefined

    Science.gov (United States)

    Weinberg, Lawrence D.

    2009-01-01

    This article examines charter schools from the perspective of religious institutions and parents that may want to open such schools. Religion-based charter schools also pose unique policy and legal questions because charter schools are a singular reform method. It examines the relevant, recent and historical, legal cases, and relevant examples of…

  15. Discourses of Learning Difficulty and the Conditions of School Development.

    Science.gov (United States)

    Skidmore, David

    1999-01-01

    Although the "consensus thesis" assumes that learning difficulties arise from school structural deficiencies, a study of two English secondary schools concludes that the thesis fails to account for complexities of school development. Instead, open-ended dialog between contrasting discourses would foster dynamic school cultures. (SK)

  16. Architectural Survey of Pence Elementary School, Fort Leonard Wood, Missouri

    Science.gov (United States)

    2011-09-01

    School, Cunningham, Tennessee (Sanders)............................ 16 Figure 15. Disney School site plan (Tanner 2006, 16...17 Figure 16. Disney School open classroom (Tanner 2006, 17...heat- ing, toilet facilities , and fire safety created much nicer environments for the students (Graves 1993, 25). Still, schools were basically stacks

  17. Torii, an Open Portal over Open Archives

    CERN Document Server

    Bertocco, S

    2001-01-01

    The world of academic publishing is undergoing many changes. Everywhere paper-based publishing is being replaced by electronic archives and ink printing by bits. Unrestricted (web) access to many resources is becoming a fundamental feature of the academic research environment. Particularly in the high-energy physics community, the pre-print distribution has moved completely away from the paper-based system into a fully electronic system based on open archives. At the same time, freely accessible peer-reviewed journals have started to challenge the more traditional, and paper-based journals showing that the entire paper-based cycle can be effectively replaced by a web-based one. The TIPS project was born in this environment and from these observations. It is based on the idea that further progress in information distribution and scientific publishing on the web requires some key ingredients: the implementation of a more extensive semantic structure in the documents that are exchanged; a unified, desktop-like, ...

  18. Building the Open Elements of an Open Data Competition

    NARCIS (Netherlands)

    d'Aquin, Mathieu; Dietze, Stefan; Drachsler, Hendrik; Guy, Marieke; Herder, Eelco; Parodi, Elisabetta

    2014-01-01

    The European Union is increasingly committed to pushing forward open approaches as indicated by the G8 Open Data Charter, the Opening Up Education initiative, the launch of the Open Education Europa Portal for OER resources and other similar initiatives. The EU-funded LinkedUp Project (Linking Web d

  19. 初中物理课开放式课堂教学方法探索%The Junior Middle School Physics Class Open Classroom Teaching Methods to Explore

    Institute of Scientific and Technical Information of China (English)

    陈孝军

    2014-01-01

    The open classroom education originated in European countries,decades after the widely used in various countries,this kind of teaching way to think about for the traditional closed classroom education has the very good teaching effect,especially for physics teaching this kind of practical stronger discipline.%开放式的课堂教学起源于欧洲国家,在此之后的几十年间在各个国家被广泛使用,这种教学方式对于传统式封闭的课堂教育具有非常好的教学效果,特别是针对物理教学这种实用性比较强的学科。

  20. The Return of All-Girls’ Schools

    Institute of Scientific and Technical Information of China (English)

    JENNIFER; LIM

    1998-01-01

    MORE than a year ago, a ceremony was held to celebrate the opening of the first senior high school for girls in Beijing since the Cultural Revolution—the Beijing Huaxia Girls’ Middle School. The revival of sex-segregated education has elicited much attention; people are expressing a whole range of different opinions about these schools. "Girls’ schools are by no means a novelty," said Wang Zhaoti, a famous

  1. A escola de qualidade para todos: abrindo as camadas da cebola La escuela de calidad para todos: abriendo las cáscaras de la cebolla Qualified school for all: opening the peels of the onion

    Directory of Open Access Journals (Sweden)

    Candido Alberto Gomes

    2005-09-01

    numerous findings today on how to build a qualified school for all. This paper recognizes the importance of the social origins of the students, educational management, evaluation, curricular organization etc. However, if focuses on selected features related to the differences among and within schools, on the basis of the national and international literature. Considering that the peculiar structure of the educational systems is similar to an onion, with its successive peels, this work analyses factors affecting learning, such as expenditure, facilities and equipment, time, teachers, school climate and management, peer effects, enrollment procedures, space management, student grouping, and other factors that affect effectively in the classroom. Therefore, it is possible to shape such a school, particularly in developing countries, where its impact is stronger than in developed countries.

  2. CERN openlab Open Day

    CERN Multimedia

    Purcell, Andrew Robert

    2015-01-01

    The CERN openlab Open Day took place on 10 June, 2015. This was the first in a series of annual events at which research and industrial teams from CERN openlab can present their projects, share achievements, and collect feedback from their user communities.

  3. Open Source Software Acquisition

    DEFF Research Database (Denmark)

    Holck, Jesper; Kühn Pedersen, Mogens; Holm Larsen, Michael

    2005-01-01

    Lately we have seen a growing interest from both public and private organisations to adopt OpenSource Software (OSS), not only for a few, specific applications but also on a more general levelthroughout the organisation. As a consequence, the organisations' decisions on adoption of OSS arebecoming...

  4. Open source development

    DEFF Research Database (Denmark)

    Ulhøi, John Parm

    2004-01-01

    This paper addresses innovations based on open source or non-proprietary knowledge. Viewed through the lens of private property theory, such agency appears to be a true anomaly. However, by a further turn of the theoretical kaleidoscope, we will show that there may be perfectly justifiable reason...

  5. Massive and Open

    Science.gov (United States)

    Fasimpaur, Karen

    2013-01-01

    MOOCs--massive open online courses--are all the rage these days, with hundreds of thousands of participants signing up and investors plunking down millions to get a piece of the pie. Why is there so much excitement about this new disruptive form of online learning, and how does this model apply to professional learning for teachers? Traditional…

  6. Bisimulation from Open Maps

    DEFF Research Database (Denmark)

    Joyal, André; Nielsen, Mogens; Winskel, Glynn

    1996-01-01

    and van Glabeek and Goltz. A tie-up with open maps in a (pre)topos, as they appear in the work of Joyal and Moerdijk, brings to light a new model, presheaves on categories of pomsets, into which the usual category of labelled event structures embeds fully and faithfully. As an indication of its promise...

  7. Bisimulation and open maps

    DEFF Research Database (Denmark)

    Joyal, André; Nielsen, Mogens; Winskel, Glynn

    1993-01-01

    ), and Goltz and van Glabeek (1989). A tie-up with open maps in a (pre)topos brings to light a promising new model, presheaves on categories of pomsets, into which the usual category of labeled event structures embeds fully and faithfully. As an indication of its promise, this new presheaf model has refinement...

  8. TIRES, OPEN BURNING

    Science.gov (United States)

    The chapter describes available information on the health effects from open burning of rubber tires. It concentrates on the three known sources of detailed measurements: (1) a small-scale emissions characterization study performed by the U.S. EPA in a facility designed to simulat...

  9. Evaluating Open Source Portals

    Science.gov (United States)

    Goh, Dion; Luyt, Brendan; Chua, Alton; Yee, See-Yong; Poh, Kia-Ngoh; Ng, How-Yeu

    2008-01-01

    Portals have become indispensable for organizations of all types trying to establish themselves on the Web. Unfortunately, there have only been a few evaluative studies of portal software and even fewer of open source portal software. This study aims to add to the available literature in this important area by proposing and testing a checklist for…

  10. Open Source in Education

    Science.gov (United States)

    Lakhan, Shaheen E.; Jhunjhunwala, Kavita

    2008-01-01

    Educational institutions have rushed to put their academic resources and services online, beginning the global community onto a common platform and awakening the interest of investors. Despite continuing technical challenges, online education shows great promise. Open source software offers one approach to addressing the technical problems in…

  11. Open-Source Colorimeter

    Science.gov (United States)

    Anzalone, Gerald C.; Glover, Alexandra G.; Pearce, Joshua M.

    2013-01-01

    The high cost of what have historically been sophisticated research-related sensors and tools has limited their adoption to a relatively small group of well-funded researchers. This paper provides a methodology for applying an open-source approach to design and development of a colorimeter. A 3-D printable, open-source colorimeter utilizing only open-source hardware and software solutions and readily available discrete components is discussed and its performance compared to a commercial portable colorimeter. Performance is evaluated with commercial vials prepared for the closed reflux chemical oxygen demand (COD) method. This approach reduced the cost of reliable closed reflux COD by two orders of magnitude making it an economic alternative for the vast majority of potential users. The open-source colorimeter demonstrated good reproducibility and serves as a platform for further development and derivation of the design for other, similar purposes such as nephelometry. This approach promises unprecedented access to sophisticated instrumentation based on low-cost sensors by those most in need of it, under-developed and developing world laboratories. PMID:23604032

  12. Open-Ended Evolution

    DEFF Research Database (Denmark)

    Taylor, Tim; A. Bedau, Mark; Channon, Alastair

    2016-01-01

    This report describes the First Workshop on Open-Ended Evolution: Recent Progress and Future Milestones (OEE1), held during the ECAL 2015 conference at the University of York, U.K., in July 2015. We briefly summarise the content of the talks and discussions and the workshop, and provide links...

  13. Quasi-open inflation

    CERN Document Server

    García-Bellido, J; Montes, X; Garcia-Bellido, Juan; Garriga, Jaume; Montes, Xavier

    1998-01-01

    We show that a large class of two-field models of single-bubble open inflation do not lead to infinite open universes, as it was previously thought, but to an ensemble of very large but finite inflating `islands'. The reason is that the quantum tunneling responsible for the nucleation of the bubble does not occur simultaneously along both field directions and equal-time hypersurfaces in the open universe are not synchronized with equal-density or fixed-field hypersurfaces. The most probable tunneling trajectory corresponds to a zero value of the inflaton field; large values, necessary for the second period of inflation inside the bubble, only arise as localized fluctuations. The interior of each nucleated bubble will contain an infinite number of such inflating regions of comoving size of order $\\gamma^{-1}$, where $\\gamma$ depends on the parameters of the model. Each one of these islands will be a quasi-open universe. Since the volume of the hyperboloid is infinite, inflating islands with all possible values...

  14. Open Educational Resources

    Science.gov (United States)

    McShane, Michael Q.

    2017-01-01

    While digital products have made significant inroads into the educational resources market, textbooks and other print materials still command about 60 percent of sales. But whether print or digital, all of these commercial offerings now face threats from a burgeoning effort to promote "open" resources for education--that is, materials…

  15. Openers for Biology Classes.

    Science.gov (United States)

    Gridley, C. Robert R.

    This teaching guide contains 200 activities that are suitable for openers and demonstrations in biology classes. Details are provided regarding the use of these activities. Some of the broad topics under which the activities are organized include algae, amphibians, bacteria, biologists, crustaceans, dinosaurs, ecology, evolution, flowering plants,…

  16. Open-Ended Evolution

    DEFF Research Database (Denmark)

    Taylor, Tim; A. Bedau, Mark; Channon, Alastair

    2016-01-01

    This report describes the First Workshop on Open-Ended Evolution: Recent Progress and Future Milestones (OEE1), held during the ECAL 2015 conference at the University of York, U.K., in July 2015. We briefly summarise the content of the talks and discussions and the workshop, and provide links...

  17. The Costs of "Openness"

    Science.gov (United States)

    Cleveland, Harlan

    1975-01-01

    The author argues that very wide consultation tends to discourage innovation and favor stand-pattism and that the very great benefits of openness and wide participation are flawed by apathy and non-participation, by muscle-binding legalisms, by processes which polarize two adversary sides, and by the encouragement of mediocrity. (JT)

  18. KAUST Open Access policy

    KAUST Repository

    Baessa, Mohamed A.

    2017-03-07

    The transition to open access (OA) is being driven by funders, libraries, researchers and publishers around the world, and is having an impact on us all. It is inevitable that different countries, organisations and disciplines are moving at different rates towards an OA model, and it is this that we will focus on in this session. Drawing on experiences from across Europe and the Middle East we will provide perspectives from both a global publisher and institutions based in the region. Taylor & Francis take a flexible, evidence-based approach to open access, providing a choice of publication routes for our authors, and a choice of agreements for our library customers. Carolyn will outline some of the open access developments, opportunities and challenges at Taylor & Francis. The library plays a critical role in facilitating open access for their researchers, from managing a repository to providing support and information on the OA publication process to their authors. Janis Tyhurst and Dr Imad Bachir will each give an overview of how this is being managed by their institution. There will be an opportunity for questions and discussion with the panel.

  19. Official Antimonopoly Website Opens

    Institute of Scientific and Technical Information of China (English)

    Guo Liqin

    2010-01-01

    @@ China's antimonopoly law website opened in December 19, 2009. Netizens can log in at http://www.antimo-nopolylaw.org to see the update information of in-depth anti-monopoly law theory and case studies, according to the organizer.

  20. APS and Open Access

    Science.gov (United States)

    2011-03-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review A, B, E, Focus, Letters, and X, Reviews of Modern Physics, and Physics will address your questions about publishing in this evolving environment.

  1. Open inventor and PREMO

    NARCIS (Netherlands)

    Wang, D.; Reynolds, G.J.; Herman, I.

    1996-01-01

    PREMO is an emerging international standard for the presentations of multimedia objects including computer graphics. Open Inventor$^{TM$ is a commercially available ``de facto'' standard for interactive computer graphics packaged as a library of objects. In this report we consider whether the conce

  2. Open Data Reader 2016

    NARCIS (Netherlands)

    M. Brinkerink (Maarten); M. Zeinstra (Maarten); L Kalshoven (Lisette); T Schep (Tijmen)

    2016-01-01

    textabstractIn deze publicatie bekijken we het gecompliceerde veld van open data, waaronder de randvoorwaarden voor het openen van data. We bekijken specifiek drie verschillende facetten van de opendatapraktijk: de juridische kaders, de technologische factoren en de beleidsvorming rondom het actief

  3. BGCI China office opens

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ The official opening ceremony of the China Office of Botanic Gardens Conservation International (BGCI) was held in the CAS South China Botanical Garden (SCBG) in Guangzhou, capital of south China's Guangdong Province, on 26 February. The event brought together more than 100 high-caliber scholars and officials, including Secretary General of BGCI Mme.

  4. The Downside Of Openness

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The opening of China’s financial markets may not be the key to resolving the U.S. trade deficit As an investment banker, Henry Paulson was known for his 70-odd visits to China. Thishigh frequency has been sustained since he took over the U.S. Treasur

  5. Playfulness and Openness

    DEFF Research Database (Denmark)

    Marchetti, Emanuela; Petersson, Eva

    2011-01-01

    What does it mean to design a playful learning tool? What is needed for a learning tool to be perceived by potential users as playful? These questions emerged reflecting on a Participatory Design process aimed at enhancing museum-learning practice from the perspective of primary school children. ...

  6. Open to Suggestion.

    Science.gov (United States)

    Journal of Reading, 1991

    1991-01-01

    Presents five class activities involving (1) using paraphrasing cards to reduce unintentional plagiarism; (2) using cartoons to improve content reading; (3) scaffolding; (4) the Neurological Impress method and middle school readers; and (5) newspapers for adults with reading difficulties. Discusses what keeps adults out of adult education programs…

  7. IPMACC: Open Source OpenACC to CUDA/OpenCL Translator

    OpenAIRE

    Lashgar, Ahmad; Majidi, Alireza; Baniasadi, Amirali

    2014-01-01

    In this paper we introduce IPMACC, a framework for translating OpenACC applications to CUDA or OpenCL. IPMACC is composed of set of translators translating OpenACC for C applications to CUDA or OpenCL. The framework uses the system compiler (e.g. nvcc) for generating final accelerator's binary. The framework can be used for extending the OpenACC API, executing OpenACC applications, or obtaining CUDA or OpenCL code which is equivalent to OpenACC code. We verify correctness of our framework und...

  8. Marketing Small Schools in New York City: A Critique of Neoliberal School Reform

    Science.gov (United States)

    Shiller, Jessica

    2011-01-01

    The objective of this article is to critically examine a school reform effort that has taken hold in New York City over the past seven years. A largely privately funded venture, the New Century Schools Initiative (NCSI), opened hundreds of new small high schools in poor urban communities in New York City starting in 2002. The theory behind opening…

  9. When School Are Not Safe Places: Reconnecting Gay and Lesbian Young People to Schools.

    Science.gov (United States)

    Mallon, Gerald P.

    1997-01-01

    Describes how two schools have made themselves more open to gay, lesbian, bisexual, and transgender students. Recommends that schools develop policies that protect students, train teachers and counselors in suicide- and violence prevention, provide support groups for straight and gay students, make information available in school libraries, and…

  10. Do Student Migrations Affect School Performance? Evidence from Wisconsin's Inter-District Public School Program

    Science.gov (United States)

    Welsch, David M.; Zimmer, David M.

    2012-01-01

    This paper examines the competitive effects of a unique school choice program implemented in the late 1990s, Wisconsin's open enrollment program, which allows families to send their children to schools outside their home district. In contrast to other school choice programs, districts not only face negative consequences from losing students and…

  11. A Framework for the Ethics of Open Education

    Directory of Open Access Journals (Sweden)

    Robert Farrow

    2016-05-01

    Full Text Available What difference does openness make to the ethics of teaching and research? This paper approaches this question both from the perspective of research into the use of open educational resources (OER in teaching and learning. An outline of the nature and importance of ethics in education research is provided before the basic principles of research ethics are examined through a discussion of traditional guidance provided by three UK research governance bodies: the Economics and Social Research Council; the British Education Research Association; and the British Psychological Society. The importance and foundation of institutional approval for research activities is analysed with several examples of the differences made by openness. It is argued that openness by its nature provokes particular issues for education researchers. A framework for understanding openness in education is then proposed based on basic meta-ethical positions (deontological; consequentialist; virtue. Used as a tool, the framework attempts to retain relevance in a variety of scenarios without requiring a dogmatic vision of openness (e.g. an insistence on open licensing. This framework is then evaluated in the context of the OER Research Hub project, which developed guidance for others in the form of an 'ethics manual' and online learning provided through the OER Research Hub’s 'Open Research' course hosted on P2PU’s School of Open. Use of the framework is intended to contribute to a better understanding of professional ethics for open practitioners.

  12. Analysis of Open Access Landscape

    Institute of Scientific and Technical Information of China (English)

    Helen Doyle; Andy Gass; Debra Lappin; Rebecca Kennison

    2005-01-01

    This paper is created by bounding 5 editorials of Public Library of Science (PLoS ) which have written on various aspects of open access. It covers wide range topics of important open access issues, such as from paying for open access to copyright to open access as a public issue, which may be more or less of interest of our audience.

  13. Open data and beyond: Exploring existing open data projects to prepare a successful open data strategy; Deelrapport inleiding open data

    NARCIS (Netherlands)

    Van Loenen, B.

    2012-01-01

    Netwerkbedrijf Alliander was begin 2011 zich aan het oriënteren naar de mogelijkheid om haar gegevens als open data ter beschikking te stellen aan een ieder. Echter wat open data nu precies is, welke mogelijke knelpunten moeten worden opgelost om open data te implementeren, de impact die open data z

  14. OpenGL development cookbook

    CERN Document Server

    Movania, Muhammad Mobeen

    2013-01-01

    The book is written in a Cookbook format with practical recipes aimed at helping you exploit OpenGL to its full potential.This book is targeted towards intermediate OpenGL programmers. However, those who are new to OpenGL and know an alternate API like DirectX might also find these recipes useful to create OpenGL animations.

  15. Opening Reproducible Research

    Science.gov (United States)

    Nüst, Daniel; Konkol, Markus; Pebesma, Edzer; Kray, Christian; Klötgen, Stephanie; Schutzeichel, Marc; Lorenz, Jörg; Przibytzin, Holger; Kussmann, Dirk

    2016-04-01

    Open access is not only a form of publishing such that research papers become available to the large public free of charge, it also refers to a trend in science that the act of doing research becomes more open and transparent. When science transforms to open access we not only mean access to papers, research data being collected, or data being generated, but also access to the data used and the procedures carried out in the research paper. Increasingly, scientific results are generated by numerical manipulation of data that were already collected, and may involve simulation experiments that are completely carried out computationally. Reproducibility of research findings, the ability to repeat experimental procedures and confirm previously found results, is at the heart of the scientific method (Pebesma, Nüst and Bivand, 2012). As opposed to the collection of experimental data in labs or nature, computational experiments lend themselves very well for reproduction. Some of the reasons why scientists do not publish data and computational procedures that allow reproduction will be hard to change, e.g. privacy concerns in the data, fear for embarrassment or of losing a competitive advantage. Others reasons however involve technical aspects, and include the lack of standard procedures to publish such information and the lack of benefits after publishing them. We aim to resolve these two technical aspects. We propose a system that supports the evolution of scientific publications from static papers into dynamic, executable research documents. The DFG-funded experimental project Opening Reproducible Research (ORR) aims for the main aspects of open access, by improving the exchange of, by facilitating productive access to, and by simplifying reuse of research results that are published over the Internet. Central to the project is a new form for creating and providing research results, the executable research compendium (ERC), which not only enables third parties to

  16. Open architecture CNC system

    Energy Technology Data Exchange (ETDEWEB)

    Tal, J. [Galil Motion Control Inc., Sunnyvale, CA (United States); Lopez, A.; Edwards, J.M. [Los Alamos National Lab., NM (United States)

    1995-04-01

    In this paper, an alternative solution to the traditional CNC machine tool controller has been introduced. Software and hardware modules have been described and their incorporation in a CNC control system has been outlined. This type of CNC machine tool controller demonstrates that technology is accessible and can be readily implemented into an open architecture machine tool controller. Benefit to the user is greater controller flexibility, while being economically achievable. PC based, motion as well as non-motion features will provide flexibility through a Windows environment. Up-grading this type of controller system through software revisions will keep the machine tool in a competitive state with minimal effort. Software and hardware modules are mass produced permitting competitive procurement and incorporation. Open architecture CNC systems provide diagnostics thus enhancing maintainability, and machine tool up-time. A major concern of traditional CNC systems has been operator training time. Training time can be greatly minimized by making use of Windows environment features.

  17. Open Days in 2008

    CERN Multimedia

    Corinne Pralavorio

    CERN will be organising two Open Days in 2008, one for CERN employees and their families on Saturday, 5 April, and another for the general public on Sunday, 6 April. This is the one last chance to see the LHC and its experiments. In addition to the surface facilities, visitors will be able to go underground to see the accelerator and will have acces to the experiment caverns. Exceptionally, most of the points along the ring will be open. We need a large number of volunteers to ensure the success of these two very special days. Full details of the events will be published in the first January edition of the Bulletin. Volunteers will be able to register by completing an electronic form and an information session will be organised.

  18. Occupants' window opening behaviour

    DEFF Research Database (Denmark)

    Fabi, Valentina; Andersen, Rune Korsholm; Corgnati, Stefano

    2012-01-01

    Energy consumption in buildings is influenced by several factors related to the building properties and the building controls, some of them highly connected to the behaviour of their occupants.In this paper, a definition of items referring to occupant behaviour related to the building control...... systems is proposed, based on studies presented in literature and a general process leading to the effects on energy consumptions is identified.Existing studies on the topic of window opening behaviour are highlighted and a theoretical framework to deal with occupants' interactions with building controls......, aimed at improving or maintaining the preferred indoor environmental conditions, is elaborated. This approach is used to look into the drivers for the actions taken by the occupants (windows opening and closing) and to investigate the existing models in literature of these actions for both residential...

  19. Open Source Physics

    CERN Document Server

    Wee, Loo Kang

    2013-01-01

    Open Source Physics (Brown, 2012; Christian, 2010; Esquembre, 2012; Hwang, 2010) empowers teachers and students to create and use these free tools with the associated intellectual property rights given to customise (Wee & Mak, 2009) the computer models/tools to suit their teaching and learning needs. Open Source Physics (OSP) focuses on design of computer models, such as Easy Java Simulations (EJS) and the use of video modeling and analysis (Tracker). They allow students to investigate, explore and analyse data which is either real or simulated. The OSP approach helps users overcome barriers in creating, using and scaling up meaningful ICT use in education. In Singapore, teachers and students have created or customised existing computer models to design and re-purpose EJS models to suit their context and learning needs. Tracker tools allow students to analyse different aspects of a physics phenomena to deepen their understanding of abstract physics concepts. Using Tracker, students record the motion of ob...

  20. Open problems in mathematics

    CERN Document Server

    Nash, Jr, John Forbes

    2016-01-01

    The goal in putting together this unique compilation was to present the current status of the solutions to some of the most essential open problems in pure and applied mathematics. Emphasis is also given to problems in interdisciplinary research for which mathematics plays a key role. This volume comprises highly selected contributions by some of the most eminent mathematicians in the international mathematical community on longstanding problems in very active domains of mathematical research. A joint preface by the two volume editors is followed by a personal farewell to John F. Nash, Jr. written by Michael Th. Rassias. An introduction by Mikhail Gromov highlights some of Nash’s legendary mathematical achievements. The treatment in this book includes open problems in the following fields: algebraic geometry, number theory, analysis, discrete mathematics, PDEs, differential geometry, topology, K-theory, game theory, fluid mechanics, dynamical systems and ergodic theory, cryptography, theoretical computer sc...

  1. Naval open systems architecture

    Science.gov (United States)

    Guertin, Nick; Womble, Brian; Haskell, Virginia

    2013-05-01

    For the past 8 years, the Navy has been working on transforming the acquisition practices of the Navy and Marine Corps toward Open Systems Architectures to open up our business, gain competitive advantage, improve warfighter performance, speed innovation to the fleet and deliver superior capability to the warfighter within a shrinking budget1. Why should Industry care? They should care because we in Government want the best Industry has to offer. Industry is in the business of pushing technology to greater and greater capabilities through innovation. Examples of innovations are on full display at this conference, such as exploring the impact of difficult environmental conditions on technical performance. Industry is creating the tools which will continue to give the Navy and Marine Corps important tactical advantages over our adversaries.

  2. OpenGL VGIS

    Science.gov (United States)

    Faust, Nickolas L.; Bhaumik, Dharmajyoti; Hodges, Larry F.; Ribarsky, William; Koller, David; Lindstrom, Peter

    1996-06-01

    Georgia Tech has developed the Virtual GIS (VGIS) system, a real time visualization system for terrain, image, and geographic information systems (GIS) data sets. The initial systems developed at Georgia Tech were non- realtime, but had fast generation of perspective scenes from multisources data sets and the ability to query for GIS attributes associated with terrain of 3D structures inserted within the terrain. The basic concept of a virtual GIS was implemented in realtime using the Silicon Graphics International graphics language. This system has been extended in capability to allow realtime traversal within a very large geographic database and to show the finest detail information available when it is near to the view point. Extensive work has been done in the management of large arrays of information and the efficient paging of that information into the rendering system. An effective level of detail management system is implemented to dynamically allocate the appropriate amount of detail relative to the viewer location. A major use of this system has been in the area of battlefield visualization. The advent of OpenGL as a defacto standard has now made it possible to provide the VGIS capacity on a number of other platforms, thereby extending its usefulness to other applications and users. OpenGL has been developed as a general purpose Graphics rendering toolkit that will be supported on various computers and special purpose rendering systems. There are hardware and software implementations of OpenGL. This should allow VGIS to operate on many systems, taking advantage of specialized graphics hardware when it is present. This paper addresses the implementation of the VGIS system in OpenGL and the use of the system in driving the Evans and Sutherland Freedom series graphics rendering hardware.

  3. Open access / accesso aperto

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-06-01

    Full Text Available Sto collaborando, per la voce Open access, a un e-book a più mani dal titolo Le parole dell’innovazione. Ricorro all’archivio Marini per mettere a disposizione di tutti una versione estesa del mio lemma. Non dice nulla di nuovo rispetto al già noto; può però essere utile a chi sia completamente disinformato sul tema.

  4. Open Flavor Strong Decays

    Science.gov (United States)

    García-Tecocoatzi, H.; Bijker, R.; Ferretti, J.; Galatà, G.; Santopinto, E.

    2016-10-01

    In this contribution, we discuss the results of a QM calculation of the open-flavor strong decays of **** light nucleon resonances. These are the results of a recent calculation, where we used a modified ^3P_0 model for the amplitudes and the U(7) algebraic model and the hypercentral quark model to predict the baryon spectrum. The decay amplitudes are compared with the existing experimental data.

  5. Open quantum system identification

    CERN Document Server

    Schirmer, Sophie G; Zhou, Weiwei; Gong, Erling; Zhang, Ming

    2012-01-01

    Engineering quantum systems offers great opportunities both technologically and scientifically for communication, computation, and simulation. The construction and operation of large scale quantum information devices presents a grand challenge and a major issue is the effective control of coherent dynamics. This is often in the presence of decoherence which further complicates the task of determining the behaviour of the system. Here, we show how to determine open system Markovian dynamics of a quantum system with restricted initialisation and partial output state information.

  6. Diophantine Correct Open Induction

    CERN Document Server

    Raffer, Sidney

    2010-01-01

    We give an induction-free axiom system for diophantine correct open induction. We relate the problem of whether a finitely generated ring of Puiseux polynomials is diophantine correct to a problem about the value-distribution of a tuple of semialgebraic functions with integer arguments. We use this result, and a theorem of Bergelson and Leibman on generalized polynomials, to identify a class of diophantine correct subrings of the field of descending Puiseux series with real coefficients.

  7. Open3DQSAR

    DEFF Research Database (Denmark)

    Tosco, Paolo; Balle, Thomas

    2011-01-01

    into gnuplot. Open3DQSAR is written in C; while pre-built binaries are available for mainstream operating systems (Windows 32/64-bit, Linux 32/64-bit, Solaris x86 32/64-bit, FreeBSD 32/64-bit, Intel Mac OS X 32/64-bit), source code is portable and can be compiled under any *NIX platform supporting POSIX...

  8. Open SHMEM Reference Implementation

    Energy Technology Data Exchange (ETDEWEB)

    2016-05-12

    OpenSHMEM is an effort to create a specification for a standardized API for parallel programming in the Partitioned Global Address Space. Along with the specification the project is also creating a reference implementation of the API. This implementation attempts to be portable, to allow it to be deployed in multiple environments, and to be a starting point for implementations targeted to particular hardware platforms. It will also serve as a springboard for future development of the API.

  9. Open static Chaplygin universe

    CERN Document Server

    Khalatnikov, I M

    2003-01-01

    We apply the qualitative theory of dynamical systems to the study of the Chaplygin gas cosmological model. In difference to earlier works devoted to this model we give up sign restrictions on the choice of the sign of the energy density and on the parameters characterising initial conditions for a cosmological evolution. It appears that exists a static stable open universe filled with the Chaplygin gas. Besides exist universes where the acoustic waves have a velocity exceeding that of light in the vacuum.

  10. Open-Source GIS

    Energy Technology Data Exchange (ETDEWEB)

    Vatsavai, Raju [ORNL; Burk, Thomas E [University of Minnesota; Lime, Steve [Minnesota Department of Natural Resources

    2012-01-01

    The components making up an Open Source GIS are explained in this chapter. A map server (Sect. 30.1) can broadly be defined as a software platform for dynamically generating spatially referenced digital map products. The University of Minnesota MapServer (UMN Map Server) is one such system. Its basic features are visualization, overlay, and query. Section 30.2 names and explains many of the geospatial open source libraries, such as GDAL and OGR. The other libraries are FDO, JTS, GEOS, JCS, MetaCRS, and GPSBabel. The application examples include derived GIS-software and data format conversions. Quantum GIS, its origin and its applications explained in detail in Sect. 30.3. The features include a rich GUI, attribute tables, vector symbols, labeling, editing functions, projections, georeferencing, GPS support, analysis, and Web Map Server functionality. Future developments will address mobile applications, 3-D, and multithreading. The origins of PostgreSQL are outlined and PostGIS discussed in detail in Sect. 30.4. It extends PostgreSQL by implementing the Simple Feature standard. Section 30.5 details the most important open source licenses such as the GPL, the LGPL, the MIT License, and the BSD License, as well as the role of the Creative Commons.

  11. The open boundary equation

    Directory of Open Access Journals (Sweden)

    D. Diederen

    2015-06-01

    Full Text Available We present a new equation describing the hydrodynamics in infinitely long tidal channels (i.e., no reflection under the influence of oceanic forcing. The proposed equation is a simple relationship between partial derivatives of water level and velocity. It is formally derived for a progressive wave in a frictionless, prismatic, tidal channel with a horizontal bed. Assessment of a large number of numerical simulations, where an open boundary condition is posed at a certain distance landward, suggests that it can also be considered accurate in the more natural case of converging estuaries with nonlinear friction and a bed slope. The equation follows from the open boundary condition and is therefore a part of the problem formulation for an infinite tidal channel. This finding provides a practical tool for evaluating tidal wave dynamics, by reconstructing the temporal variation of the velocity based on local observations of the water level, providing a fully local open boundary condition and allowing for local friction calibration.

  12. Open source posturography.

    Science.gov (United States)

    Rey-Martinez, Jorge; Pérez-Fernández, Nicolás

    2016-12-01

    The proposed validation goal of 0.9 in intra-class correlation coefficient was reached with the results of this study. With the obtained results we consider that the developed software (RombergLab) is a validated balance assessment software. The reliability of this software is dependent of the used force platform technical specifications. Develop and validate a posturography software and share its source code in open source terms. Prospective non-randomized validation study: 20 consecutive adults underwent two balance assessment tests, six condition posturography was performed using a clinical approved software and force platform and the same conditions were measured using the new developed open source software using a low cost force platform. Intra-class correlation index of the sway area obtained from the center of pressure variations in both devices for the six conditions was the main variable used for validation. Excellent concordance between RombergLab and clinical approved force platform was obtained (intra-class correlation coefficient =0.94). A Bland and Altman graphic concordance plot was also obtained. The source code used to develop RombergLab was published in open source terms.

  13. Open-Access Publishing

    Directory of Open Access Journals (Sweden)

    Nedjeljko Frančula

    2013-06-01

    Full Text Available Nature, one of the most prominent scientific journals dedicated one of its issues to recent changes in scientific publishing (Vol. 495, Issue 7442, 27 March 2013. Its editors stressed that words technology and revolution are closely related when it comes to scientific publishing. In addition, the transformation of research publishing is not as much a revolution than an attrition war in which all sides are buried. The most important change they refer to is the open-access model in which an author or an institution pays in advance for publishing a paper in a journal, and the paper is then available to users on the Internet free of charge.According to preliminary results of a survey conducted among 23 000 scientists by the publisher of Nature, 45% of them believes all papers should be published in open access, but at the same time 22% of them would not allow the use of papers for commercial purposes. Attitudes toward open access vary according to scientific disciplines, leading the editors to conclude the revolution still does not suit everyone.

  14. ADOPT Open Access

    CERN Multimedia

    2007-01-01

    Are you writing a theoretical paper? An experimental one? Or one about instrumentation? You can publish it in Open Access. Now. Read how... You might have heard about Open Access, the next big thing in scientific publishing. The idea is to make the results of your (publicly funded) research free to read for everyone out there ... not only those lucky ones who work in places where libraries can afford to purchase the expensive subscriptions to scientific journals. CERN, DESY and other particle physics institutes have accepted an offer by one of the leading journals in High Energy Physics, JHEP: our libraries will pay a special subscription fee, and, in exchange, all articles with at least one author from our institutes will be published in Open Access. Anyone, anywhere and anytime will be able to read them, without any financial barrier! If you are writing an instrumentation paper, you can submit it to JINST and benefit from the same offer. This is a major step forward in the planned conversion of existi...

  15. Bispectrum from open inflation

    Energy Technology Data Exchange (ETDEWEB)

    Sugimura, Kazuyuki [Yukawa Institute for Theoretical Physics, Kyoto University, Kyoto (Japan); Komatsu, Eiichiro, E-mail: sugimura@yukawa.kyoto-u.ac.jp, E-mail: komatsu@mpa-garching.mpg.de [Max-Planck-Institut für Astrophysik, Karl-Schwarzschild Str. 1, 85741 Garching (Germany)

    2013-11-01

    We calculate the bispectrum of primordial curvature perturbations, ζ, generated during ''open inflation.'' Inflation occurs inside a bubble nucleated via quantum tunneling from the background false vacuum state. Our universe lives inside the bubble, which can be described as a Friedmann-Lemaȋtre-Robertson-Walker (FLRW) universe with negative spatial curvature, undergoing slow-roll inflation. We pay special attention to the issue of an initial state for quantum fluctuations. A ''vacuum state'' defined by a positive-frequency mode in de Sitter space charted by open coordinates is different from the Euclidean vacuum (which is equivalent to the so-called ''Bunch-Davies vacuum'' defined by a positive-frequency mode in de Sitter space charted by flat coordinates). Quantum tunneling (bubble nucleation) then modifies the initial state away from the original Euclidean vacuum. While most of the previous study on modifications of the initial quantum state introduces, by hand, an initial time at which the quantum state is modified as well as the form of the modification, an effective initial time naturally emerges and the form is fixed by quantum tunneling in open inflation models. Therefore, open inflation enables a self-consistent computation of the effect of a modified initial state on the bispectrum. We find a term which goes as (ζ{sub k{sub 1}}ζ{sub k{sub 2}}ζ{sub k{sub 3}})∝1/k{sub 1}{sup 2}k{sub 3}{sup 4} in the so-called squeezed configurations, k{sub 3} << k{sub 1} ≈ k{sub 2}, in agreement with the previous study on modifications of the initial state. The bispectrum in the exact folded limit, e.g., k{sub 1} = k{sub 2}+k{sub 3}, is also enhanced and remains finite. However, these terms are exponentially suppressed when the wavelength of ζ is smaller than the curvature radius of the universe. The leading-order bispectrum is equal to the usual one from single-field slow-roll inflation; the terms

  16. A New Way of Measuring Openness: The Open Governance Index

    Directory of Open Access Journals (Sweden)

    Liz Laffan

    2012-01-01

    Full Text Available Open source software is now "business as usual" in the mobile industry. While much attention is given to the importance of open source licenses, we argue in this article that the governance model can be as necessary to a project’s success and that projects vary widely in the governance models – whether open or closed – that they employ. Open source governance models describe the control points that are used to influence open source projects with regard to access to the source code, how the source code is developed, how derivatives are created, and the community structure of the project. Governance determines who has control over the project beyond what is deemed legally necessary via the open source licenses for that project. The purpose of our research is to define and measure the governance of open source projects, in other words, the extent to which decision-making in an open source project is "open" or "closed". We analyzed eight open source projects using 13 specific governance criteria across four areas of governance: access, development, derivatives and community. Our findings suggest that the most open platforms will be most successful in the long term, however we acknowledge exceptions to this rule. We also identify best practices that are common across these open source projects with regard to source code access, development of source code, management of derivatives, and community structure. These best practices increase the likelihood of developer use of and involvement in open source projects.

  17. Integration eines Open-Source-Lernmanagementsystems an der Medizinischen Fakultät der LMU München: ein Erfahrungsbericht unter ökonomischen Gesichtspunkten / Integration of an Open-Source learning management system at a German medical school: a field report with an economical focus

    Directory of Open Access Journals (Sweden)

    Hege, Inga

    2010-01-01

    Full Text Available Since 2004 a commercial learning management system (LMS was introduced at the Medical Faculty of LMU. During the following four years the platform was hardly used by staff members and students. Therefore, in 2009 it was replaced by the Open Sorce LMS Moodle. Reasons for this step were a better adaptability of the software and the possibility for teachers to upload their material themselves. Our aim was to enhance acceptance among both students and teachers. During the implementation special emphasis was laid on the integration of Moodle into the existing IT infrastructure of the faculty. After the introduction of Moodle the number of active users increased from 500 to 5,060 (students and teachers. The number of courses raised from 14 to 90 (summer term and 125 (winter term. Mainly static documents such as scripts and lecture slides have been uploaded, but also a few interactive activities have been provided. The calculated costs for using Moodle added up to about 20 €/user/year. In comparison the commercial system cost about 100 €/user/year because of the low number of users. The high acceptance especially among teachers showed that decision to introduce Moodle was the right step at our faculty. Evaluation results show that despite many improvements users still rate Moodle as not very user friendly. At the end of the summer term we faced technical problems due to an unexpected peak of hits. An ongoing adaption of the platform is necessary to adress these issues. The aim for the coming terms are to support teachers to provide more high quality interactive learning activities.

  18. A Quantitative Synthesis of the Effects of Open Education.

    Science.gov (United States)

    Hetzel, Donna C.; And Others

    By employing meta-analysis procedures to build on the reviews of Horwitz and Peterson, specific effects of open education are quantified and related to school and student characteristics. From the 45 studies located in ERIC, the Education Index, and Horwitz's monograph, student, setting, and research design characteristics were coded. Twenty-three…

  19. Open-Ended Experimentation with the Fungus Pilobolus.

    Science.gov (United States)

    Coble, Charles R.; Bland, Charles E.

    This paper describes open-ended experimentation with the fungus Pilobolus for laboratory work by high school students. The fungus structure and reproduction is described and sources of the fungus are suggested. Four areas for investigation are suggested: the effect of a diffuse light source, the effect of a point light source, the effect of light…

  20. Open-Space Lab Provides Data on a New Concept

    Science.gov (United States)

    Kreamer, Ralph

    1972-01-01

    Describes the Jenkins Elementary School which not only serves as a neighborhood elementary education facility, but also provides students at Millersville State College, Pennsylvania, an opportunity to learn, work with, and observe the many different concepts embodied in open education. (Author/MB)

  1. Adding Value: Open Online Learning and the MBA

    Science.gov (United States)

    Fitzgerald, Rachel; Anderson, Maggie; Thompson, Ross

    2015-01-01

    Evidence suggests that MOOCs are being used as a strategic tool to explore alternative models of course delivery (Allen & Seaman, 2013) and this paper shares insight into an example of such innovation for Business School Education. Gateway MBA draws on examples of open learning worldwide to create a MOOC to extend the MBA distance learning…

  2. High School Closures in New York City: Impacts on Students' Academic Outcomes, Attendance, and Mobility. Brief

    Science.gov (United States)

    Kemple, James J.

    2015-01-01

    In the first decade of the 21st century, the New York City (NYC) Department of Education implemented a set of large-scale and much debated high school reforms, which included closing large, low-performing schools, opening new small schools, and extending high school choice to students throughout the district. The school closure process was the…

  3. High School Closures in New York City: Impacts on Students' Academic Outcomes, Attendance, and Mobility. Report

    Science.gov (United States)

    Kemple, James J.

    2015-01-01

    In the first decade of the 21st century, the New York City (NYC) Department of Education implemented a set of large-scale and much debated high school reforms, which included closing large, low-performing schools, opening new small schools, and extending high school choice to students throughout the district. The school closure process was the…

  4. Los fundamentos de la seguridad escolar (The Fundamentals of School Security). ERIC Digest.

    Science.gov (United States)

    Gaustad, Joan

    This digest in Spanish presents ways that school administrators can realistically assess their schools' security needs. It opens by reporting that some types of school violence are declining, such as self-reported weapon carrying and fighting on school property, which reflects an overall decline in youth violence. However, schools still must…

  5. School Health

    Science.gov (United States)

    ... else except home. Schools can have a major effect on children's health. Schools can teach children about health, and promote healthy behaviors. Physical education classes give children a chance to get exercise. Schools work to Prevent risky behaviors such as ...

  6. Open Source Seismic Hazard Analysis Software Framework (OpenSHA)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — OpenSHA is an effort to develop object-oriented, web- & GUI-enabled, open-source, and freely available code for conducting Seismic Hazard Analyses (SHA). Our...

  7. Open-market innovation.

    Science.gov (United States)

    Rigby, Darrell; Zook, Chris

    2002-10-01

    Companies in many industries are feeling immense pressure to improve their ability to innovate. Even in these tough economic times, executives have pushed innovation initiatives to the top of their priority lists, but they know that the best ideas aren't always coming out of their own R&D labs. That's why a growing number of companies are exploring the idea of open-market innovation--an approach that uses tools such as licensing, joint ventures, and strategic alliances to bring the benefits of free trade to the flow of new ideas. For instance, when faced with the unanticipated anthrax scare last fall, Pitney Bowes had nothing in its R&D pipeline to help its customers combat the deadly spores. So it sought help from outside innovators to come up with scanning and imaging technologies that could alert its customers to tainted letters and packages. And Dow Chemical and Cargill jointly produced a new form of plastic derived from plant starches--a breakthrough product that neither company could have created on its own. In this article, Bain consultants Darrell Rigby and Chris Zook describe the advantages and disadvantages of open-market innovation and the ways some companies are using it to gain competitive advantage. By importing ideas from the outside, the authors say, companies can collect more and better ideas from different kinds of experts. Creative types within a company will stick around longer if they know their ideas will eventually find a home--as internal R&D projects or as concepts licensed to outside buyers. Exporting ideas also gives companies a way to measure an innovation's real value. However, the authors warn against entering into open-market innovation without properly structuring deals: Xerox and TRW virtually gave away their innovations and had to stand by while other companies capitalized on them.

  8. Open for business?

    DEFF Research Database (Denmark)

    Bogers, Marcel; Jensen, Jørgen Dejgård

    2017-01-01

    and some of its main components — considering an internal and external orientation — and how they can be applied to the gastronomic sector. On this basis, we propose, develop and test an empirical framework for the economic sustainability of gastronomic enterprises. Based on data from a publicly available...... the sector to create value through for example product differentiation, market segmentation, and so on. The analysis revealed 9 different clusters, which represent different business models in terms of customer value creation, segmentation and resource utilization — highlighting either more closed or open...

  9. Open innovation in networks

    DEFF Research Database (Denmark)

    Hu, Yimei

    Open innovation in networks has been a popular topic for long, this paper rethinks the concepts of innovation network and network organization, and clarifies the differences between them based on the network perspective. Network perspective means that: network is the context of firms; market...... and hierarchy can be analyzed from a network approach. Within a network perspective, there are different levels of network, and a firm may not always has the power to “manage” innovation networks due to different levels of power. Based on the strength of a firm’s power, its role may varies from manager...

  10. Open verification methodology cookbook

    CERN Document Server

    Glasser, Mark

    2009-01-01

    Functional verification is an art as much as a science. It requires not only creativity and cunning, but also a clear methodology to approach the problem. The Open Verification Methodology (OVM) is a leading-edge methodology for verifying designs at multiple levels of abstraction. It brings together ideas from electrical, systems, and software engineering to provide a complete methodology for verifying large scale System-on-Chip (SoC) designs. OVM defines an approach for developing testbench architectures so they are modular, configurable, and reusable. This book is designed to help both novic

  11. OpenLabNotes

    DEFF Research Database (Denmark)

    List, Markus; Franz, Michael; Tan, Qihua

    2015-01-01

    the longevity of the providers. Turning towards free alternatives, however, raises questions about data protection, which are not sufficiently addressed by available solutions. To serve as legal documents, ELNs must prevent scientific fraud through technical means such as digital signatures. It would also......LabFramework, a powerful and flexible laboratory information management system. In contrast to comparable solutions, it allows to protect the intellectual property of its users by offering data protection with digital signatures. OpenLabNotes effectively Closes the gap between research documentation and sample management...

  12. Why Open Access?

    OpenAIRE

    2015-01-01

    As mentioned in the previous editorial (López-López, 2015), Suber’s (2015) book is a significant contribution that we can use to clarify the limits and the scope of Open Access (OA), and it is also helpful in explaining confusions and inaccuracies that are widespread in our communities, which are not quite ready to face the accelerated changes that are being generated by the new dynamics of scientific output and communication (Gallegos, Berra, Benito, & López-López, 2014). Suber (2015) st...

  13. Open Source Software Acquisition

    DEFF Research Database (Denmark)

    Holck, Jesper; Kühn Pedersen, Mogens; Holm Larsen, Michael

    2005-01-01

    Lately we have seen a growing interest from both public and private organisations to adopt OpenSource Software (OSS), not only for a few, specific applications but also on a more general levelthroughout the organisation. As a consequence, the organisations' decisions on adoption of OSS arebecoming......, in smaller organisations and in small-scale adoption of OSS, the cheapprice of OSS is a major enabler, as it provides a good opportunity for experiments and short-termeconomic benefits. For small organisations these experiments can lead to development of a commonIT-architecture, and in larger organisations...

  14. Supersymmetric Open Wilson Lines

    CERN Document Server

    Baker, Edward B

    2011-01-01

    In this paper we study Open Wilson Lines (OWL's) in the context of two Supersymmetric Yang Mills theories. First we consider four dimensional N=2 Supersymmetric Yang Mills Theory with hypermultiplets transforming in the fundamental representation of the gauge group, and find supersymmetric OWL's only in the superconformal versions of these theories. We then consider four dimensional N=4 SYM coupled to a three dimensional defect hypermultiplet. Here there is a semi-circular supersymmetric OWL, which is related to the ray by a conformal transformation. We perform a perturbative calculation of the operators in both theories, and discuss using localization to compute them non-perturbatively.

  15. ICALEPS 2005 : opening session

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    ICALEPCS 2005, the tenth International Conference on Accelerator and Large Experimental Physics Control Systems, will be held in Geneva, Switzerland, 10-14 Oct. 2005 at the International Conference Center Geneva (CICG). ICALEPCS 2005 thus falls in the year that UNESCO has declared the "World Year of Physics". ICALEPCS covers all aspects of control and operation of Experimental Physics facilities such as particle accelerators, particle detectors, optical telescopes, radio telescopes, nuclear fusion facilities like Tokamaks, nuclear reactors, lasers, etc .... Opening session by . A. Daneels (CERN): Introducting ICALEPCS 2005 . C.Lamprecht (Republic & State of Geneva): Welcome speech . J. Lister (EPFL): Welcome speech . J. Engelen (CERN): The machine and experiment challenges of LHC

  16. Certified Schools

    Data.gov (United States)

    Department of Homeland Security — Certified schools must provide specific information regarding the school, the nature and requirements of the educational program, location and contact information,...

  17. Innovation with open data: Essential elements of open data ecosystems

    NARCIS (Netherlands)

    Zuiderwijk, A.M.G.; Janssen, M.F.W.H.A.; Davis, C.B.

    2014-01-01

    Open data ecosystems are expected to bring many advantages, such as stimulating citizen participation and innovation. However, scant attention has been given to what constitutes an open data ecosystem. The objective of this paper is to provide an overview of essential elements of open data ecosystem

  18. Adult Learning Open University Determinants (ALOUD) study: Psychological factors associated with study success

    NARCIS (Netherlands)

    Neroni, Joyce; De Groot, Renate; Kirschner, Paul A.

    2013-01-01

    Neroni, J., De Groot, R. H. M., & Kirschner, P. A. (2012, 7 November). Adult Learning Open University Determinants (ALOUD) study: Psychological factors associated with study success. Poster presentation at the International ICO Fall School, Girona, Spain.

  19. Adult Learning Open University Determinants study (ALOUD): Biological lifestyle factors associated with study success

    NARCIS (Netherlands)

    Gijselaers, Jérôme; De Groot, Renate; Kirschner, Paul A.

    2012-01-01

    Gijselaers, H. J. M., De Groot, R. H. M., & Kirschner, P. A. (2012, 7 November). Adult Learning Open University Determinants study (ALOUD): Biological lifestyle factors associated with study success. Poster presentation at the International ICO Fall School, Girona, Spain.

  20. [Opening medicine containers].

    Science.gov (United States)

    Glerup, E; Dengsø, H

    1990-07-09

    In connection with self-administration of medicine for patients with rheumatoid arthritis, patients with weak hands and elderly patients in general, the design of many medicine containers makes them awkward to handle for the patients. In this investigation 12 different medicine containers were tested. The 12 containers represent the antirheumatic medicine containers available on the market in Denmark in 1988. Sixty patients participated in the investigation. Thirty had rheumatoid arthritis and 30 had normal hand function. The age range was 40-85 years The patients had the choice between five possible answers concerning each container. In all patients, grip strength was measured. The patients with rheumatoid arthritis were classified in four functional classes, and pulpa-vola distance end thumb--5th MCP point distance were measured. The opening mechanisms of 29% of the antirheumatic medicine containers are unacceptable; these are plastic containers with a "push-off" top and suppository packs. 46%--(containers with screw cap or pressure dispensing) are considered acceptable. For 25% (tablet and capsule blister packs) the patients' estimate varied. It is important that medicine containers can be opened by the patients without difficulty, so that they do not present a hindrance to a correct intake of medicine or result in an unnecessary admission to hospital. The results of this investigation show that it is of continuous importance to encourage the production of medicine containers that comply with the requirements of the patients.

  1. Challenges of open access

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, J.

    1994-09-01

    As utilities provide open access to their transmission grids under new federal regulations, the volume of bulk power transactions is expected to rise sharply - putting a strain on already heavily loaded delivery systems. Can everybody ride a grid that was designed to be operated in a simpler business environment New EPRI software and analysis methods can help utilities cope with the practical problems that open access brings, such as accurately calculating the costs of providing transmission services to third parties and operating power systems closer to their inherent technical limits. A variety of power system analysis programs are already available for planning purposes, and on-line versions for use by operations personnel are beginning to enter utility demonstration. In addition, new resource scheduling and generation control software can help utilities reduce the total cost of electricity production by up to 3%. A decision framework has also been prepared that a utility can use to integrate technical information about its power system with overall corporate strategy.

  2. Printshop open days

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    With new machines, new services and new opening hours, the CERN Printshop has turned over many new leaves at the start of 2013. Come and find out more from 25 to 27 March at the Printshop open days!   The CERN Printshop’s new 8-metre long black and white printer. The CERN Printshop’s new 8-metre long black-and-white printer is a technical marvel. It can produce 160 pages per minute (it prints on both sides in one pass) and can also staple, punch holes, do thermal binding and make A4 or A5 brochures. The new colour printer is more discreet but no less efficient: it churns out 70 A4 or A3 pages per minute. Once they are printed, colour documents can be inserted into the black and white machine to be hole-punched, made into brochures or bound. They can even be mixed in with black-and-white pages and, as if by magic, come out in the right order! Having recently acquired a state-of-the-art large-format printer, the CERN Printshop can now print posters in A2, A1 or A0 format. ...

  3. Magnet Schools: No Longer Famous, but Still Intact

    Science.gov (United States)

    Rossell, Christine H.

    2005-01-01

    It was in 1968, when Martin Luther King had been assassinated, and American cities were erupting in flames because of King's violent death and the decades-long smoldering resentments from racism, that the nation's first "magnet" school opened in Tacoma, Washington. The following year, 1969, the country's second magnet school opened--this…

  4. Huijia School Summer Camp Program

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    As an open and international educational institution, Beijing Huijia Private School is located in Changping, a scenic district in Beijing's northern suburb. In order to strengthen international cultural exchanges, promote the study of Chinese language and the spread of Chinese culture, and make the world know more about China, Huijia School regularly organizes various summer camps for students of different ages every year. Until now, we have already successfully received more than 1,000 students from hom...

  5. Open innovation and serious gaming

    NARCIS (Netherlands)

    Westera, Wim

    2010-01-01

    Westera, W. (2010, 15 April). Open innovation and serious gaming. Workshop presentation and discussion with Hogeschool Zuyd, Communication and Multimedia Design, Heerlen, The Netherlands: Open University of the Netherlands.

  6. Virtuelt skrivebord med open office

    DEFF Research Database (Denmark)

    Nielsen, Kurt Gammelgaard

    2009-01-01

    SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende.......SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende....

  7. SOFTWARE OPEN SOURCE, SOFTWARE GRATIS?

    Directory of Open Access Journals (Sweden)

    Nur Aini Rakhmawati

    2006-01-01

    Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 Berlakunya Undang – undang Hak Atas Kekayaan Intelektual (HAKI, memunculkan suatu alternatif baru untuk menggunakan software open source. Penggunaan software open source menyebar seiring dengan isu global pada Information Communication Technology (ICT saat ini. Beberapa organisasi dan perusahaan mulai menjadikan software open source sebagai pertimbangan. Banyak konsep mengenai software open source ini. Mulai dari software yang gratis sampai software tidak berlisensi. Tidak sepenuhnya isu software open source benar, untuk itu perlu dikenalkan konsep software open source mulai dari sejarah, lisensi dan bagaimana cara memilih lisensi, serta pertimbangan dalam memilih software open source yang ada. Kata kunci :Lisensi, Open Source, HAKI

  8. UN OPEN GIS CAPACITY BUILDING

    National Research Council Canada - National Science Library

    A. Albertella; M. A. Brovelli; D. Gonzalez Ferreiro

    2017-01-01

    The UN Open GIS Initiative is to identify and develop, under UN guidance, an Open Source GIS bundle that meets the requirements of UN operations, taking full advantage of the expertise of mission partners...

  9. Virtuelt skrivebord med open office

    DEFF Research Database (Denmark)

    Nielsen, Kurt Gammelgaard

    2009-01-01

    SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende.......SDUs erfaringer med projektet Port 22: en virtuel platform med Open Office som kontorpakke til studerende....

  10. Eclipsing binaries in open clusters

    DEFF Research Database (Denmark)

    Southworth, John; Clausen, J.V.

    2006-01-01

    Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...

  11. The open information systems journal

    National Research Council Canada - National Science Library

    2007-01-01

    The Open Information Systems Journal is an Open Access online journal which publishes research articles, reviews, and letters in all areas on the development, use, application and influence of information systems...

  12. Open innovation and serious gaming

    NARCIS (Netherlands)

    Westera, Wim

    2010-01-01

    Westera, W. (2010, 15 April). Open innovation and serious gaming. Workshop presentation and discussion with Hogeschool Zuyd, Communication and Multimedia Design, Heerlen, The Netherlands: Open University of the Netherlands.

  13. Abdominal aortic aneurysm repair - open

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/007392.htm Abdominal aortic aneurysm repair - open To use the sharing features on this page, please enable JavaScript. Open abdominal aortic aneurysm repair is surgery to fix a widened part ...

  14. Project: Public School

    OpenAIRE

    Eräpuu, Päivi

    2013-01-01

    Lahden ammattikorkeakoulun Muotoilu- ja taideinstituutin Muoti- ja vaatetussuunnittelun opinnäytetyö Project: Public School pohtii open design -ideologian sovellutusmahdollisuuksia vaatesuunnittelussa. Opinnäytetyö tutkii avoimen suunnittelun käsitettä, sen ilmiöitä ja toimintatapoja lokaalista valmistuksesta, tee-se-itse-ideologiasta ja ekologisista arvoista. Opinnäytemalliston visuaalisena teemana on koulupuku ja sen kaltaisen valmisvaatteen dekonstruktio uuden vaatteen suunni...

  15. School Climate as an Important Component in School Effectiveness

    Directory of Open Access Journals (Sweden)

    Dorina Rapti

    2013-07-01

    Full Text Available Expectations, values, faith, relationships with staff, the school leader, teachers and students behavior create school climate. The leader can promote or hinder a positive climate through his leadership model. The purpose of this study is to explore what are the climate types that appear in the school as well as to contribute to the expectations of different stakeholders on the school climate. The starting point for improving the performance of students and teachers is to improve school climate. Thus, this study will help leaders who for one reason or another have not been effective in keeping their responsibilities, and, as a result, did not work efficiently in improving school climate. It is assumed that a positive school climate enhances effective teaching, and as a result a better performance of student learning. This study will serve to further studies related to the expansion of the leaders’ roles on school climate. In conclusion, the research will assist policy makers in Albania to assess the content of the modules needed for training future managers and teachers to ensure they are equipped with the skills required to create a positive, open and collaborative climate in school. The school leader should be released from some managerial tasks, for paying more time to teachers and students.

  16. Open Educational Resources and Practices

    Science.gov (United States)

    Blackall, Leigh

    2008-01-01

    This article looks at what constitutes an open educational resource and considers the issues and benefits to an educational institution that is moving to participate in open educational resource development and to adopt more open educational practices. It describes the initial steps in these directions being made by the Educational Development…

  17. Open Culture Data position paper

    NARCIS (Netherlands)

    L.B. Baltussen (Lotte); M. Brinkerink (Maarten); N. Timmermans (Nikki); M. Zeinstra (Maarten)

    2013-01-01

    textabstractOpen Culture Data started as a grassroots movement at the end of 2011, with the aim to open up data in the cultural sector and stimulate (creative) reuse. In this context, we organised a hackathon, which resulted in the creation of 13 Open Culture Data apps. After this successful first h

  18. Open Education and Critical Pedagogy

    Science.gov (United States)

    Farrow, Robert

    2017-01-01

    This paper argues for a revaluation of the potential of open education to support more critical forms of pedagogy. Section 1 examines contemporary discourses around open education, offering a commentary on the perception of openness as both a disruptive force in education, and a potential solution to contemporary challenges. Section 2 examines the…

  19. OpenStack cloud security

    CERN Document Server

    Locati, Fabio Alessandro

    2015-01-01

    If you are an OpenStack administrator or developer, or wish to build solutions to protect your OpenStack environment, then this book is for you. Experience of Linux administration and familiarity with different OpenStack components is assumed.

  20. Open-Ended Approach: An Effort in Cultivating Students' Mathematical Creative Thinking Ability and Self-Esteem in Mathematics

    Science.gov (United States)

    Fatah, Abdul; Suryadi, Didi; Sabandar, Jozua; Turmudi

    2016-01-01

    The present study aims at examining the use of open-ended approach in cultivating senior high school students' mathematical creative thinking ability (MCTA) and self-esteem (SE) in mathematics viewed from school category. The subjects of this research were the students grade XI at three schools; high, middle and low category in Kota Serang, Banten…

  1. EVE and School

    CERN Document Server

    EVE et École

    2017-01-01

    IMPORTANT DATES Enrolments 2017-2018 Enrolments for the school year 2017-2018 to the Nursery, the Kindergarten and the School will take place on 6, 7 and 8 March 2017 from 10 am to 1 pm at EVE and School. Registration forms will be available from Thursday 2nd March. More information on the website: http://nurseryschool.web.cern.ch/. Saturday 4 March 2017 Open day at EVE and School of CERN Staff Association Are you considering enrolling your child to the Children’s Day-Care Centre EVE and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 4 March 2017 from 10 to 12 am We look forward to welcoming you and will be delighted to present our structure, its projects and premises to you, and answer all of your questions. Sign up for one of the two sessions on Doodle via the link below before Wednesday 1st March 2017 : http://doodle.com/poll/gbrz683wuvixk8as

  2. Open Data, Open Source and Open Standards in chemistry: The Blue Obelisk five years on

    Directory of Open Access Journals (Sweden)

    O'Boyle Noel M

    2011-10-01

    Full Text Available Abstract Background The Blue Obelisk movement was established in 2005 as a response to the lack of Open Data, Open Standards and Open Source (ODOSOS in chemistry. It aims to make it easier to carry out chemistry research by promoting interoperability between chemistry software, encouraging cooperation between Open Source developers, and developing community resources and Open Standards. Results This contribution looks back on the work carried out by the Blue Obelisk in the past 5 years and surveys progress and remaining challenges in the areas of Open Data, Open Standards, and Open Source in chemistry. Conclusions We show that the Blue Obelisk has been very successful in bringing together researchers and developers with common interests in ODOSOS, leading to development of many useful resources freely available to the chemistry community.

  3. Open Data, Open Source and Open Standards in chemistry: The Blue Obelisk five years on

    Science.gov (United States)

    2011-01-01

    Background The Blue Obelisk movement was established in 2005 as a response to the lack of Open Data, Open Standards and Open Source (ODOSOS) in chemistry. It aims to make it easier to carry out chemistry research by promoting interoperability between chemistry software, encouraging cooperation between Open Source developers, and developing community resources and Open Standards. Results This contribution looks back on the work carried out by the Blue Obelisk in the past 5 years and surveys progress and remaining challenges in the areas of Open Data, Open Standards, and Open Source in chemistry. Conclusions We show that the Blue Obelisk has been very successful in bringing together researchers and developers with common interests in ODOSOS, leading to development of many useful resources freely available to the chemistry community. PMID:21999342

  4. Nursery School

    CERN Multimedia

    Nursery School

    2016-01-01

    Enrolments 2016-2017 Enrolments for the school year 2016-2017 to the Nursery, the Nursery school and the school will take place on 7, 8 and 9 March 2016 from 8 to 10 am at the Nursery School. Registration forms will be available from Thursday 3rd March. More information on the website: http://nurseryschool.web.cern.ch/.

  5. The open data imperative

    Directory of Open Access Journals (Sweden)

    Professor Geoffrey Boulton

    2014-07-01

    Full Text Available The information revolution of recent decades is a world historical event that is changing the lives of individuals, societies and economies and with major implications for science, research and learning. It offers profound opportunities to explore phenomena that were hitherto beyond our power to resolve, and at the same time is undermining the process whereby concurrent publication of scientific concept and evidence (data permitted scrutiny, replication and refutation and that has been the bedrock of scientific progress and of ‘self-correction’ since the inception of the first scientific journals in the 17th century. Open publication, release and sharing of data are vital habits that need to be redefined and redeveloped for the modern age by the research community if it is to exploit technological opportunities, maintain self-correction and maximize the contribution of research to human understanding and welfare.

  6. Comunicazione e Open Access

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2005-06-01

    Full Text Available Il potenziale editoriale della rivista, sebbene compia appena il suo terzo anno di attività, è considerevole: basti pensare che la scelta fondante una parte del progetto editoriale, la pubblicazione di testi integrali, accessibili liberamente e gratuitamente su formato html, ha permesso l’accrescersi costante della consultazione delle pagine web pubblicate su internet e del numero dei visitatori che hanno avuto accesso agli articoli diffusi per ogni numero trimestrale. Condividendo e promuovendo i principi dell’Open-Access, il libero accesso al patrimonio culturale e scientifico, partecipando ad una comunicazione scientifica che favorisca una democratizzazione della conoscenza, si è inoltre indotto un valore aggiunto allo strumento editoriale: la valorizzazione della produzione scientifica e degli stessi contributi degli autori, insieme all’ampia divulgazione dei contenuti, liberamente accessibili da qualsiasi luogo del mondo tramite una connessione ad internet.

  7. The Open Science Grid

    Energy Technology Data Exchange (ETDEWEB)

    Pordes, Ruth; /Fermilab; Kramer, Bill; Olson, Doug; / /LBL, Berkeley; Livny, Miron; Roy, Alain; /Wisconsin U., Madison; Avery, Paul; /Florida U.; Blackburn, Kent; /Caltech; Wenaus, Torre; /Brookhaven; Wurthwein, Frank; /UC, San Diego; Gardner, Rob; Wilde, Mike; /Chicago U. /Indiana U.

    2007-06-01

    The Open Science Grid (OSG) provides a distributed facility where the Consortium members provide guaranteed and opportunistic access to shared computing and storage resources. OSG provides support for and evolution of the infrastructure through activities that cover operations, security, software, troubleshooting, addition of new capabilities, and support for existing and engagement with new communities. The OSG SciDAC-2 project provides specific activities to manage and evolve the distributed infrastructure and support its use. The innovative aspects of the project are the maintenance and performance of a collaborative (shared & common) petascale national facility over tens of autonomous computing sites, for many hundreds of users, transferring terabytes of data a day, executing tens of thousands of jobs a day, and providing robust and usable resources for scientific groups of all types and sizes. More information can be found at the OSG web site: www.opensciencegrid.org.

  8. The Open Science Grid

    CERN Document Server

    Pordes, Ruth; Olson, Doug; Livny, Miron; Roy, Alain; Avery, Paul; Blackburn, Kent; Wenaus, Torre; Wuerthwein, Frank K.; Gardner, Rob; Wilde, Mike; Blatecky, Alan; McGee, John; Quick, Rob

    2007-01-01

    The Open Science Grid (OSG) provides a distributed facility where the Consortium members provide guaranteed and opportunistic access to shared computing and storage resources. OSG provides support for and evolution of the infrastructure through activities that cover operations, security, software, troubleshooting, addition of new capabilities, and support for existing and engagement with new communities. The OSG SciDAC-2 project provides specific activities to manage and evolve the distributed infrastructure and support it's use. The innovative aspects of the project are the maintenance and performance of a collaborative (shared & common) petascale national facility over tens of autonomous computing sites, for many hundreds of users, transferring terabytes of data a day, executing tens of thousands of jobs a day, and providing robust and usable resources for scientific groups of all types and sizes. More information can be found at the OSG web site: www.opensciencegrid.org.

  9. The open science grid

    Energy Technology Data Exchange (ETDEWEB)

    Pordes, Ruth [Fermi National Accelerator Laboratory (United States); Petravick, Don [Fermi National Accelerator Laboratory (United States); Kramer, Bill [Lawrence Berkeley National Laboratory (United States); Olson, Doug [Lawrence Berkeley National Laboratory (United States); Livny, Miron [University of Wisconsin, Madison (United States); Roy, Alain [University of Wisconsin, Madison (United States); Avery, Paul [University of Florida (United States); Blackburn, Kent [California Institute of Technology (United States); Wenaus, Torre [Brookhaven National Laboratory (United States); Wuerthwein, Frank [University of California, San Diego (United States); Foster, Ian [University of Chicago (United States); Gardner, Rob [University of Chicago (United States); Wilde, Mike [University of Chicago (United States); Blatecky, Alan [Renaissance Computing Institute (United States); McGee, John [Renaissance Computing Institute (United States); Quick, Rob [Indiana University (United States)

    2007-07-15

    The Open Science Grid (OSG) provides a distributed facility where the Consortium members provide guaranteed and opportunistic access to shared computing and storage resources. OSG provides support for and evolution of the infrastructure through activities that cover operations, security, software, troubleshooting, addition of new capabilities, and support for existing and engagement with new communities. The OSG SciDAC-2 project provides specific activities to manage and evolve the distributed infrastructure and support it's use. The innovative aspects of the project are the maintenance and performance of a collaborative (shared and common) petascale national facility over tens of autonomous computing sites, for many hundreds of users, transferring terabytes of data a day, executing tens of thousands of jobs a day, and providing robust and usable resources for scientific groups of all types and sizes. More information can be found at the OSG web site: www.opensciencegrid.org.

  10. OPEN about obesity

    DEFF Research Database (Denmark)

    Lissner, L; Troiano, R P; Midthune, D

    2007-01-01

    OBJECTIVE: Obesity-related under-reporting of usual dietary intake is one of the most persistent sources of bias in nutrition research. The aim of this paper is to characterize obese and non-obese individuals with respect to reporting errors observed with two common dietary instruments, using...... energy and protein recovery biomarkers as reference measures. POPULATION AND METHODS: This report employs data from the Observing Protein and Energy Nutrition (OPEN) study. Analyses are based on stratified samples of 211 (57 obese) men and 179 (50 obese) women who completed 24-h recalls (24HR), food...... frequency questionnaires (FFQ), doubly labelled water (DLW) and urinary nitrogen (UN) assessments. RESULTS: In obese and non-obese subgroups, FFQ yielded lower energy and protein intake estimates than 24HR, although biomarker-based information indicated under-reporting with both dietary instruments. Gender...

  11. CCI Open Data Portal

    Science.gov (United States)

    Clarke, H.; Pechorro, E.; Bennett, V.; Farquhar, C.; Blower, J.

    2016-08-01

    The European Space Agency's (ESA's) Climate Change Initiative (CCI) Programme, producing harmonised datasets from long term Earth Observation satellite data records for a number of Essential Climate Variables (ECV's), provides a solid basis for climate science and modelling, for specialist application development and ultimately for European and global policy making.The resulting Climate Data Records (CDRs) represent a major investment of science, funding and personal effort, therefore extended access to those products is a key element of programme success.ECV datasets are currently being distributed through individual ECV teams, and access procedures and interfaces vary. To compliment and unify the work of the individual teams and to maximise the visibility and uptake of ECV data in the climate data user community within and beyond the CCI, a new ESA CCI project has started, to create a central open data portal and metadata catalogue for the ESA CCI project.This paper highlights key features of the Portal to date.

  12. Muse's open body

    Directory of Open Access Journals (Sweden)

    George Luiz França

    2010-07-01

    Full Text Available This text discuss the concept and the implications of the muses’ image in Jean-Luc Nancy’s philosophy, based, specially, in Les muses, a book published by him in 1994. This book is a collection of essays and conferences written or pronounced in different moments, in which the philosopher tries to articulate his conceptions of world and community with a way to think about language differently from the traditional philosophy (having to deal with its limits and with the occidental rationality’s limits, without the possibility of abolish them. It’s a discussion about the return of an image in the contemporaneity (the muse’s image, and about the theory that Nancy develops about the multiplicity of the arts, the aesthetics, the body and the idea of opening.

  13. Open water bells

    Science.gov (United States)

    Paramati, Manjula; Tirumkudulu, Mahesh S.

    2016-03-01

    A smooth circular moving liquid sheet is formed by the head-on impingement of two equal laminar water jets. We subject such a liquid sheet to uniform laminar air flow from one side such that the direction of air velocity is perpendicular to the liquid sheet. The pressure of the moving air deforms the liquid sheet giving rise to an open water bell. The water bell is symmetric suggesting that the gas flow around the bell is also symmetric and that the gravitational force is negligible. We have captured the shape of the water bells for varying air flow rates and for varying Weber numbers, and compared the measurements with theoretical predictions obtained from a force balance involving liquid inertia, surface tension, and pressure difference across the sheet. The pressure exerted by the gas phase on the front and the rear surface of the deformed liquid sheet is obtained from known results of flow past flat circular discs. The predicted steady state shapes match well with the measurements at low Weber numbers but differences are observed at high Weber numbers, where the sheet flaps and is no longer smooth. Interestingly, the shape predicted by assuming a constant pressure difference equal to the stagnation pressure over the whole of the front face of the sheet and free stream value over the whole of the rear face yields nearly identical results suggesting that an open water bell is similar to a closed water bell in that, to a good approximation, the pressure on either sides of the water bell is homogeneous.

  14. Timed bisimulation and open maps

    DEFF Research Database (Denmark)

    Hune, Thomas; Nielsen, Mogens

    1998-01-01

    of timed bisimulation. Thus the abstract results from the theory of open maps apply, e.g. the existence of canonical models and characteristic logics. Here, we provide an alternative proof of decidability of bisimulation for finite timed transition systems in terms of open maps, and illustrate the use......Open maps have been used for defining bisimulations for a range of models, but none of these have modelled real-time. We define a category of timed transition systems, and use the general framework of open maps to obtain a notion of bisimulation. We show this to be equivalent to the standard notion...... of open maps in presenting bisimulations....

  15. Dual Campus High School

    Directory of Open Access Journals (Sweden)

    Carmen P. Mombourquette

    2013-04-01

    Full Text Available September 2010 witnessed the opening of the first complete dual campus high school in Alberta. Catholic Central High School, which had been in existence since 1967 in one building, now offered courses to students on two campuses. The “dual campus” philosophy was adopted so as to ensure maximum program flexibility for students. The philosophy, however, was destined to affect student engagement and staff efficacy as the change in organizational structure, campus locations, and course availability was dramatic. Changing school organizational structure also had the potential of affecting student achievement. A mixed-methods study utilizing engagement surveys, efficacy scales, and interviews with students and teachers was used to ascertain the degree of impact. The results of the study showed that minimal impact occurred to levels of student engagement, minor negative impact to staff efficacy, and a slight increase to student achievement results.

  16. "The Open Library at AU" (Athabasca University): Supporting Open Access and Open Educational Resources

    Science.gov (United States)

    Elliott, Colin; Fabbro, Elaine

    2015-01-01

    To address challenges that learners, course creators, librarians and academics involved with OER and MOOCs are facing when looking for scholarly materials, Athabasca University Library has initiated the development of "the Open Library at AU." This open library is a full library website that provides easy access to open and free…

  17. Professional Development for Rhode Island School Administrators.

    Science.gov (United States)

    Turley, James; Brittingham, Barbara E.

    This report presents the results of a survey of Rhode Island school administrators (n=523) and open-ended interviews of administrators (n=28) that would provide information for the design of leadership and staff development activities as part of Rhode Island's LEAD project--an attempt to improve the leadership capacity of school administrators.…

  18. New frontiers in open innovation

    CERN Document Server

    Vanhaverbeke, Wim; West, Joel

    2014-01-01

    Companies have to innovate to stay competitive, and they have to collaborate with other organizations to innovate effectively. Although the benefits of "open innovation" have been described in detail before, mechanisms underlying how companies can be successful "open innovators" have not be understood well. A growing community of innovation management researchers started to develop different frameworks to understand open innovation in a more systematic way. This book provides a thorough examination of research conducted to date on open innovation, as well as a comprehensive overview of what will be the most important, most promising and most relevant research topics in this area during the next decade. "Open Innovation: Researching a new paradigm" (OUP 2006) was the first initiative to bring open innovation closer to the academic community. Open innovation research has since then been growing in an exponential way and research has evolved in different and unexpected directions. As the research field is growin...

  19. An Evaluation of Open Source Learning Management Systems According to Administration Tools and Curriculum Design

    Science.gov (United States)

    Ozdamli, Fezile

    2007-01-01

    Distance education is becoming more important in the universities and schools. The aim of this research is to evaluate the current existing Open Source Learning Management Systems according to Administration tool and Curriculum Design. For this, seventy two Open Source Learning Management Systems have been subjected to a general evaluation. After…

  20. Differential Use of the Open Classroom: A Study of Exploratory and Cautious Children. Final Report.

    Science.gov (United States)

    Minuchin, Patricia

    The purpose of this study was to investigate the differences between exploratory children and cautious children as they functioned in open classrooms over a period of time and to document some general aspects of child behavior in open educational settings. Sixty children were observed through the course of the school year in their first grade open…

  1. Perspective on Open-Access Publishing: An Interview with Peter Suber

    Science.gov (United States)

    Cornwell, Reid; Suber, Peter

    2008-01-01

    In this edition of Perspectives, Reid Cornwell discusses open-access publishing with Peter Suber, senior researcher at the Scholarly Publishing and Academic Resources Coalition, senior research professor of philosophy at Earlham College, and currently visiting fellow at Yale Law School. Open access means that scholarly work is freely and openly…

  2. Open, Online, and Blended: Transactional Interactions with MOOC Content by Learners in Three Different Course Formats

    Science.gov (United States)

    Emanuel, Jeffrey P.; Lamb, Anne

    2017-01-01

    During the 2013-14 academic year, Harvard University piloted the use of Massive Open Online Courses (MOOCs) as tools for blended learning in select undergraduate and graduate residential and online courses. One of these courses, The Ancient Greek Hero, combined for-credit (Harvard College and Harvard Extension School) and open online (HarvardX)…

  3. Perspective on Open-Access Publishing: An Interview with Peter Suber

    Science.gov (United States)

    Cornwell, Reid; Suber, Peter

    2008-01-01

    In this edition of Perspectives, Reid Cornwell discusses open-access publishing with Peter Suber, senior researcher at the Scholarly Publishing and Academic Resources Coalition, senior research professor of philosophy at Earlham College, and currently visiting fellow at Yale Law School. Open access means that scholarly work is freely and openly…

  4. Lexical Link Analysis for the Haiti Earthquake Relief Operation Using Open Data Sources

    Science.gov (United States)

    2011-06-01

    Information Systems Experimentation ( DISE ) Group Naval Postgraduate School, Monterey, CA 93943 yzhao@nps.edu, spgallup@nps.edu, djmackin@nps.edu...Using Open Data Sources Dr. Ying Zhao, Dr. Shelley P. Gallup, and Dr. Douglas J. MacKinnon Distributed Information Systems Experimentation ( DISE ...Proceedings of the Seventh Annual Acquisition Research Program. Monterey, CA: Naval Postgraduate School. DISE Distributed Information Systems

  5. Managing conflict in primary schools / Tshigwane Elizabeth Motsiri.

    OpenAIRE

    Motsiri, Tshigwane Elizabeth

    2008-01-01

    This research investigated the correlation between the principal's leadership style and the school organisational climate. The literature study established the importance of leadership in the context of an open and positive school organisational climate. In this regard, it was found that a supportive principal leadership style is positively related to an open and positive school climate, where educators are engaged and enjoy high collegiality and intimate relationships. T...

  6. An open question.

    Science.gov (United States)

    Ayling, John

    2004-01-01

    The lungs are surrounded by the pleural membranes. The visceral pleura directly covers the lung and is separated from the parietal pleura by a layer of surfactant, which reduces friction during respiratory movement. A potential space exists between these two layers, and they may become separated by fluid or air. A lung can collapse to the size of a fist under pressure from either. Standard treatment in the field for an open chest wound is an occlusive dressing. The first thing that can be used to occlude the wound is a gloved hand. After placing the dressing, evaluate the breath sounds and determine if they have improved. The dressing should be taped down on three sides, leaving one side open to relieve the pressure during exhalation (one-way valve). "Burping" the dressing involves lifting one side to make sure any pressure buildup is relieved, as occasionally the dressing can become adhered to the skin, which may lead to a tension pneumothorax. If, after ensuring the occlusive dressing is properly in place, the respiratory rate increases, distress level worsens, oxygen saturations fall and breath sounds decrease, then needle decompression is required. A neurovascular bundle is located underneath each rib, and it is important to avoid damage to that bundle by performing a decompression over the top of a rib. If the patient is intubated before the development of a tension pneumothorax, carefully evaluate the breath sounds (especially if the left-side sounds are diminished) to determine if the ET tube needs to be withdrawn a centimeter. The rescuer performing ventilation will usually recognize a tension pneumothorax by the difficulty in bagging the patient. Remember, when you perform a needle thoracentesis, you are creating an open chest wound. Early signs and symptoms of a tension pneumothorax include diminished or absent breath sounds, severe dyspnea, narrowing pulse pressure, tachycardia and restlessness. Neck veins may be distended, but this can be a normal

  7. Necobelac supporting open access, a path to open science

    OpenAIRE

    Agudelo-Calderon, Carlos Alberto

    2012-01-01

    On the occasion of the International Open Access week, a global event now in its 5th year, promoting Open Access (OA) as a new norm in scholarship and research, we, the NECOBELAC (Network of collaboration between Europe and Latin American Caribbean (LAC) countries to spread know-how in scientific writing and provide the best tools to exploit open access information for the safeguard of public health) project partners, wish to stimulate the scientific community to take action and make their wo...

  8. On the impact of being open

    NARCIS (Netherlands)

    Schuwer, Robert; van Genuchten, Michiel; Hatton, Les

    2015-01-01

    There's much discussion about being open, with topics such as open source software, open innovation, open research, and open education. Will the whole world be open, and, if so, what was all closed in the past? The authors analyze the similarities and differences between the open movements they've b

  9. Achieving Better Buying Power through Acquisition of Open Architecture Software Systems: Volume 1

    Science.gov (United States)

    2016-01-06

    2009. [Sca10] Scacchi, W. (2010). The Future of Research in Free / Open Source Software Development, Proc. ACM Workshop Future of Software Engineering...review and approve choices between functionally similar low or no cost open source software components, and commercially priced closed source ...NavalPostgraduate School, Monterey, CA. [Ke12] Kenyon, H. (2012). DoD, Intel Officials Bullish On Open Source Software ; Government- wide Software

  10. The Open Library at AU (Athabasca University: Supporting Open Access and Open Educational Resources

    Directory of Open Access Journals (Sweden)

    Colin Elliott

    2015-04-01

    Full Text Available To address challenges that learners, course creators, librarians and academics involved with OER and MOOCs are facing when looking for scholarly materials, Athabasca University Library has initiated the development of the Open Library at AU. This open library is a full library website that provides easy access to open and free resources. Tools and information literacy tutorials are also included to enable learners, researchers, and others to find, evaluate, and use the information they need for their open learning course or research. Many of the challenges that those involved in open learning face are addressed by the open library and the potential impact it can have on open learning and knowledge sharing is tremendous. http://dx.doi.org/10.5944/openpraxis.7.2.196

  11. Empathy in Medical Students Is Moderated by Openness to Spirituality.

    Science.gov (United States)

    Damiano, Rodolfo F; DiLalla, Lisabeth F; Lucchetti, Giancarlo; Dorsey, J Kevin

    2017-01-01

    Empathy is one component of medical student education that may be important to nurture, but there are many potential psychological barriers to empathy, such as student depression, burnout, and low quality of life or wellness behaviors. However, few studies have addressed how positive behaviors such as wellness and spirituality, in combination with these barriers, might affect empathy. We hypothesized a negative relationship between psychological distress and empathy, and a positive relationship between empathy and wellness behaviors. We also hypothesized that openness to others' spirituality would moderate the effects of psychological distress on empathy in medical students. This cross-sectional study included 106 medical students in a public medical school in the U.S. Midwest. Mailed questionnaires collected student information on specialty choice and sociodemographics, empathy, spirituality openness, religiosity, wellness, burnout, depression, anxiety, and stress. Hierarchical multiple regression analysis was conducted, with empathy as the dependent variable, psychological distress and all wellness behaviors as predictors, and spirituality openness as a moderator. Specialty choice, burnout, wellness behaviors, spirituality openness, and religiosity were significant independent predictors of empathy. In addition, when added singly, one interaction was significant: Spirituality Openness × Depression. Spirituality openness was related to empathy only in nondepressed students. Empathy of students with higher levels of depression was generally lower and not affected by spirituality openness. Nondepressed students who reported lower openness to spirituality might benefit most from empathy training, because these students reported the lowest empathy. Highly depressed or disengaged students may require interventions before empathy can be addressed. In addition, burnout was related to lower levels of empathy and wellness was related to higher levels. These provide

  12. Implementing Open Data: The Open Data Commons Project

    Directory of Open Access Journals (Sweden)

    Jordan Hatcher

    2008-02-01

    Full Text Available Free and libre/open source software (F/LOSS movements have spawned similar solutions in many other contexts, each at differing stages of development. As F/LOSS enters the routine and familiarity of middle age, the open content movement--open source for non-software copyright and best embodied by the work of Creative Commons--has just graduated university and is getting a feel for the world. Even younger is the open data movement, whose legal tools have just started to come online.

  13. Inclusive STEM High School Design: 10 Critical Components

    Science.gov (United States)

    Peters-Burton, Erin E.; Lynch, Sharon J.; Behrend, Tara S.; Means, Barbara B.

    2014-01-01

    Historically, the mission of science, technology, engineering, and mathematics (STEM) schools emphasized providing gifted and talented students with advanced STEM coursework. However, a newer type of STEM school is emerging in the United States: inclusive STEM high schools (ISHSs). ISHSs have open enrollment and are focused on preparing…

  14. Cultural Competence and School Counselor Training: A Collective Case Study

    Science.gov (United States)

    Nelson, Judith A.; Bustamante, Rebecca; Sawyer, Cheryl; Sloan, Eva D.

    2015-01-01

    This collective case study investigated the experiences of bilingual counselors-in-training who assessed school-wide cultural competence in public schools. Analysis and interpretation of data resulted in the identification of 5 themes: eye-opening experiences, recognition of strengths, the role of school leaders, road maps for change, and…

  15. Cultural Competence and School Counselor Training: A Collective Case Study

    Science.gov (United States)

    Nelson, Judith A.; Bustamante, Rebecca; Sawyer, Cheryl; Sloan, Eva D.

    2015-01-01

    This collective case study investigated the experiences of bilingual counselors-in-training who assessed school-wide cultural competence in public schools. Analysis and interpretation of data resulted in the identification of 5 themes: eye-opening experiences, recognition of strengths, the role of school leaders, road maps for change, and…

  16. E-Learning and Evidence Based Practice in Schools

    Science.gov (United States)

    Quong, Terrence

    2016-01-01

    JCTIC has used open source software to develop a unique school online environment that has made evidence based practice viable in their school. In this paper the proposition is made that eLearning enables evidence based practice which in turn leads to improved student outcomes. Much has been written about evidence based practice in schools, but…

  17. Cooperative Learning and the Organization of Secondary Schools.

    Science.gov (United States)

    Shachar, Hanna; Sharan, Shlomo

    1995-01-01

    Describes the interrelationship between school organization and classroom instructional style. Characterizes the bureaucratic and the open systems models of school organization in terms of three major dimensions of school life: administrator, teacher, and student behaviors; work design and tasks; and space-time allocations. The bureaucratic…

  18. British International Schools: The Deployment and Training of Teaching Assistants

    Science.gov (United States)

    Tarry, Estelle

    2011-01-01

    This article reports on research carried out on behalf of the Council of British International Schools (COBIS) as to the role and deployment of British international school teaching assistants. Through questionnaires and a follow up open discussion with headteachers from British international schools it was found that, due to the differing…

  19. It's Elementary: Expanding the Use of School-Based Clinics

    Science.gov (United States)

    Lear, Julia Graham

    2007-01-01

    Governor Arnold Schwarzenegger has declared his intention to open health centers in 500 elementary schools across the state, which would bring the total number of such school-based clinics to 646. This initiative builds on California's 30-year history of using the school setting to increase access to care for children, improve clinical outcomes,…

  20. Opening Channels of Communication

    Directory of Open Access Journals (Sweden)

    Clarice Moura Costa

    2009-03-01

    Full Text Available Psychosis, as described through a psychodynamic perspective, is conceptualized as an attempt to deny the enveloping reality to avoid contact with the other. Music therapy is a way to break this barrier of non-communication raised by the patients. The music therapy process is configured as a trinomial – action (making music/ relationship (action with the other/communication (musical or verbal voluntary expression of feelings and conflicts, which, although intrinsically connected, is perceived in a sequential process. Aulagnier asserts that psychic activity represents the conjunction of three modes of functioning: the original process, the primary process and the secondary process. The perception of sound passes through three phases, corresponding to each manner of functioning of the psychic system – the pleasure of hearing, the desire to listen (to the other and the imperative of meaning. The music therapy process offers a significant similarity with the theory proposed by Aulagnier. We propose the hypothesis that in music therapy, there is an opportunity to (reexperience very archaic phases in the constitution of the ego, but in a new manner, so helping to open communication channels. This theoretical hypothesis is illustrated by real examples of patients.