WorldWideScience

Sample records for k-1 illustrated book

  1. Mechanisms in ancient Chinese books with illustrations

    CERN Document Server

    Hsiao, Kuo-Hung

    2014-01-01

    This book presents a unique approach for studying mechanisms and machines with drawings that were depicted unclearly in ancient Chinese books. The historical, cultural and technical backgrounds of the mechanisms are explained, and various mechanisms described and illustrated in ancient books are introduced. By utilizing the idea for the conceptual design of modern mechanisms, all feasible designs of ancient mechanisms with uncertain members and joints that meet the technical standards of the subjects’ time periods are synthesized systematically. Ancient Chinese crossbows (the original crossbow and repeating crossbows), textile mechanisms (silk-reeling mechanism, spinning mechanisms, and looms), and many other artisan's tool mechanisms are used as illustrated examples.  Such an approach provides a logical method for the reconstruction designs of ancient mechanisms with uncertain structures. It also provides an innovative direction for researchers to further identify the original structures of mechanisms...

  2. The Representation of Authors and Illustrators of Color in School-Based Book Clubs

    Science.gov (United States)

    McNair, Jonda C.

    2008-01-01

    The purpose of this study was to examine Firefly (Preschool) and Seesaw (K-1) Scholastic book club order forms for a period of one year--from September of 2004 through June of 2005--in order to determine which authors and illustrators of children's literature, particularly those of color, were routinely included and excluded. This study was…

  3. Child Illustrators: Making Meaning through Visual Art in Picture Books

    Science.gov (United States)

    Villarreal, Alicia; Minton, Sylvia; Martinez, Miriam

    2015-01-01

    In picture books, illustrations often play a critical role in helping authors tell stories. Instruction in the elements of composition including visual, textual, and peritextual features enhances meaning for children when they are given the opportunity to become authors of their own picturebooks. This study was conducted in a fourth grade…

  4. Culture or Disability? Examining Deaf Characters in Children's Book Illustrations

    Science.gov (United States)

    Golos, Debbie B.; Moses, Annie M.; Wolbers, Kimberly A.

    2012-01-01

    Picture books can influence how children perceive those from backgrounds and cultures different from their own. Studies have been conducted examining how the text of children's literature portrays multicultural characters or characters with disabilities. However, few have looked specifically at the portrayal of characters through illustrations,…

  5. Preschoolers' Ideas of What Makes a Picture Book Illustration Beautiful

    Science.gov (United States)

    House, Carolyn A.; Rule, Audrey C.

    2005-01-01

    Preschoolers' reasons for ranking the beauty of 30 children's book illustrations were investigated through individual interviews. Most frequent response criteria for beauty were associated with familiar objects or surroundings, action, color, clothing or accessories, water or ice, body features, and babies or small things. Children's book…

  6. Verbal Visuality at the Service of Pathemization in Illustrated Books

    Directory of Open Access Journals (Sweden)

    Beatriz dos Santos Feres

    2013-11-01

    Full Text Available This work, mostly based on the Semiolinguistic Theory of Discourse Analysis, intends to discuss aspects of the verbal-visual semiosis in illustrated books regarding the process of pathemization, that is, the triggering of emotions from descriptive staging. It is assumed that pathemization, of an intentional nature, is activated in the text-reader interaction due to a manifested discursive planning in (verbal and visual representations endowed with cultural valuation prone to reactive emotions. The observed complementarity between word and image in the analyzed illustrated books allows for not only a higher density of meaning, but also for the enhancement of qualities and categories that are not always “signifiable.” The symbolization by analogy updated in the images (visual or metaphorical, or in the superposition of both, complexifies signification, allowing not only for effects of meaning, but also for felt effects, stemming from knowledge and beliefs on which representations are founded, whether verbally or visually configured.

  7. An Investigation into Illustrations in English Course Books in a Turkish Context

    Science.gov (United States)

    Basal, Ahmet; Celen, Kiymet Merve; Kaya, Halime; Bogaz, Seyma Nur

    2016-01-01

    In language classrooms all over the world, textbooks are the most dominant teaching and learning materials. In these books, illustrations occupy a prominent place in teaching and learning processes. This qualitative study aims to investigate the frequency of occurrence and functions of illustrations in English course books. Four course books (5th,…

  8. Using Authentic Picture Books and Illustrated Books to Improve L2 Writing among 11-Year-Olds

    Science.gov (United States)

    Birketveit, Anna; Rimmereide, Hege Emma

    2017-01-01

    The case study investigates what impact extensive reading of authentic picture books/illustrated books had on the learners' writing skills in a Norwegian EFL (English as a foreign language) classroom of 11-year-olds. Furthermore, the study also looks into the importance the pictures/illustrations had for the learners and what type of picture-text…

  9. Using Authentic Picture Books and Illustrated Books to Improve L2 Writing among 11-Year-Olds

    Science.gov (United States)

    Birketveit, Anna; Rimmereide, Hege Emma

    2017-01-01

    The case study investigates what impact extensive reading of authentic picture books/illustrated books had on the learners' writing skills in a Norwegian EFL (English as a foreign language) classroom of 11-year-olds. Furthermore, the study also looks into the importance the pictures/illustrations had for the learners and what type of picture-text…

  10. Illustrations

    OpenAIRE

    2016-01-01

    Illustration 1 Illustration 2 : Taux des éléments représentés en fonction du niveau scolaire et du type d’identification Illustration 1 : Les positions GPS Illustration 2 : Espace d’investissement d’un enfant de 8 ans Source : Données A. Legendre Illustration 3 : Espace des enfants Source : Données A. Legendre Illustration 4 : Co-présence des enfants Source : Données A. Legendre

  11. Illustrations

    OpenAIRE

    2016-01-01

    Illustration I – Source : Exposition coloniale internationale. Guide officiel. Illustration II – Carte : « Paris sociologique », Paris, Guide Dent, (sd). Illustration III – André Granet, La Tour Eiffel illuminée pour l’Exposition de 1937, Fonds Eiffel, RMN. Illustration IV – Robert Delaunay, Tour, première étude, 1909, MAMVP, 1985, ©L&M SERVICES B.V. Amsterdam 981005. Illustration V – Robert Delaunay, La Ville de Paris, 1910-1912, MAM, ©L&M SERVICES B.V. Amsterdam 981005. Illustration VI...

  12. Illustrations

    OpenAIRE

    2013-01-01

    Fig. 1 – Fiche d’identité du baron de Plazanet avec ses deux illustrations, gravure et photographie, extraite du Relevé des Députés, IVe législature, 1889. Fig. 2 et 3 – Deux portraits de Xavier Vallat en 1919 et 1936. Sur la première, la pose de profil permet de masquer l’œil borgne, grâce à une lentille opaque qui évoque un monocle. En 1936, les profils se raréfient et le député préfère une pose de face, accentuant la perte de son œil. Un indice du retour de la culture d’ancien combattant ...

  13. Text and images: relations in illustrated book for children with visual impairment

    Directory of Open Access Journals (Sweden)

    Tássia Ruiz

    2014-12-01

    Full Text Available Exploratory, the paper presents and discusses the response of children with visual impairment on the illustrated children’s book, analyzing how to establish relationships and dialogue between text and image support in the book from the perspective of non- visual , mainly in concerns the cognitive feature and the specific conditions of visual impairment . This study is justified by the importance that access to different languages ( image and text , added to the literary function of fictional narrative can provide the Bantam player, as well as access to imaging and its meaning to the reader , there is still the possibility include children with visual impairment in the literary universe in a field whose intricate set of languages provides the reader with a multiplicity of meanings that can take children’s reader to find new ways to relate to the world . The method used here , interview - conversation ( SARAMAGO , 2001 , questions blind and low vision between 10 and 14 years Londrinense Institute of Education and Work for the Blind of Londrina / PR on the relationship between image and text children during reading two illustrated works adapted : forgotten Adelia Adelia and dreamy, both selected by the diversity of graphical features ( smooth textures , flocked , granular , etc. used in the translation of images for relief . The aim is to compare two aspects equivalences and differences between reading narratives that rely on graphics to convey its essential message and that can easily be understood only by the text in order to verify that an integration or fragmentation of languages that exist on integrating image text - in the context of visual impairment . Results indicate that the experience of reading is complexed in each book , unique to each turn of the page and predominantly verbal. However, typologies act as effective parameter for understanding the various relationships between image and text observed during the interview and awaken

  14. Natio Made Visible: The Hungarian Political Community in Illustrated Books (ca. 1350–1700

    Directory of Open Access Journals (Sweden)

    Karolina Mroziewicz

    2016-12-01

    Full Text Available Natio Made Visible: The Hungarian Political Community in Illustrated Books (ca. 1350–1700 The main objective of this paper is to examine the understanding of the natio Hungarica, as it emerges from the texts and images of a number of richly illustrated Hungarian books. The Chronicon pictum (ca. 1358, János Thuróczy’s Chronica Hungarorum (Brno, Augsburg, 1488, Mausoleum regum et Ungariae ducum (Nuremberg, 1664, Trophaeum domus Estorasianae (Vienna, 1700 and Clarissimorum Hungariae heroum icones (Vienna, 1652 served as points of reference for the discussion on the ways in which the Hungarian political community wanted to be and was perceived prior to its eighteenth- and nineteenthcentury transformation into a modern nation. The study encompasses the formative period of Hungarian illustrated books that contributed to the formulation of the national imagery in Hungary, based on the ethno-genetic myths, memories of shared ancestry and collective past, cultural values, legal code, customs and models of conduct, modes of self-display, and, last but not least, on the imagery of the homeland. The three-and-a-half-century chronological scope of the study has made it possible to trace the major changes which the concept of natio Hungarica underwent between mid-fourteenth and seventeenth centuries.   Unaoczniona Nacja Węgierska wspólnota polityczna w książkach ilustrowanych (ca. 1350 – 1700 Głównym celem artykułu było zbadanie rozumienia pojęcia natio Hungarica, jakie wyłania się z tekstów i obrazów węgierskich książek ilustrowanych. Chronicon pictum (ca. 1358, Chronica Hungarorum Jánosa Thuróczy’ego (Brno, Augsburg, 1488, Mausoleum regum et Ungariae ducum (Norymberga, 1664, Trophaeum domus Estorasianae (Wiedeń, 1700 oraz Clarissimorum Hungariae heroum icones (Wiedeń, 1652 stanowiły punkt wyjścia do analizy wyobrażeń, jakie wspólnota polityczna miała na swój temat oraz jakie starano się jej narzucić przed er

  15. “Surprised!” Telling the pictures. Can the illustrations in picture books promote language acquisition?

    Directory of Open Access Journals (Sweden)

    Sandie Mourão

    2009-11-01

    Full Text Available Este artigo procura apresentar os resultados da re-análise dos dados recolhidos em dois projectos de investigaçãoacçãosobre a utilização de álbuns em língua inglesa nas aulas de Inglês da Educação Pré-Escolar em Portugal.Dois álbums forum usados, demonstrando diferentes interacções entre texto e imagem, ‘paralela’ e ‘interdependente’. Transcrições de gravações de horas do conto com estes livros foram categorizadas de acordo com asfalas em Inglês a que o texto ou imagem deram origem. Os resultados indicam que a linguagem que as criançasaprendem de facto, com os livros ‘inter-dependentes’ (onde a história escrita é diferente da história ilustrada émais rica e as próprias crianças tomam um papel mais activo na criação de um significado. As implicações destesresultados são discutidas.The following article presents the findings of a re-analysis of data from two action research projects investigatingthe use of English picture books in Pre-school English classes in Portugal. Two picture books were used, eachrepresenting parallel and interdependent storytelling models. Audio tapescripts of the picture book read aloudswere categorised according to the utterances prompted by the verbal and visual texts. Results show that foreignlanguage acquisition is extended when both the verbal and visual texts of a picture book are used for languageinput and that children are more actively involved in meaning making. Implications are discussed.

  16. Traumatic brain injuries in illustrated literature: experience from a series of over 700 head injuries in the Asterix comic books.

    Science.gov (United States)

    Kamp, Marcel A; Slotty, Philipp; Sarikaya-Seiwert, Sevgi; Steiger, Hans-Jakob; Hänggi, Daniel

    2011-06-01

    The goal of the present study was to analyze the epidemiology and specific risk factors of traumatic brain injury (TBI) in the Asterix illustrated comic books. Among the illustrated literature, TBI is a predominating injury pattern. A retrospective analysis of TBI in all 34 Asterix comic books was performed by examining the initial neurological status and signs of TBI. Clinical data were correlated to information regarding the trauma mechanism, the sociocultural background of victims and offenders, and the circumstances of the traumata, to identify specific risk factors. Seven hundred and four TBIs were identified. The majority of persons involved were adult and male. The major cause of trauma was assault (98.8%). Traumata were classified to be severe in over 50% (GCS 3-8). Different neurological deficits and signs of basal skull fractures were identified. Although over half of head-injury victims had a severe initial impairment of consciousness, no case of death or permanent neurological deficit was found. The largest group of head-injured characters was constituted by Romans (63.9%), while Gauls caused nearly 90% of the TBIs. A helmet had been worn by 70.5% of victims but had been lost in the vast majority of cases (87.7%). In 83% of cases, TBIs were caused under the influence of a doping agent called "the magic potion". Although over half of patients had an initially severe impairment of consciousness after TBI, no permanent deficit could be found. Roman nationality, hypoglossal paresis, lost helmet, and ingestion of the magic potion were significantly correlated with severe initial impairment of consciousness (p ≤ 0.05).

  17. BOOK REVIEW: The Illustrated Wavelet Transform Handbook: Introductory Theory and Applications in Science, Engineering, Medicine and Finance

    Science.gov (United States)

    Ng, J.; Kingsbury, N. G.

    2004-02-01

    This book provides an overview of the theory and practice of continuous and discrete wavelet transforms. Divided into seven chapters, the first three chapters of the book are introductory, describing the various forms of the wavelet transform and their computation, while the remaining chapters are devoted to applications in fluids, engineering, medicine and miscellaneous areas. Each chapter is well introduced, with suitable examples to demonstrate key concepts. Illustrations are included where appropriate, thus adding a visual dimension to the text. A noteworthy feature is the inclusion, at the end of each chapter, of a list of further resources from the academic literature which the interested reader can consult. The first chapter is purely an introduction to the text. The treatment of wavelet transforms begins in the second chapter, with the definition of what a wavelet is. The chapter continues by defining the continuous wavelet transform and its inverse and a description of how it may be used to interrogate signals. The continuous wavelet transform is then compared to the short-time Fourier transform. Energy and power spectra with respect to scale are also discussed and linked to their frequency counterparts. Towards the end of the chapter, the two-dimensional continuous wavelet transform is introduced. Examples of how the continuous wavelet transform is computed using the Mexican hat and Morlet wavelets are provided throughout. The third chapter introduces the discrete wavelet transform, with its distinction from the discretized continuous wavelet transform having been made clear at the end of the second chapter. In the first half of the chapter, the logarithmic discretization of the wavelet function is described, leading to a discussion of dyadic grid scaling, frames, orthogonal and orthonormal bases, scaling functions and multiresolution representation. The fast wavelet transform is introduced and its computation is illustrated with an example using the Haar

  18. Development of monograph titled "augmented chemistry aldehida & keton" with 3 dimensional (3D) illustration as a supplement book on chemistry learning

    Science.gov (United States)

    Damayanti, Latifah Adelina; Ikhsan, Jaslin

    2017-05-01

    Integration of information technology in education more rapidly performed in a medium of learning. Three-dimensional (3D) molecular modeling was performed in Augmented Reality as a tangible manifestation of increasingly modern technology utilization. Based on augmented reality, three-dimensional virtual object is projected in real time and the exact environment. This paper reviewed the uses of chemical learning supplement book of aldehydes and ketones which are equipped with three-dimensional molecular modeling by which students can inspect molecules from various viewpoints. To plays the 3D illustration printed on the book, smartphones with the open-source software of the technology based integrated Augmented Reality can be used. The aims of this research were to develop the monograph of aldehydes and ketones with 3 dimensional (3D) illustrations, to determine the specification of the monograph, and to determine the quality of the monograph. The quality of the monograph is evaluated by experiencing chemistry teachers on the five aspects of contents/materials, presentations, language and images, graphs, and software engineering, resulted in the result that the book has a very good quality to be used as a chemistry learning supplement book.

  19. Books

    Science.gov (United States)

    White, Daniel O.

    1973-01-01

    Reviews books and curriculum materials for law-related courses for public schools coordinated by the National Center for Law-Focused Education in Chicago. Police and police behavior is the focus of this review. (DM)

  20. 中国本土原创绘本中的文字设计%Chinese Local Text Design of Original Illustrated Books

    Institute of Scientific and Technical Information of China (English)

    杨宇萍

    2015-01-01

    为了探究中国本土原创绘本中的文字设计,从丰子恺儿童图画书奖和信谊幼儿文学奖的获奖作品中挑选了5本中国本土原创绘本,这5本绘本的故事内容涉及自然、生活及科普3个方面。虽然绘本中的文字大约只有200~500个字符,但是从逐本的文字设计分析和探究中,可以看出设计者对于中国文字的设计讲究和设计使用。无论是绘本书籍的封面文字设计,还是绘本书籍的内页文字设计,文字不再是以辅助绘本中的插图而存在。文字本身在绘本阅读的情景中已经具有丰富的视觉设计层次和人性化的阅读感官。正是文字设计日益受到设计者的重视,以绘本为载体的这类独特书籍类型在中国本土的阅读和出版情景中而蕴含着更丰富的中国书卷文化。%In order to explore China local original picture book text design, this paper selects the five Chinese local original picture books from FENG ZIKAI Children's Picture Book Award and HSIN-YI children's literature prize winners in five illustrated story that relates to nature, life and science. Although the text of picture books is only about 200 to 500 characters, we can see the designer's design stresses for Chinese characters and design use from the text of this design by analysis and inquiry. Whether it is design illustrated cover text books, picture books or books pages text design, text no longer bases on the auxiliary picture books and illustrations exists. The text itself has a rich visual design hierarchy and humane sense in reading picture books read scenarios. Typography is the growing emphasis on designers to “picture books” as the carrier of such a unique type of books and reading in Chinese mainland publishing scenarios and contains a richer Chinese books culture.

  1. The impact of western science and technology on 'ukiyo-e' prints and book illustrations in late eighteenth and nineteenth century Japan.

    Science.gov (United States)

    Low, Morris

    2011-01-01

    In the Edo period (c. 1600-1868), exposure to Western art, science and technology encouraged Japanese 'ukiyo-e' (pictures of the floating world) artists to experiment with Western perspective in woodblock prints and book illustrations. We can see its early influence in the work of Utagawa Hiroshige (1787-1858), as well as Utagawa Kuniyoshi (1797-1861). Unlike Hiroshige, Kuniyoshi lived to see the opening of the port of Yokohama to trade with the West in 1859. A whole genre of Yokohama prints emerged and one of the key artists was Utagawa Sadahide (1807-1873). In his illustrated books entitled 'Yokohama kaikō kenbunshi' (A Record of Things Seen and Heard in the Open Port of Yokohama) (1862), Sadahide plays with perspective in an effort to represent the dynamic changes that Japan was undergoing in its encounter with the West at the time. In the work of later artists such as Hiroshige III (1843-1894), Kobayashi Kiyochika (1847-1915) and Inoue Yasuji (1864-1889), we can see growing efforts to depict light, shadow and depth, and a continuing fascination with the steam locomotive and the changes occurring in the Tokyo-Yokohama region as Japan entered the Meiji period (1868-1912).

  2. Illustrator CC digital classroom

    CERN Document Server

    Smith, Jennifer

    2013-01-01

    A complete training package lets you learn Adobe Illustrator CC at your own speed Adobe Illustrator is the leading drawing and illustration software used to create artwork for a variety of media. This book-and-DVD package provides 13 self-paced lessons that get you up to speed on the latest version of Illustrator (Creative Cloud). Step-by-step instructions in the full-color book are supported by video tutorials on the DVD. Together, these tools will help you learn Adobe Illustrator basics, essential skills, and all the new capabilities in Illustrator CC-in no time.  Includes step-by-step in

  3. Bidimensional illustration touches in children books: consideration about their construction in the context of the education of children with visual impairments

    Directory of Open Access Journals (Sweden)

    Adriano Henrique Nuernberg

    2010-06-01

    Full Text Available The politics diffusion of the inclusive education last decade was positive for the several initiatives that wanted to promote the access to the knowledge from visual deficiency people. Many of these initiatives, however, have their theories from crooked notions about the ways of access and concepts elaborated of blind people, mainly when it deals with the congenital blindness. The goal of this article is to discuss the construction of bidimensional illustration touches as a way of guarantee the access of the visual content from children books. Based in the historic-cultural psychology from Vigotski, differences are pointed between the ways of visual and touch perception, taking the language as a way of blindness social compensation. Finding conceptual problems of the construction of these bidimensional illustration touches, it is a hope to collaborate for the improvement of the quality of the material produced in the context of the inclusive education, having in view the attention to the different topics of the psychical human being in the presence of the congenital blindness.

  4. 图像证史——解读《三才图会》%Pictures Attest to History-reading the Book of Three Realms Illustration

    Institute of Scientific and Technical Information of China (English)

    吕小川

    2012-01-01

    Three Realms illustration(the heaven ,the earth and the human)is a magnitude book that comprises lots of volumes and has masses of pictures, in which the texts are appeared with related pictures in recording things and events. The book not only revivifies ancient people's daily lives for modern readers,but also imparts the folk's way of seeing the world to constitute an in-depth gain to the researchers. As in the vast volumes of ancient Chinese esthetics,picture works could only stand for the palates of the elites that have a say, while the tastes of the ordinary people comprising the maiority of population were overlooked. Therefore, it is of much significance to study Three Realms illustration which stands for the tastes of the ordinary people .%《三才图会》一书卷帙巨大,图像繁多,所记事物,图文并存,不仅向当代阅读者粗略还原了古代民众日常生活场景,而且对研究者而言,更深层的收获应该是看到了当时一般民众"观看世界的方式"。因为以往汗牛充栋的中国美学理论著述中的图像作品,只代表着占有语话权的精英文化文人的趣味。而占人口大多数的普通人的口味被忽略了,所以对代表一般民众品位的《三才图绘》进行研究是很有意义的。

  5. 从科普插图看托勒密的地心说%Understanding the Geocentric Model from Illustrations in Popular-Science Books in China

    Institute of Scientific and Technical Information of China (English)

    吴光节

    2015-01-01

    古希腊著名天文学家托勒密一生著作很多,他和他的学说在天文学发展中无疑占有重要地位,其中最为著名、影响甚广的,似乎是被诬蔑为“臭名昭著”的“地心说”。不过,在中国的天文学科普书籍中,作者注意到有两种不同版本的“地心说”插图,两者反映的科学含义有很大差别。试图从这两种不同版本的插图来探讨“地心说”为什么能够统治那么多年。%Claudius Ptolemaeus, a well-known astronomer of the Ancient Greece, wrote many books in his life time. He and his writings are certainly important in the history of astronomy. His most influential idea is the ‘notorious’ Geocentric Model. From some popular-science books about astronomy in China the author has found two highly different versions of illustrations about the Geocentric Model. In this paper the author discusses which version is closer to the original idea of Claudius Ptolemaeus. In addition, the author argues that the eventual replacement of the long-held Geocentric Model by the Heliocentric Model owes to advancements in astronomical observations.

  6. "What is the Use of a Book without Pictures?" An Exploration of the Impact of Illustrations on Reading Experience in "A Monster Calls"

    Science.gov (United States)

    Aggleton, Jen

    2017-01-01

    This article examines the effect of Jim Kay's illustrations on the experience of reading "A Monster Calls" by Patrick Ness. The author compares the responses of six Key Stage Three children (11-14 years old), three of whom were given an illustrated version of the text, and three a non-illustrated version. The children with an illustrated…

  7. The Royal Book by Haly Abbas from the 10th century: one of the earliest illustrations of the surgical approach to skull fractures.

    Science.gov (United States)

    Aciduman, Ahmet; Arda, Berna; Kahya, Esin; Belen, Deniz

    2010-12-01

    Haly Abbas was one of the pioneering physicians and surgeons of the Eastern world in the 10th century who influenced the Western world by his monumental work, The Royal Book. The book was first partly translated into Latin by Constantinus Africanus in the 11th century without citing the author's name. Haly Abbas was recognized in Europe after full translation of The Royal Book by Stephen of Antioch in 1127. The Royal Book has been accepted as an early source of jerrah-names (surgical books) in the Eastern world. The chapters regarding cranial fractures in Haly Abbas' work include unique management strategies for his period with essential quotations from Paul of Aegina's work Epitome. Both authors preferred free bone flap craniotomy in cranial fractures. Although Paul of Aegina, a Byzantine physician and surgeon, was a connection between ancient traditions and Islamic interpretation, Haly Abbas seemed to play a bridging role between the Roman-Byzantine and the School of Salerno in Europe.

  8. Reviews: Books.

    Science.gov (United States)

    Weiss, Bretta; And Others

    1993-01-01

    Reviews three books: "The Schoolhome: Rethinking Schools for Changing Families," by Jane Martin; "Godly Play," by Jerome Berryman; and "Five Kingdoms: An Illustrated Guide to the Phyla of Life on Earth," by Margulis and Schwartz. (TJQ)

  9. Book Review: Book review

    Science.gov (United States)

    Clevers, Jan G. P. W.

    2016-09-01

    For many years a good introductory book for undergraduate and postgraduate students on remote sensing of the Earth's land surface, which was not starting with an emphasis on traditional photographic techniques, was missing. In 2010 the first edition of the book Fundamentals of Satellite Remote Sensing by Emilio Chuvieco and Alfredo Huete was published by CRC Press and it was filling this gap. Now the second edition by Emilio Chuvieco was published by CRC Press. This second edition is made more attractive by the use of colour and including colour illustrations instead of the black-and-white ones in the first edition.

  10. Book Review: Book review

    Science.gov (United States)

    Mishchenko, Michael I.

    2017-07-01

    This fundamental (and in many respects encyclopedic) 755-page monograph was published as part of the ;Mario Boella Series on Electromagnetism in Information and Communication; edited by P. L. E. Uslenghi. The main purpose of the book is systematic exposition of several important aspects of the electromagnetic scattering theory along with the presentation of the requisite mathematical apparatus and illustrative numerical results. What distinguishes this volume from the vast majority of related books is the extensive treatment of the time-domain scattering theory.

  11. Illustrator CS5 digital classroom

    CERN Document Server

    2011-01-01

    A book-and-video training package provides a unique illustration to the basics of Illustrator Adobe Illustrator is a unique design and drawing program that allows you to create and produce brilliant art for a variety of mediums. This full-color book-and-video training package deciphers even the most complex Illustrator tasks and gets you quickly up to speed using the capabilities of the newest release of Illustrator. Thirteen self-paced lessons explain how to create and produce vibrant graphics using this robust vector drawing application. The complementary lessons featured on the vid

  12. Text Illustrations.

    Science.gov (United States)

    Duchastel, Philippe C.

    1983-01-01

    Discusses three roles of textbook illustrations--to arrest the reader's attention and arouse interest, to provide explanation and clarification of complex verbal descriptions, and to aid retention of the information presented in the text. It is recommended that illustrations be designed with their specific role(s) in mind. (EAO)

  13. Radiology illustrated. Spine

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Heung Sik; Lee, Joon Woo [Seoul National Univ. Bundang Hospital, Seongnam, Kyonggi-do (Korea, Republic of). Dept. of Radiology; Kwon, Jong Won [Samsung Medical Center, Seoul (Korea, Republic of). Dept. of Radiology

    2014-04-01

    Offers a practical approach to image interpretation for spinal disorders. Includes numerous high-quality radiographic images and schematic illustrations. Will serve as a self-learning book covering daily routine cases from the basic to the advanced. Radiology Illustrated: Spine is an up-to-date, superbly illustrated reference in the style of a teaching file that has been designed specifically to be of value in clinical practice. Common, critical, and rare but distinctive spinal disorders are described succinctly with the aid of images highlighting important features and informative schematic illustrations. The first part of the book, on common spinal disorders, is for radiology residents and other clinicians who are embarking on the interpretation of spinal images. A range of key disorders are then presented, including infectious spondylitis, cervical trauma, spinal cord disorders, spinal tumors, congenital disorders, uncommon degenerative disorders, inflammatory arthritides, and vascular malformations. The third part is devoted to rare but clinically significant spinal disorders with characteristic imaging features, and the book closes by presenting practical tips that will assist in the interpretation of confusing cases.

  14. Medical Illustration

    Science.gov (United States)

    ... Accredited programs prepare students for a career in academic or research health science centers, industry, or consulting. As members of the health career profession with strong communication skills, medical illustrators work closely with clients to interpret ...

  15. Radiology illustrated. Gastrointestinal tract

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Byung Ihn (ed.) [Seoul National University Hospital (Korea, Republic of). Dept. of Radiology

    2015-02-01

    Radiology Illustrated: Gastrointestinal Tract is the second of two volumes designed to provide clear and practical guidance on the diagnostic imaging of abdominal diseases. The book presents approximately 300 cases with 1500 carefully selected and categorized illustrations of gastrointestinal tract diseases, along with key text messages and tables that will help the reader easily to recall the relevant images as an aid to differential diagnosis., Essential points are summarized at the end of each text message to facilitate rapid review and learning. Additionally, brief descriptions of each clinical problem are provided, followed by case studies of both common and uncommon pathologies that illustrate the roles of the different imaging modalities, including ultrasound, radiography, computed tomography, and magnetic resonance imaging.

  16. Illustrated WPF

    CERN Document Server

    Solis, Daniel M

    2009-01-01

    Windows Presentation Foundation is Microsoft's newest API for creating Windows applications. It gives the programmer the ability to produce dazzling, graphics-rich programs easily without having to delve into the messy details of the graphics subsystem. To use this power, however, the programmer must learn new concepts for laying out pages and displaying graphics. Illustrated WPF presents these concepts clearly and visually-making them easier to understand and retain. What you'll learn* The important new concepts underlying programming in WPF, including the visual tree, the logical tree, depen

  17. Skylab Illustration

    Science.gov (United States)

    1972-01-01

    This artist's concept is a cutaway illustration of the Skylab with the Command/Service Module being docked to the Multiple Docking Adapter. In an early effort to extend the use of Apollo for further applications, NASA established the Apollo Applications Program (AAP) in August of 1965. The AAP was to include long duration Earth orbital missions during which astronauts would carry out scientific, technological, and engineering experiments in space by utilizing modified Saturn launch vehicles and the Apollo spacecraft. Established in 1970, the Skylab Program was the forerurner of the AAP. The goals of the Skylab were to enrich our scientific knowledge of the Earth, the Sun, the stars, and cosmic space; to study the effects of weightlessness on living organisms, including man; to study the effects of the processing and manufacturing of materials utilizing the absence of gravity; and to conduct Earth resource observations. The Skylab also conducted 19 selected experiments submitted by high school students. Skylab's 3 different 3-man crews spent up to 84 days in Earth orbit. The Marshall Space Flight Center (MSFC) had responsibility for developing and integrating most of the major components of the Skylab: the Orbital Workshop (OWS), Airlock Module (AM), Multiple Docking Adapter (MDA), Apollo Telescope Mount (ATM), Payload Shroud (PS), and most of the experiments. MSFC was also responsible for providing the Saturn IB launch vehicles for three Apollo spacecraft and crews and a Saturn V launch vehicle for the Skylab.

  18. Rendering HTML5 illustration

    CERN Document Server

    David, Matthew

    2010-01-01

    Scalable Vector Graphics (SVG) and CANVAS are two new tools introduced in HTML5 that you can use to add illustration and interactive animation to your Web pages. Understand why there are two different formats, how you can use them, and where they can be used today. HTML 5, is the first major update to the core language of the Web in over a decade The focus of this book is on innovations that most directly effect Web site design and multimedia integration The companion Web site features working demonstrations and tutorial media for hands-on p

  19. Book Reviews

    OpenAIRE

    Adrianus Koster; Peter Gathercole; Simon Kooijman; Roland Werner; P.E. de Josselin de Jong; John Ingleson; C.K. Jonker-de Putter; M. Jacq-Hergoualc’h; R. Hagesteijn; William Wood; B.G. Grijpstra; Robert Wessing; D.C. Geirnaert-Martin; Carl Lumholtz; P. van Emst

    1981-01-01

    - H.J.M. Claessen, David Lewis, From Maui to Cook: The discovery and settlement of the Pacific, Drawings by Walter Stackpool. Sydney: Doubleday, 1977. Bibliography. - P. van Emst, Carl Lumholtz, Among Cannibals. An account of four years travel in Australia and of camp life with the aborigines of Queensland. Firle: Caliban Books. 383 pp. Maps, illustrations and index. Reprinted from the first edition, London: John Murray. - D.C. Geirnaert-Martin, Robert Wessing, Cosmology and social behaviour ...

  20. American Illustration, 1890-1925: Romance, Adventure, & Suspense.

    Science.gov (United States)

    Larson, Judy L.

    This book explores the popularity of American illustration from the late 1800s through the 1920s. Illustrated books, periodicals, the public consumption of illustrations, and various themes of illustration are discussed. Themes include: (1) "The Smart Set"; (2) "The Masses"; (3) "The Domestic Scene"; (4) "Town and Country"; (5) "Let Me Call You…

  1. Development of the Electrical Book

    OpenAIRE

    金澤, 邦生

    2012-01-01

    This research is inventing “Electrical Book” to argue about elements required for books after “Electronic Book” appearance. Electrical Book is the book made of printed circuit board printed text and illustration work as electronic circuit. We can read it as book and use it as electronic device. Today appearance of Electronic Book is changing the concept of book. We need make new model for book as media and goods. I study book design in this university so I try tackle this subject by making El...

  2. Radiology illustrated. Chest radiology

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyung Soo [Sungkyunkwan Univ. School of Medicine, Seoul (Korea, Republic of). Dept. of Radiology; Han, Joungho [Sungkyunkwan Univ. School of Medicine, Seoul (Korea, Republic of). Dept. of Pathology; Chung, Man Pyo [Sungkyunkwan Univ. School of Medicine, Seoul (Korea, Republic of). Dept. of Medicine; Jeong, Yeon Joo [Pusan National Univ. Hospital, Busan (Korea, Republic of). Dept. of Radiology

    2014-04-01

    Pattern approach to the diagnosis of lung diseases based on CT scan appearances. Guide to quick and reliable differential diagnosis. CT-pathology correlation. Emphasis on state-of-the-art MDCT. The purpose of this atlas is to illustrate how to achieve reliable diagnoses when confronted by the different abnormalities, or ''disease patterns'', that may be visualized on CT scans of the chest. The task of pattern recognition has been greatly facilitated by the advent of multidetector CT (MDCT), and the focus of the book is very much on the role of state-of-the-art MDCT. A wide range of disease patterns and distributions are covered, with emphasis on the typical imaging characteristics of the various focal and diffuse lung diseases. In addition, clinical information relevant to differential diagnosis is provided and the underlying gross and microscopic pathology is depicted, permitting CT-pathology correlation. The entire information relevant to each disease pattern is also tabulated for ease of reference. This book will be an invaluable handy tool that will enable the reader to quickly and easily reach a diagnosis appropriate to the pattern of lung abnormality identified on CT scans.

  3. The New Russian Book

    DEFF Research Database (Denmark)

    Pristed, Birgitte Beck

    print culture to a post-Soviet book market. It delivers a profound and critical exploration of Russian visual imaginary of classic, popular, and contemporary prose. Among all the carelessly bungled covers of mass-published post-Soviet series the study identifies gems from experimental designers......This book takes up the obtrusive problem of visual representation of fiction in contemporary Russian book design. By analyzing a broad variety of book covers, the study offers an absolutely unique material that illustrates a radically changing notion of literature in the transformation of Soviet...... the fields of Russian studies, contemporary book and media history, art, design, and visual studies....

  4. Hamiltonian[k,k+1]-因子%Hamiltonian [k, k + 1]-Factor

    Institute of Scientific and Technical Information of China (English)

    蔡茂诚; 方奇志; 李延军

    2003-01-01

    A Hamiltonian [k, k + 1]-factor is a [k, k + 1]-factor containing a Hamiltonian cycle. A simple graph G of order n is n/2-critical if δ(G) ≥ n/2 but δ(G - e) < n/2 for any edge e ∈ E(G). Let k ≥ 2 be an integer and G be an n/2-critical graph with n ≥ 4k - 6 and n ≥ 7. In this paper it is proved that for any given Hamiltonian cycle C of G, G has a [k, k + 1]-factor containing C. This result is an improvement on some recent results about the existence of Hamiltonian [k, k + 1]-factor.%本文考虑n/2-临界图中Hamiltonian[k,k+1]-因子的存在性.Hamiltonian[k,k+1]-因子是指包含Hamiltonian圈的[k,k+1]-因子;给定阶数为n的简单图G,若δ(G)≥n/2而δ(G\\e)<n/2(对任意的e∈E(G)),则称G为n/2-临界图.设k为大于等于2的整数,G为n/2-临界图(其中n≥4k-6且n≥7),我们证明了对于G的任何Hamiltonian圈C,G中必存在包含C的[k,k+1]-因子.该结果改进了现有的一些有关Hamiltonian[k,k+1]-因子存在性的结果.

  5. 台灣兒童圖畫書出版產業之困境與願景:從插畫創作者之角度檢視 The Dilemma and Vision of the Children’s Picture Book Industry in Taiwan: A Perspective of Illustrators

    Directory of Open Access Journals (Sweden)

    Bin I

    2007-03-01

    Full Text Available 本研究主要針對55位台灣兒童圖畫書插畫創作者之問卷調查以及其中10位成名插畫家的訪談,調查研究台灣兒童圖畫書插畫創作者所面臨之問題。研究結果發現:台灣市場狹小導致自製圖畫書風險太高,出版社必須以進口圖畫書出版為主力,造成插畫創作舞台變小,插畫家收入無保障,自然影響創作品質,而政府徒有創意產業的口號,卻忽略重要的插畫領域,缺乏具體計畫與政策。研究對政府提出建議為:政策上整體規劃、獎勵出版社自製圖畫書開拓國際市場、民間與官方保持密切合作關係、獎勵與輔導機制提升插畫家創作品質、輔導成立插畫家團體,出版年鑑、輔導成立商業性的台灣插畫影像資料庫。對出版社的建議為:尊重插畫專業、提供合理及時的創作報酬、具備專業編輯和完整企劃、主動把關圖畫書之整體美感、提升行銷能力擴大市場。對教育單位的建議為:以積極培育優良的插畫人才。對插畫家建議為:不斷提升專業知識技能與態度,發揚個人與文化的獨特性,以及建立經紀人制度。The present research investigate the difficulties that illustrator is facing through questionnairing 55 illustrators of children’s picture book (cpb and interviewing 10 famous ones of them. The results indicate that the small market of Taiwan results in high risk of domestic publication of cpb, and the publishers turned to buy copyright from other countries. The domestic illustrators therefore had less opportunities of creation and less income. The quality of illustration could be limited because part time jobs distracted the illustrators. Recently, Taiwan government is showing high interest in “culture and creative industries but ironically ignore the very important one — illustration picture book, and has no other practical plan and policy about it. The study

  6. Book Review: Book review

    Science.gov (United States)

    Manohar, C. S.

    2015-02-01

    The subject of the theory of vibrations has carried an aesthetic appeal to generations of engineering students for its richness of ideas, and for the intellectual challenges it offers. Also, the diverse range of its applications (covering civil, mechanical, automotive, and aerospace structures) has provided obvious motivations for its study. For most students, the subject provides, perhaps, the first encounter in substantial application of mathematical tools (differential equations, calculus of variations, Fourier/Laplace transforms, and matrix algebra) to engineering problems. The intimate relationship that the subject of mechanics has with mathematics strikes home probably for the first time. While teaching this subject, the instructor is spoilt for choice in selecting a text book and so are the students who wish to pursue a self-study of the subject. Many luminaries in the field have offered their own exposition of the subject: starting from the classics of Rayleigh, Timoshenko, Den Hartog, Bishop and Johnson, and the works of more recent vintage (e.g., the books by Meirovich, Clough, and Penzien, and works with computational flavour, such as, those by Bathe and Petyt), several works easily come to one's mind. Given this milieu, it requires a distinctive conviction to write a new book on this subject. And, here we have a book, written by a practitioner, which aims to deal with fundamental aspects of vibrations of engineering systems. The scepticism that this reviewer had on the need for having one more such book vanished as he browsed through the book and read selectively a few sections. The author's gift for elegant explanations is immediately noticeable even in such a preliminary reading. After a more careful reading, the reviewer has found this book to be insightful and he considers the book to be a welcome addition to the family of books on vibration engineering. The author has struck a fine balance between physical explanations, mathematical niceties

  7. Radiology illustrated. Uroradiology. 2. ed.

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung Hyup (ed.) [Seoul National University Hospital, Seoul (Korea, Republic of). Dept. of Radiology

    2012-07-01

    Uroradiology is an up-to-date, image-oriented reference in the style of a teaching file that has been designed specifically to be of value in clinical practice. All aspects of the imaging of urologic diseases are covered, and case studies illustrate the findings obtained with the relevant imaging modalities in both common and uncommon conditions. Most chapters focus on a particular clinical problem, but normal findings, congenital anomalies, and interventions are also discussed and illustrated. In this second edition, the range and quality of the illustrations have been enhanced, and many schematic drawings have been added to help readers memorize characteristic imaging findings through pattern recognition. The accompanying text is concise and informative. Besides serving as an outstanding aid to differential diagnosis, this book will provide a user-friendly review tool for certification or recertification in radiology. (orig.)

  8. Book Review:

    Science.gov (United States)

    Truscott, J. G.

    2004-05-01

    may be faced when using the measurement techniques and a basic framework is given for the validation and quality assurance of measurement instruments. The only disappointment is the final section on animal and human studies, where the chapter on human studies is superficial and concentrates predominantly on DXA matters. Occasional use of non-SI units (c/sec rather than hertz) is surprising but my only real complaint is about the quality of reproduction of a large number of the illustrations, particularly the photographs, where the contrast is poor and the resolution at times leaves something to be desired. That said, this is an excellent and encyclopaedic book which any individual or department concerned with bone measurement, or wishing to extend their knowledge of the field, should have on their bookshelf.

  9. IEE wiring regulations explained and illustrated

    CERN Document Server

    Scaddan, Brian

    2013-01-01

    The IEE Wiring Regulations Explained and Illustrated, Second Edition discusses the recommendations of the IEE Regulations for the Electrical Equipment of Buildings for the safe selection or erection of wiring installations. The book emphasizes earthing, bonding, protection, and circuit design of electrical wirings. The text reviews the fundamental requirements for safety, earthing systems, the earth fault loop impedance, and supplementary bonding. The book also describes the different types of protection, such as protection against mechanical damage, overcurrent, under voltage (which prevents

  10. Illustrated C# 2010

    CERN Document Server

    Solis, Daniel M

    2010-01-01

    This book presents the C# 2012 language in a uniquely succinct and visual format. Often in programming books, the information can be hidden in a vast sea of words. As a programmer who has over the years used a dozen programming languages, the author understands it can sometimes be difficult to slog through another 1,000-page book of dense text to learn a new language. There are likely many other programmers who feel the same way. To address this situation, this book explains C# 2012 using figures; short, focused code samples; and clear, concise explanations. Figures are of prime importance in

  11. Examining Language of Information Books for Children

    Science.gov (United States)

    Inan, Hatice Zeynep

    2010-01-01

    In recent years, inclusion of information books in early childhood centers is well-advised since children show fast developing knowledge of information book language and enjoy reading those books. The aim of the current study is to discuss features of information books' language by examining the illustrations and texts of randomly selected 15…

  12. Book Review: Book review

    Science.gov (United States)

    van der Linden, Sebastian

    2016-05-01

    Compiling a good book on urban remote sensing is probably as hard as the research in this disciplinary field itself. Urban areas comprise various environments and show high heterogeneity in many respects, they are highly dynamic in time and space and at the same time of greatest influence on connected and even tele-connected regions due to their great economic importance. Urban remote sensing is therefore of great importance, yet as manifold as its study area: mapping urban areas (or sub-categories thereof) plays an important (and challenging) role in land use and land cover (change) monitoring; the analysis of urban green and forests is by itself a specialization of ecological remote sensing; urban climatology asks for spatially and temporally highly resolved remote sensing products; the detection of artificial objects is not only a common and important remote sensing application but also a typical benchmark for image analysis techniques, etc. Urban analyses are performed with all available spaceborne sensor types and at the same time they are one of the most relevant fields for airborne remote sensing. Several books on urban remote sensing have been published during the past 10 years, each taking a different perspective. The book Global Urban Monitoring and Assessment through Earth Observation is motivated by the objectives of the Global Urban Observation and Information Task (SB-04) in the GEOSS (Global Earth Observation System of Systems) 2012-2015 workplan (compare Chapter 2) and wants to highlight the global aspects of state-of-the-art urban remote sensing.

  13. Book Review: Book review

    Science.gov (United States)

    Wang, Christina Yan

    2017-02-01

    The world class Ni-Cu-PGE sulfide deposits associated with the Sudbury Igneous Complex (SIC) are quite unique on earth in the sense that the energy source and origin were triggered by a large meteorite impact event. The ore deposits in the SIC make up one of the largest Ni-Cu-PGE sulfide deposit camps in the world and have now been mined for over 100 years. This is the first complete reference book that focuses entirely on the SIC and covers the fields of economic geology, petrology, geochemistry and geophysics. The purpose of this book is to explore the linkage between sulfide and silicate magmas generated by the 1.85 Ga Sudbury impact event and to unite an understanding of the process of crustal melt sheet evolution with the formation of the magmatic sulfide mineralization. The author, Peter Lightfoot, has been based in Sudbury for 25 years. As a top scientist on magmatic Ni-Cu-PGE sulfide deposits and a Chief Geologist with the Brownfield Exploration group at Vale Base Metals, Peter has been positioned to develop and assemble the ideas presented in this book, which are perfectly balanced between industry and academia.

  14. Information Graphics - A Comprehensive Illustrated Reference

    Science.gov (United States)

    Harris, Robert L.

    2000-01-01

    This beautifully illustrated book is the first complete handbook to visual information. Well written, easy to use, and carefully indexed, it describes the full range of charts, graphs, maps, diagrams, and tables used daily to manage, analyze, and communicate information. It features over 3,000 illustrations, making it an ideal source for ideas on how to present information. It is an invaluable tool for anyone who writes or designs reports, whether for scientific journals, annual reports, or magazines and newspapers.

  15. Astronomy books in Spanish

    Science.gov (United States)

    Fierro, Julieta

    Great cultures have created language. They have discovered its strength among other reasons for education. For a long time the Bible was one of the few books available in western culture, its influence is beyond any doubt. Many developing nations have no science books in their mother tongue. They might carry a few translations but these do not convey the local culture so it is harder for students to grasp the concepts and to build on what they know. Books, even if they are extremely simple, should be written in local languages because that will facilitate the conveying of knowledge and the creation of scientific culture. In the books examples that pertain to every day local life must be given, in particular examples that have to do with women. Women play a central role in developing nations by child bearing; if they become literate they will influence enormously the quality of their children's education, in particular their science comprehension. In Mexico a collection that includes astronomy books has recently been edited by the National Council for Culture and Arts. The books are small and light, which encourages middle-school students to carry them around and read them while traveling in public transportation, such as the subway. Every other page is a new subject, that carries illustrations, abstracts and conclusions. The astronomy books are on search for extraterrestrial life, the stars and the universe. These books are distributed nation-wide and are inexpensive. They have been written by Mexican astronomers.

  16. Book Review: Book review

    Science.gov (United States)

    Pulte, Helmut

    In his Erkenntnisproblem, Ernst Cassirer described Heinrich Hertz (1857-1894) as the first great physicist who consequently elaborated a both hypothetical and objective concept of scientific theory, i.e. an understanding of physical theory, which combines a logical rigorous analysis of the different possibilities of conceptual foundation with a carefully thought-out renunciation of absolute truth for one of these possibilities. This judgment mainly refers to Hertz's book Die Prinzipien der Mechanik, in neuem Zusammenhange dargestellt (1894), which was the main result of his scientific research during the last 3 years of his short life.

  17. Book Review: Book review

    Science.gov (United States)

    da Costa, Newton C. A.; Krause, Décio

    This book contains a representative selection of Erhard Scheibe's writings on the philosophy of physics. It encompasses eight sections, with 38 papers, distributed as follows: (I) Between Rationalism and Empiricism (five papers from 1969 to 1994); (II) The Philosophy of the Physicists (five papers from 1988 to 1995); (III) Reconstruction (four papers, from 1979 to 1988); (IV) Laws of Nature (five papers, from 1989 to 1998); (V) Reduction (five papers from 1973 to 1995); (VI) Foundations of Quantum Mechanics (six papers from 1985 to 1993); (VII) Spacetime, Invariance, Covariance (four papers from 1982 to 1994), and (VIII) Mathematics and Physics (four papers from 1977 to 1997).

  18. Best Books for Spring 1972

    Science.gov (United States)

    Gerhardt, Lillian N.; And Others

    1972-01-01

    Titles of what are considered to be outstanding in terms of content, design or illustration as selected by the editors of School Library Journal Book Review" are presented. (47 references) (Author/NH)

  19. The Horn Book Graphic Gallery.

    Science.gov (United States)

    Horn Book Magazine, 1986

    1986-01-01

    Presents an annotated bibliography of 14 picture books with copyright dates from 1980 to 1984. David Macauley, Ed Young, and Richard Bartlett based their selections on illustration and design criteria that they most admired. (JK)

  20. Book Review: Book review

    Science.gov (United States)

    Mishchenko, Michael I.

    2017-01-01

    The second - revised and enlarged - edition of this popular monograph is co-authored by Michael Kahnert and is published as Volume 145 of the Springer Series in Optical Sciences. As in the first edition, the main emphasis is on the mathematics of electromagnetic scattering and on numerically exact computer solutions of the frequency-domain macroscopic Maxwell equations for particles with complex shapes. The book is largely centered on Green-function solution of relevant boundary value problems and the T-matrix methodology, although other techniques (the method of lines, integral equation methods, and Lippmann-Schwinger equations) are also covered. The first four chapters serve as a thorough overview of key theoretical aspects of electromagnetic scattering intelligible to readers with undergraduate training in mathematics. A separate chapter provides an instructive analysis of the Rayleigh hypothesis which is still viewed by many as a highly controversial aspect of electromagnetic scattering by nonspherical objects. Another dedicated chapter introduces basic quantities serving as optical observables in practical applications. A welcome extension of the first edition is the new chapter on group theoretical aspects of electromagnetic scattering by particles with discrete symmetries. An essential part of the book is the penultimate chapter describing in detail popular public-domain computer programs mieschka and Tsym which can be applied to a wide range of particle shapes. The final chapter provides a general overview of available literature on electromagnetic scattering by particles and gives useful reading advice.

  1. On Japanese Children's Books.

    Science.gov (United States)

    Watanare, Shigeo

    This report, given at a special meeting held in Tehran, presents data and facts concerning yearly publications (books, magazines, and textbooks), translations, and illustrations of Japanese children's literature. The report then discusses at length recent trends in children's literature and library activities for children in the past, present, and…

  2. Book Reviews 2015

    Directory of Open Access Journals (Sweden)

    Hilling Axel

    2015-12-01

    Full Text Available This section contains three book reviews. First the book Swedish Taxation, Development since 1862 is reviewed. This volume comprises six studies that examine the development of Swedish taxation from 1862 to 2013, and will likely be of great value in future Nordic tax research because of its comprehensiveness. The second review is about a book written in Swedish:Momsfri sjukvård (The VAT exemption for health care. This volume discusses a topical issue and presents convincing recommendations for changes in the Swedish VAT legislation. Finally, the Danish book International Skatteret, i et dansk perspektiv (International Tax Law, in a Danish perspective is presented as highly recommended literature for students and practitioners in the field of international tax law. This volume discusses and illustrates general matters in international tax law, as well as specific matters relevant for Danish international tax law.

  3. Accessibility Standards, Illustrated.

    Science.gov (United States)

    Jones, Michael A.

    The book sets forth Illinois environmental accessibility standards for disabled persons based on observation and interview data. Photographs, drawings, and detailed floor plans are included in sections dealing with human data (including space requirements for maneuvering wheelchairs, color blindness, incontinence, and severe auditory or visual…

  4. Accessibility Standards, Illustrated.

    Science.gov (United States)

    Jones, Michael A.

    The book sets forth Illinois environmental accessibility standards for disabled persons based on observation and interview data. Photographs, drawings, and detailed floor plans are included in sections dealing with human data (including space requirements for maneuvering wheelchairs, color blindness, incontinence, and severe auditory or visual…

  5. Newnes electronics engineers pocket book

    CERN Document Server

    Brindley, Keith

    2013-01-01

    This book is packed with information and material which everyone involved in electronics will find indispensable. Now when you need to know a transistor's characteristics, or an integrated circuit's pinout details, simply look it up! The book is full of tables, symbols, formulae, conversions and illustrations.Promotion via the new Newnes Pocket Book catalogue to the electronics trade will drive sales into the book trade Covers component data; encapsulations; pin-outs; symbols & codings Extensive material on conversion factors, formulae; units and relationships

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    Adrianus Koster

    1981-01-01

    Full Text Available - H.J.M. Claessen, David Lewis, From Maui to Cook: The discovery and settlement of the Pacific, Drawings by Walter Stackpool. Sydney: Doubleday, 1977. Bibliography. - P. van Emst, Carl Lumholtz, Among Cannibals. An account of four years travel in Australia and of camp life with the aborigines of Queensland. Firle: Caliban Books. 383 pp. Maps, illustrations and index. Reprinted from the first edition, London: John Murray. - D.C. Geirnaert-Martin, Robert Wessing, Cosmology and social behaviour in a West Javanese settlement, Papers in International Studies, Southeast Asia Series no. 47, Ohio University Center for International Studies, Southeast Asia Program, 1978, Athens, Ohio. - B.G. Grijpstra, William Wood, Cultural-ecological perspectives in Southeast Asia, edited and with an introduction by William Wood, Papers in International Studies, Southeast Asia Studies no. 41, Ohio University Center for International Studies, Southeast Asia Program, 1977, Athens, Ohio. - R. Hagesteijn, M. Jacq-Hergoualc’h, L’armement et l’organisation de l’armée khmère aux XIIe et XIIIe siècles; d’après les bas-reliefs d’Angkor Vat, du Bayon et de Bantay Chmar. Paris: Presses Universitaires de France. - C.K. Jonker-de Putter, John Ingleson, Road to exile; The Indonesian nationalist movement, 1927-1934. ASAA Southeast Asia Publications Series, No. 1. Heinemann Educational Books (Asia Ltd., Singapore, 1979. xii + 254 blz. Bibliographie, index. - P.E. de Josselin de Jong, Roland Werner, Jah-het of Malaysia: art and culture, 1975. Kuala Lumpur: Penerbit Universiti Malaya. xxxv, 626 pp., 39 figs., 2 maps, 746 plates. - P.E. de Josselin de Jong, Roland Werner, Mah-Meri of Malaysia: Art and culture, 1974. Kuala Lumpur: Penerbit Universiti Malaya. xxvi, 485 pp., 13 figs., 3 maps, 460 plates. - Simon Kooijman, Peter Gathercole, The art of the Pacific Islands. National Gallery of Art, Washington, 1979, 365 pp., 386 illustrations + 6 sketch-maps., Adrienne L

  7. The MCAT Physics Book

    CERN Document Server

    Biehle, Garrett

    2012-01-01

    Comprehensive, Rigorous Prep for MCAT Physics. The MCAT Physics Book offers the most comprehensive and rigorous analysis of MCAT physics available. Including,. Features:. * 500 MCAT-style practice problems and detailed solutions to all problems. * 49 MCAT-style passages. Illustrations and tables are included wherever necessary to focus and clarify key ideas and concepts. Dr. Biehle's classic MCAT Physics Book presents a clear, insightful analysis of MCAT physics. His lively prose and subtle wit make this challenging topic more palatable. Dr. Biehle received his Ph.D. from Caltech (California I

  8. Web designer's idea book

    CERN Document Server

    McNeil, Patrick

    2014-01-01

    Discover the latest trends in web design! Looking for inspiration for your latest web design project? Expert Patrick McNeil, author of the popular Web Designer's Idea Book series, is back with all new examples of today's best website design. Featuring more than 650 examples of the latest trends, this fourth volume of The Web Designer's Idea Book is overflowing with visual inspiration. Arranged categorically, this fully illustrated guide puts important topics like design styles, elements, themes and responsive design at your fingertips. This new volume also includes a detailed discussion o

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    J.G. Oosten

    1980-10-01

    Full Text Available - M.A. van Bakel, Frederic L. Pryor, The origins of the economy. A comparative study of distribution in primitive and peasant economies. Academic Press, New York 1977. XVIII + 475 blz. - H.J. de Graaf, W. Ph. Coolhaas, Generale missiven van Gouverneurs-Generaal en Raden aan heren XVII der Verenigde Oost-Indische Compagnie. Deel VII. 1713-1725. ‘s-Gravenhage 1979. Rijks geschiedkundige publicatiën. Grote Serie 164. - F.G.P. Jaquet, P. Sutikno, J. Bastin, Nineteenth century prints and illustrated books of Indonesia; with particular reference to the print collection of the Tropenmuseum, Amsterdam; a descriptive bibliography. Utrecht etc., Het Spectrum, 1979. XIV, 386 pp. Ills., B. Brommer (eds. - S. Kooijman, Adrienne L. Kaeppler, “Artificial curiosities” being an exposition of native manufactures collected on the three Pacific voyages of Captain James Cook, R.N. at the Bernice Pauahi Bishop Museum January 18, 1978 - August 31, 1978 on the occasion of the Bicentennial of the European discovery of the Hawaiian islands by Captain Cook - January 18, 1778. Bernice P. Bishop Museum special publication 65, Honolulu, Hawaii, 1978. - J.G. Oosten, Marcel Mauss, Seasonal variations of the Eskimo. A study in social morphology. Marcel Mauss in collaboration with Henri Beuchat. Translated, with a foreword by James J. Fox. Routledge & Kegan Paul, London, Boston and Henley 1979. - Jérôme Rousseau, W.F. Schneeberger, Contributions to the ethnology of central Northeast Borneo (parts of Kalimantan, Sarawak and Sabah. The University of Berne, Institute of Ethnology, Berne 1979. Series: Studia ethnologica Bernensia, no. 2. 143 pages. Maps, figures, plates.

  10. A Brief Illustrated Guide to Understanding Islam. Second Edition.

    Science.gov (United States)

    Ibrahim, I. A.

    This book is a brief guide to understanding Islam, intended to help individuals better understand Islamic culture, Muslims, and the Holy Quran. It consists of the following three chapters: (1) Some Evidence for the Truth of Islam; (2) Some Benefits of Islam; and (3) General Information on Islam. The book is extensively illustrated with photographs…

  11. 猜想M(2k,k+1)=3k-1+[(k-1)/2]的反例%Counter-Examples to the Conjecture M(2k, k + 1) = 3k - 1 + 「(k-1)/2」

    Institute of Scientific and Technical Information of China (English)

    游林; 王天明

    2002-01-01

    Brualdi 与Jung在[1]中研究了一类具有固定线和k的n×n矩阵上的最大跳跃数M(n,k),M(2k,k+1)=3k-1+[k-1/2]并提出猜想本文给出了这一猜想的两个反例.%The maximum jump number M(n, k) over a class of n × n matrices of zeros and ones with constant row and colunn sum k has been investigated by Brualdi and Jung in [1] where they proposed the conjecture M(2k, k + 1) = 3k - 1 + [k-1/2].In this note, we give two counter-exalnples to this conjecture.

  12. The Study of Turkish Illustrated Story Books Published Between 1974-1993, from the Viewpoint of Physical Aspects 1974-1993 Yılları Arasında Türkçe Basılmış Olan Resimli Öykü Kitaplarının Resimlendirilme ve Fiziksel Özellikleri Yönünden İncelenmesi

    Directory of Open Access Journals (Sweden)

    Havise Çakmak Güleç

    1997-03-01

    Full Text Available This research was planned and carried out to study the illustration, physical quality(size, binding; cover paper, font size and relationship between text and illustration of Turkish children's picture story book published 1974-1993 to ascertion whether there were any deficiencies. The samples used in the research were chosen from among 411 books (translated and adapted published between the years 1974-1993 and taken at random from various kindergartens, children's libraries, private collections and bookshops. The books chosen were studied and recorded on a specially prepared "Book Form" which includes name of book, name of the author and the illustrator, publishing place and publishing year, binding, quality of cover, size, quality of paper, illustration and colouring, relationship between text and illustration and style of illustration. Then, tables were prepared to study the distributions and position of the illustration and physical features of the books. Tables were analyzed by using the Khi-Square (X2 statistical test. The findings showed that there was generally an inadequacy in the binding quality of cover, paper and colouring. But the size, illustration, position of illustration, relationship between text and illustration were found edaquate. Bu araştırma, 1974-1993 yılları arasında Türkçe basılmış resimli öykü kitaplarını resimlendirme, fiziksel özellikleri (büyüklük, ciltleme, kapak, kağıt, punto, metin ve resim ilişkisi yönünden incelemek ve bu konularda olduğu düşünülen yetersizlikleri ortaya koymak amacıyla planlanmış ve uygulanmıştır. Araştırmanın örneklemini 1974-1993 yılları arasında Türkçe basılmış olan ve rastgele tekniğiyle seçilmiş kitapçılarda, çocuk kütüphanelerinde, anaokullarında ve özel koleksiyonlarda bulunan 411 (çeviri ve adapte dahil resimli öykü kitabı oluşturmuştur. Örneklemi oluşturan kitaplar, araştırmacı tarafından hazırlanan ve içinde her

  13. Illustrative EDOF topics in Fourier optics

    Science.gov (United States)

    George, Nicholas; Chen, Xi; Chi, Wanli

    2011-10-01

    In this talk we present a series of illustrative topics in Fourier Optics that are proving valuable in the design of EDOF camera systems. They are at the level of final examination problems that have been made solvable by a student or professoi having studied from one of Joseph W. Goodman's books---our tribute for his 75fr year. As time permits, four illustrative topics are l) Electromagnetic waves and Fourier optics;2) The perfect lens; 3) Connection between phase delay and radially varying focal length in an asphere and 4) tailored EDOF designs.

  14. A Study of Mathematical Content Provided in Illustrated Children's Books

    Science.gov (United States)

    Yilmaz Genc, Melek Merve; Akinci Cosgun, Aysegul; Pala, Sengul

    2017-01-01

    Purpose: Early childhood is of critical importance in terms of cognitive, affective and physical development. Undoubtedly, a substantially stimulating environment and opportunities offered to children, as well as appropriate educational materials, have an impact on their development. The object of this study is to investigate the mathematical…

  15. Book Review on the Illustrated Seeds of Chinese Medicinal Plants

    Institute of Scientific and Technical Information of China (English)

    Guo QS; Wang QY; Liu L; HE Shan-an

    2010-01-01

    @@ Medicinal plants are important source for Oriental and Western medicines. There are more than 500 herbs commonly used today in China, in which near 30% of them are seed medicines and over 65% are propagated from seed.

  16. P4k-1-factorization of complete bipartite graphs

    Institute of Scientific and Technical Information of China (English)

    DU; Beiliang; WANG; Jian

    2005-01-01

    Let Km,n be a complete bipartite graph with two partite sets having m and n vertices, respectively. A Pv-factorization of Km,n is a set of edge-disjoint Pv-factors of Km,n which partition the set of edges of Km,n. When v is an even number,Wang and Ushio gave a necessary and sufficient condition for the existence of Pv-factorization of Km,n. When v is an odd number, Ushio in 1993 proposed a conjecture. However, up to now we only know that Ushio Conjecture is true for v=3. In this paper wewill show that Ushio Conjecture is true when v=4k-1. That is, we shall prove that a necessary and sufficient condition for the existence of a P4k-1-factorization of Km,n is (1) (2k-1)m≤2kn, (2) (2k-1)n ≤2km, (3) m+n ≡0 (mod 4k-1), (4) (4k-1)mn/[2(2k-1)(m+n)] is an integer.integer.

  17. The K-1 Active Dispenser for Orbit Transfer

    Science.gov (United States)

    Lai, G.; Cochran, D.; Curtis, R.

    2002-01-01

    Kistler Aerospace Corporation is building the K-1, the world's first fully reusable launch vehicle. The two-stage K- 1 is designed primarily to service the market for low-earth orbit (LEO) missions, due to Kistler's need to recover both stages. For customers requiring payload delivery to high-energy orbits, Kistler can outfit the payload with a K- 1 Active Dispenser (an expendable third stage). The K-1 second stage will deploy the Active Dispenser mated with its payload into a 200 km circular LEO parking orbit. From this orbit, the Active Dispenser would use its own propulsion to place its payload into the final desired drop-off orbit or earth-escape trajectory. This approach allows Kistler to combine the low-cost launch services offered by the reusable two-stage K-1 with the versatility of a restartable, expendable upper stage. Enhanced with an Active Dispenser, the K-1 will be capable of delivering 1,500 kg to a geosynchronous transfer orbit or up to approximately 1,000 kg into a Mars rendezvous trajectory. The list price of a K-1 Active Dispenser launch is 25 million (plus the price of mission unique integration services) significantly less than the price of any launch vehicle service in the world with comparable capability.

  18. Book Bonding.

    Science.gov (United States)

    Elleman, Barbara

    1998-01-01

    Discusses nine books (fiction, nonfiction, and poetry) for children that center on bats. Focuses on one book ("Silverwing") as an example of the animal fantasy genre, which can tell the adventures of a particular animal, impart environmental knowledge and concerns, and include intriguing, solid facts about the animal in question. Offers…

  19. Professional Books.

    Science.gov (United States)

    Gilstrap, Robert L.

    1994-01-01

    Reviews five books: "Garbage Pizza, Patchwork Quilts and Math Magic" (Ohanian), about elementary math instruction; "Ready for What?" (Graue), on school readiness; "The Braid of Literature: Children's Worlds of Reading" (Wolf and Heath); "The Best Years of Their Lives" (Zvirin), a book of resources for teenagers; and "Teaching and Learning in the…

  20. Book Reviews.

    Science.gov (United States)

    Powicke, J. C.; And Others

    1986-01-01

    Reviews of 10 recent books and one new journal ("Catalyst: A Journal of Policy Debate") are provided. Topics of the books reviewed include: economics in modern Britain, world economics, the mixed economy, Milton Friedman's thought, British industry, economic issues, and London as a financial center. (JDH)

  1. Illustration of Saturn's Rings

    Science.gov (United States)

    2001-01-01

    This illustration shows a close-up of Saturn's rings. These rings are thought to have formed from material that was unable to form into a Moon because of tidal forces from Saturn, or from a Moon that was broken up by Saturn's tidal forces.

  2. Ares I concept illustration

    Science.gov (United States)

    2008-01-01

    Shown is an illustration of the Ares I concept. The first stage will be a single, five-segment solid rocket booster derived from the space shuttle programs reusable solid rocket motor. The first stage is managed by NASA's Marshall Space Flight Center in Huntsville, Alabama for NASA's Constellation program.

  3. Becoming a Voice: A Conversation with George Littlechild, Illustrator.

    Science.gov (United States)

    Mendoza, Jean

    2001-01-01

    Presents an interview with George Littlechild, a Canadian Plains Cree artist, writer and illustrator who has created nearly 500 paintings that have been exhibited on several continents. Discusses his autobiographical "This Land is My Land" which is illustrated with his paintings and which won the Jane Addams Picture Book Award. (SG)

  4. Becoming a Voice: A Conversation with George Littlechild, Illustrator.

    Science.gov (United States)

    Mendoza, Jean

    2001-01-01

    Presents an interview with George Littlechild, a Canadian Plains Cree artist, writer and illustrator who has created nearly 500 paintings that have been exhibited on several continents. Discusses his autobiographical "This Land is My Land" which is illustrated with his paintings and which won the Jane Addams Picture Book Award. (SG)

  5. K1 Group of Finite Dimensional Path Algebra

    Institute of Scientific and Technical Information of China (English)

    Xue Jun GUO; Li Bin LI

    2001-01-01

    In this paper, by calculating the commutator subgroup of the unit group of finite pathalgebra κ/△ and the unit group abelianized, we explicitly characterize the K1 group of finite dimensionalpath algebra over an arbitrary field.

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    Ger P. Reesink

    1995-07-01

    Full Text Available - Rogier Busser, Peter Post, Japanse bedrijvigheid in Indonesië, 1868-1942; Structurele elementen van Japan’s vooroorlogse economische expansie in Zuidoost Azië. Proefschrift Vrije Universiteit, Amsterdam, 1991, xviii + 374 pp. - H.J.M. Claessen, Arne Aleksej Perminow, The long way home; Dilemmas of everyday life in a Tongan village. Oslo: Scandinavian University Press, 1993, 166 pp. - Aone van Engelenhoven, René van den Berg, Studies in Sulawesi linguistics III. Jakarta: Badan Penyelenggara Seri Nusa, Universitas Katolik Indonesia Atma Jaya, 1994, xii + 116 pp. [NUSA, Linguistic Studies of Indonesian and Other Languages in Indonesia 36.] - Will Derks, Wolfgang Marschall, Texts from the Islands; Oral and written traditions of Indonesia and the Malay world, (Procedings of the 7th European Colloquium on Indonesia and Malay Studies, Berne, June 1989 1994, iii + 411 pp. [Ethnologica Bernensia 4]. - Michael Kaden, Krishna Sen, Indonesian Cinema; Framing the New Order, London: Zed Books, 1994, x + 188 pp. - Nico Kaptein, Mona Abaza, Indonesian Students in Cairo; Islamic education perceptions and exchanges, Paris: Association Archipel, 1994, 198 pp. [Cahier d’Archipel 23.] - P. Keppy, Chris Manning, Indonesia assessment 1993; Labour: Sharing in the benefits of growth? Canberra: Australian National University, 1993, xxi + 326 pp., Joan Hardjono (eds. - Anke Niehof, Jan-Paul Dirkse, Development and social welfare; Indonesia’s experiences under the New Order, Leiden: KITLV Press, 1993, xi + 295 pp., Frans Hüsken, Mario Rutten (eds. - Hetty Nooy-Palm, Michale C. Howard, Textiles of Southeast Asia; An annotated and illustrated bibliography. Bangkok: White Lotus, 1994, 212 pp. + 64 pp. pf photographs in colour. - Harry A. Poeze, Hans van Miert, Een koel hoofd en een warm hart; Nationalisme, Javanisme en jeugdbeweging in Nederlands-Indië, 1918-1930. Amsterdam: De Bataafsche Leeuw, 1995, 424 pp. - Ger P. Reesink, Jürg Wassmann, Historical atlas of

  7. Book Reviews

    Directory of Open Access Journals (Sweden)

    F.L. van Holthoon

    1970-01-01

    Full Text Available - Yvan Simonis, Bertel Nathhorst, Formal or structural studies of traditional tales. The usefulness of some methodological proposals advanced by Vladimir Propp, Alan Dundes, Claude Levi-Strauss and Edmund Leach. Acta Universitatis Stockholmiensis, Stockhlom Studies in Comparative Religion, 9 - Stockholm 1969. 80 p. bibliogr., index. - A.J.F. Köbben, G.P. Murdock, Ethnographic atlas. University of Pittsburgh Press, 1967. 128 pp. - J. Blauw, Banton Michael, Anthropological approaches to the study of religion. Tavistock Publications, London, 1966. XZII en 176p. - C. Baks, J.F. Boissevain, Netwerken en quasi-groepen; enkele beschouwingen over de plaats van de Niet-Groepen in de Sociale Wettenschappen. Oratie. Van Gorcum & Comp., Assen 1968. 44 pp. - C.J. Lammers, Tom Burns, Industrial man. Penguin Modern Sociology Readings. Harmondsworth, Middlesex: Penguin Books Ltd. 1969. 414 pp. - P. van Daalen, M.M. Albinski, Maatschappelijke behoefte aan sociologen. Rede Katholieke Universiteit te Nijmegen. Van Gorcum, Assen 1969. 37 blz. - W. Brand, Louise B. Young, Population in perspective. Oxford University Press, New York/London/Toronto, 1968. 460 blz. - J.H.B. den Ouden, C. Baks, Afschaffing van Pacht. Een onderzoek naar de sociale gevolgen van de afschaffing van pacht in twee dorpen van Zuid-Gujerat, India. Publikatie no. 13. Afdeling Zuid- en Zuidoost-Azië. Antropologisch-Sociologisch Centrum. Universiteit van Amsterdam. 1969. 228 pp. - Mohan K. Gautam, William H. Newell, A study of Gaddi scheduled tribe - and affiliated castes. Census of India 1961. Vol. XX, Part V-B. Himachal Pradesh. Report on scheduled castes and scheduled tribes. Government of India Press, Simla. 1967. I-IV plus 104 pp. with 14 black and white illustrations, appendices and bibliography. - P.J. van Winter, Monica Wilson, The Oxford history of South Africa. Vol. I, South Africa to 1870. Clarendon Press, Oxford 1969. XXXIII, 502 p., Leonard Thompson (eds. - Jan Knappert, Hasani bin

  8. Book Review:

    Science.gov (United States)

    Wainwright, John

    2007-04-01

    The present volume is an introduction to general relativity and cosmology, at a level suitable for beginning graduate students or advanced undergraduates. The book consists of two main parts, the first entitled `Elements of differential geometry', and the second `The theory of gravitation'. Chapters 2-7, part I, introduce the basic ideas of differential geometry in a general setting, and are based on previously unpublished notes by one of the authors. On the one hand, the treatment is modern in that it uses a `top-down' approach, i.e. starting with general differentiable manifolds, and deferring the introduction of a metric tensor until after the notions of affine connection and curvature have been introduced. On the other hand, the treatment is classical in that it relies heavily, though not exclusively, on index notation. The general material, chapters 1-7, is then followed by four more specialized chapters dealing with matters of specific interest for general relativity. Topics include symmetry groups acting on Riemannian manifolds, with spherically symmetric spacetimes and spatially homogeneous spacetimes as examples, the efficient calculation of curvature, and the Petrov classification of the Weyl curvature tensor using spinors. Part II deals with general relativity and cosmology. The basic assumptions of the theory and its application to spherically symmetric gravitational fields are discussed in two chapters, and there is some historical material and motivation for the basic assumptions at the beginning of the book. The final chapter contains a detailed discussion of the Kerr solution. But the main emphasis in part II is on relativistic cosmology, in particular the analysis of cosmological models more general than the familiar Friedmann-Lemaitre (FL) models. The material on cosmology begins with a discussion of relativistic hydrodynamics and thermodynamics. The kinematical quantities (rate of expansion, shear, etc, of a timelike congruence) are introduced

  9. The Scientist as Illustrator.

    Science.gov (United States)

    Iwasa, Janet H

    2016-04-01

    Proficiency in art and illustration was once considered an essential skill for biologists, because text alone often could not suffice to describe observations of biological systems. With modern imaging technology, it is no longer necessary to illustrate what we can see by eye. However, in molecular and cellular biology, our understanding of biological processes is dependent on our ability to synthesize diverse data to generate a hypothesis. Creating visual models of these hypotheses is important for generating new ideas and for communicating to our peers and to the public. Here, I discuss the benefits of creating visual models in molecular and cellular biology and consider steps to enable researchers to become more effective visual communicators.

  10. Table des illustrations

    OpenAIRE

    2017-01-01

    Illustration de couverture : Dolmen n° 2 des Géandes avec le Mont Ventoux en arrière-plan, octobre 2006 (cliché Wolfgang Pape). Illustration de la quatrième de couverture : René Gilles sur le dolmen n° 5 des Géandes en mars 1989 (cliché Wolfgang Pape). Fig. 1 - Gorges de l’Ardèche au niveau de la grotte de Saint-Marcel (cliché Bernard Gély) 21 Fig. 2 - Doline de Bidon (cliché Wolfgang Pape) 21 Fig. 3 - Paysage de garrigue (cliché Wolfgang Pape) 22 Fig. 4 - Données radio-chronométriques de l’A...

  11. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    4th Dalai Lama Yundain GyamcoAuthored by 5th Dalai Lama and translated by Chen Qingying and Ma Lianlong, the book tells the life of the 4th Dalai Lama who was the only non-Tibetan among the various generations of the Dalai Lama.As he was the first reincarnated Mongolian Living Buddha of the Gelug Sect, he held an important position in the history of the Gelug Sect. His period was a period filled with social changes, and little historical materials are found to cover his period. Publication of the book, published by the Tapei All Buddhist Cultural Undertakings Co. Ltd., is obviously a must-read book.

  12. CONTEMPORARY AGROBOTANICAL ILLUSTRATION

    Directory of Open Access Journals (Sweden)

    Tsatsenko L. V.

    2016-01-01

    Full Text Available The article discusses the contemporary agrobotanical illustration, as an integral part of scientific and educational work. For the analysis of the issue, we set up the basis of illustrative images, which acted as the test material. It has been shown that visual images serve as the material for the development of visual thinking students are taught to read information, which represents the worksheet, to think and to create something new. The article considers art of graphics pencil using a computer-drawing program with processing in Photoshop. There are mixed techniques (mixed media, based on the use of traditional drawing and herbarium specimen, processed in Photoshop in the color. Another new direction of contemporary agroillustration is infographics. Its using in educational and scientific process is determined by the fact that infographics involves analytical processing of quantitative data obtained during the experiment. On the other hand, the data is needed to visualize, execute and present. A new direction in contemporary agro-botanical illustration is plant images taken with X-rays. The modern level of requirements to create images is high enough and it must be taken into account when carrying out scientific experiments, when it is necessary to demonstrate the object of research results. Modern agroillustration can be processed using various systems of artificial intelligence, pattern recognition, for example, the system named “Edos”

  13. Adsorbed Water Illustration

    Science.gov (United States)

    2008-01-01

    The Thermal and Electrical Conductivity Probe on NASA's Phoenix Mars Lander detected small and variable amounts of water in the Martian soil. In this schematic illustration, water molecules are represented in red and white; soil minerals are represented in green and blue. The water, neither liquid, vapor, nor solid, adheres in very thin films of molecules to the surfaces of soil minerals. The left half illustrates an interpretation of less water being adsorbed onto the soil-particle surface during a period when the tilt, or obliquity, of Mars' rotation axis is small, as it is in the present. The right half illustrates a thicker film of water during a time when the obliquity is greater, as it is during cycles on time scales of hundreds of thousands of years. As the humidity of the atmosphere increases, more water accumulates on mineral surfaces. Thicker films behave increasingly like liquid water. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  14. Book Review:

    Science.gov (United States)

    Gregory, Ruth

    2007-06-01

    The study of braneworlds has been an area of intense activity over the past decade, with thousands of papers being written, and many important technical advances being made. This book focuses on a particular aspect of braneworlds, namely perturbative gravity in one specific model: the Randall-Sundrum model. The book starts with an overview of the Randall-Sundrum model, discussing anti-de Sitter (AdS) space and the Israel equations in some detail. It then moves on to discuss cosmological branes, focusing on branes with constant curvature. The book then turns to brane gravity, i.e. what do we, as brane observers, perceive the gravitational interaction to be on the brane as derived from the actual five-dimensional gravitational physics? After a derivation of the general brane equations from the Israel equations, the remainder of the book deals with perturbative gravity. This part of the book is extremely detailed, with calculations given explicitly. Overall, the book is quite pedagogical in style, with the aim being to explain in detail the topics it chooses to cover. While it is not unusual to have books written on current and extremely popular research areas, it is unusual to have calculations written so explicitly. This is both a strength and a weakness of this book. It is a strength because the calculations are presented in a detail that students learning the topic will definitely appreciate; however, the narrow focus of the book also means that it lacks perspective and fails to present the broader context. In choosing to focus on one particular aspect of Randall-Sundrum branes, the book has not managed to communicate why a large number of theorists have worked so intensively on this model. In its early stages, the explicit detail of the Randall-Sundrum model would be extremely useful for a student starting out in this research area. In addition, the calculational detail later in the computation of the graviton propagator on the brane would also be welcome not

  15. Il teatro classico e rinascimentale nelle cinquecentine illustrate custodite in Sardegna

    Directory of Open Access Journals (Sweden)

    Barbara Cadeddu

    2016-06-01

    Keywords: University Library of Cagliari, University Library of Sassari, incunabulum illustrated, book illustrated from the 1500s, woodcuts, brothers Sabbio, brothers Dal Gesù, Lazzaro Soardi, Ioannes Roigny, Plautus, Terence, Bernardo Dovizi, Bibbiena, Calandra, Zoan Andrea

  16. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2012-01-01

    Full Text Available The second edition of Computational Physics by Rubin Landau, Manuel Paez and Cristian C. Bordeianu (published by Wiley hit bookshelves in 2007, and is steadily making its way into physics classrooms across the United States. Your reviewer first encountered the book at the Stanford Campus Book Store, where it is presumably being put to good use by students and faculty. The first edition was published in 1997 with Landau and Paez as authors [Computational Physics, 1st edn, Wiley, New York, 1997]. Rubin Landau is a very experienced computational physicist and staff member of the Oregon State University in Corvallis, where he directs the Computational Physics for Undergraduates course and teaches using this book. Landau is an incredibly active teacher to put it mildly – the code for the book is supplied in an accompanying DVD and he also posts applets and video lectures for his courses on his web page (http://www.physics.orst.edu/~rubin/.

  17. Nightmare book

    Science.gov (United States)

    judithku; jajustin; tyler, d.

    2017-02-01

    In response to Kate Brown's review of Kate Moore's book The Radium Girls, which tells the depressing but important tale of female radium-dial painters in the early 1900s who contracted radiation poisoning.

  18. Book review

    African Journals Online (AJOL)

    questions enabling readers to consider how their organisation embodies each model. The ... discussed in detail and has more examples than other models in this book. ... theories and causes of organisational change and the second outlining ...

  19. Orange Book

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Approved Drug Products with Therapeutic Equivalence (Orange Book or OB) is a list of drugs approved under Section 505 of the Federal Food, Drug and Cosmetic Act...

  20. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang Liwei-China's First Astronaut; and Chronology of the First Manned Space Flight. The book is appended with Memorabilia of China'...

  1. Lunar Module Illustration

    Science.gov (United States)

    1969-01-01

    This concept is a cutaway illustration of the Lunar Module (LM) with detailed callouts. The LM was a two part spacecraft. Its lower or descent stage had the landing gear, engines, and fuel needed for the landing. When the LM blasted off the Moon, the descent stage served as the launching pad for its companion ascent stage, which was also home for the two astronauts on the surface of the Moon. The LM was full of gear with which to communicate, navigate, and rendezvous. It also had its own propulsion system, and an engine to lift it off the Moon and send it on a course toward the orbiting Command Module.

  2. Multi-satellite ocean tide modelling - the K-1 constituent

    DEFF Research Database (Denmark)

    Andersen, Ole Baltazar; Knudsen, Per

    1997-01-01

    All major ocean tide constituents are aliased into signals with periods less than 90 days from TOPEX/POSEIDON altimetry, except the K-1 constituent. The aliased K-1 has a period of 173 days. Consequently, it might be confounded with height variations caused by the semiannual cycle having a period......, where the presence of crossing tracks cannot separate K-1 from the semiannual signal from TOPEX/POSEIDON, the importance of including ERS-1 and GEOSAT observations was demonstrated. A comparison with 29 pelagic and coastal tide gauges in the Southern Ocean south of 50 degrees S gave 5.59 (M-2), 2.27 (S......-2) and 5.04 (K-1) cm RMS agreement for FES95.1 ocean tide model. The same comparison for the best empirical estimated constituents based on TOPEX/POSEIDON + ERS-1 + GEOSAT gave 4.32, 2.21, and 4.29 cm for M-2, S-2 and K-1, respectively....

  3. Development of organometallic S6K1 inhibitors.

    Science.gov (United States)

    Qin, Jie; Rajaratnam, Rajathees; Feng, Li; Salami, Jemilat; Barber-Rotenberg, Julie S; Domsic, John; Reyes-Uribe, Patricia; Liu, Haiying; Dang, Weiwei; Berger, Shelley L; Villanueva, Jessie; Meggers, Eric; Marmorstein, Ronen

    2015-01-08

    Aberrant activation of S6 kinase 1 (S6K1) is found in many diseases, including diabetes, aging, and cancer. We developed ATP competitive organometallic kinase inhibitors, EM5 and FL772, which are inspired by the structure of the pan-kinase inhibitor staurosporine, to specifically inhibit S6K1 using a strategy previously used to target other kinases. Biochemical data demonstrate that EM5 and FL772 inhibit the kinase with IC50 value in the low nanomolar range at 100 μM ATP and that the more potent FL772 compound has a greater than 100-fold specificity over S6K2. The crystal structures of S6K1 bound to staurosporine, EM5, and FL772 reveal that the EM5 and FL772 inhibitors bind in the ATP binding pocket and make S6K1-specific contacts, resulting in changes to the p-loop, αC helix, and αD helix when compared to the staurosporine-bound structure. Cellular data reveal that FL772 is able to inhibit S6K phosphorylation in yeast cells. Together, these studies demonstrate that potent, selective, and cell permeable S6K1 inhibitors can be prepared and provide a scaffold for future development of S6K inhibitors with possible therapeutic applications.

  4. The care of fine books

    CERN Document Server

    Greenfield, Jane; Basbanes, Nicholas A

    2014-01-01

    The Care of Fine Books is a thorough, readable guide to caring for books of value. From a discussion of the various techniques and materials used in bookbinding to advice on handling and storage, Jane Greenfield has created a succinct yet complete resource for anyone who wants to preserve and protect their fine books. Whether you are a collector, a librarian, or a conservation professional, you will benefit from this expert advice. Learn about appropriate levels of light, temperature, relative humidity, and pollution; how to secure a collection against fire, insect infestation, flood, and theft; and methods for cleaning and repairing books that have already been damaged. Always practical and amply illustrated, this is a must-have reference for anyone who loves fine books.

  5. BOOK MANAGER'S CHOICE BOOKS RECEIVED

    African Journals Online (AJOL)

    ... of higher cerebral functions like language, memory and problem solving. ... hormonal responses to exercise and the impact of these responses on different ... text to sports medicine. This book is not ... and classical music. He was widely read ...

  6. Electronic book – paperless book

    Directory of Open Access Journals (Sweden)

    Mateja Ločniškar-Fidler

    2003-01-01

    Full Text Available The article presents the electronic book, which is accessible on the Internet, with particularities and drawbacks that the present and future users and librarians may encounter.It also presents devices (such as scanners and hand-helds and software required for reading and designing electronic books, as well as the details we should pay attention to when buying and using the above mentioned devices. Some of the most significant web pages dedicated to the selling and promoting of electronic books are also presented. The protection of authors’ works, distributed via the Internet and digital media, is gaining importance. In September 1999, Slovenia also joined the international agreement on the protection of copyrights. It is expected that electronic books will gradually become part of the collection of all types of libraries. Therefore, libraries will need appropriate technical equipment as well as trained personnel for the usage of this new medium.

  7. Intestinal scavenger receptors are involved in vitamin K1 absorption.

    Science.gov (United States)

    Goncalves, Aurélie; Margier, Marielle; Roi, Stéphanie; Collet, Xavier; Niot, Isabelle; Goupy, Pascale; Caris-Veyrat, Catherine; Reboul, Emmanuelle

    2014-10-31

    Vitamin K1 (phylloquinone) intestinal absorption is thought to be mediated by a carrier protein that still remains to be identified. Apical transport of vitamin K1 was examined using Caco-2 TC-7 cell monolayers as a model of human intestinal epithelium and in transfected HEK cells. Phylloquinone uptake was then measured ex vivo using mouse intestinal explants. Finally, vitamin K1 absorption was compared between wild-type mice and mice overexpressing scavenger receptor class B type I (SR-BI) in the intestine and mice deficient in cluster determinant 36 (CD36). Phylloquinone uptake by Caco-2 cells was saturable and was significantly impaired by co-incubation with α-tocopherol (and vice versa). Anti-human SR-BI antibodies and BLT1 (a chemical inhibitor of lipid transport via SR-BI) blocked up to 85% of vitamin K1 uptake. BLT1 also decreased phylloquinone apical efflux by ∼80%. Transfection of HEK cells with SR-BI and CD36 significantly enhanced vitamin K1 uptake, which was subsequently decreased by the addition of BLT1 or sulfo-N-succinimidyl oleate (CD36 inhibitor), respectively. Similar results were obtained in mouse intestinal explants. In vivo, the phylloquinone postprandial response was significantly higher, and the proximal intestine mucosa phylloquinone content 4 h after gavage was increased in mice overexpressing SR-BI compared with controls. Phylloquinone postprandial response was also significantly increased in CD36-deficient mice compared with wild-type mice, but their vitamin K1 intestinal content remained unchanged. Overall, the present data demonstrate for the first time that intestinal scavenger receptors participate in the absorption of dietary phylloquinone.

  8. Intestinal Scavenger Receptors Are Involved in Vitamin K1 Absorption*

    Science.gov (United States)

    Goncalves, Aurélie; Margier, Marielle; Roi, Stéphanie; Collet, Xavier; Niot, Isabelle; Goupy, Pascale; Caris-Veyrat, Catherine; Reboul, Emmanuelle

    2014-01-01

    Vitamin K1 (phylloquinone) intestinal absorption is thought to be mediated by a carrier protein that still remains to be identified. Apical transport of vitamin K1 was examined using Caco-2 TC-7 cell monolayers as a model of human intestinal epithelium and in transfected HEK cells. Phylloquinone uptake was then measured ex vivo using mouse intestinal explants. Finally, vitamin K1 absorption was compared between wild-type mice and mice overexpressing scavenger receptor class B type I (SR-BI) in the intestine and mice deficient in cluster determinant 36 (CD36). Phylloquinone uptake by Caco-2 cells was saturable and was significantly impaired by co-incubation with α-tocopherol (and vice versa). Anti-human SR-BI antibodies and BLT1 (a chemical inhibitor of lipid transport via SR-BI) blocked up to 85% of vitamin K1 uptake. BLT1 also decreased phylloquinone apical efflux by ∼80%. Transfection of HEK cells with SR-BI and CD36 significantly enhanced vitamin K1 uptake, which was subsequently decreased by the addition of BLT1 or sulfo-N-succinimidyl oleate (CD36 inhibitor), respectively. Similar results were obtained in mouse intestinal explants. In vivo, the phylloquinone postprandial response was significantly higher, and the proximal intestine mucosa phylloquinone content 4 h after gavage was increased in mice overexpressing SR-BI compared with controls. Phylloquinone postprandial response was also significantly increased in CD36-deficient mice compared with wild-type mice, but their vitamin K1 intestinal content remained unchanged. Overall, the present data demonstrate for the first time that intestinal scavenger receptors participate in the absorption of dietary phylloquinone. PMID:25228690

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    Brian Swann

    1983-10-01

    Full Text Available - G.J. Abbink, J.M. Schoffeleers, Missie en Ontwikkeling in Oost-Afrika. Een ontmoeting van culturen, Nijmegen-Baarn: Katholiek Studiecentrum - Ambo, 1983, 167 pp., H. Obdeijn (eds. - Gary Brana-Shute, Barry B. Levine, Benjy Lopez: A picaresque tale of emigration and return. Basic Books, 1980. 240 pages, bibliography, no index. - Victoria M. Clara van Groenendael, Günter Spitzing, Das indonesische Schattenspiel Bali - Java - Lombok, Köln: Dumont, 1981, 236 pages, photographs, illustrations, map, tables, glossary, bibliography, index. Dumont-Taschenbücher 110. - Dirk van Dusseldorp, B. Galjart, Participation of the poor in development. Contributions to a seminar. 325 pp. Leiden development studies 2, Institute of cultural and social studies, University of Leiden, Leiden 1982., D. Buys (eds. - C. van Dijk, R. de Bruin, Islam en nationalisme in door Japan bezet Indonesië: 1942-1945, ‘s-Gravenhage: Staatsuitgeverij, 1982. Rijksinstituut voor Oorlogsdocumentatie, Cahiers over Nederland en de Tweede Wereldoorlog, nr. 3. - R. Hagesteijn, H.B. Sarkar, Literary heritage of Southeast Asia. Calcutta, Firma KLM Private Limited, 265 pages. - M. Hekker, S. Price, Afro-American arts of the Suriname rain forest. University of California Press, Berkeley/Los Angelos/London, 1981. 237 pp. Maps, Ill., R. Price (eds. - M. Hekker, S.R. Siregar, Adat, Islam and Christianity in a Batak Homeland. Athens, Ohio 1981. Papers in International studies, Southeast Asia series no. 57, Ohio University. 108 pp. - P.E. de Josselin de Jong, Wazir-Jahan Begum Karim, Ma’ Betisék concepts of living things, 1981. New Jersey: Athlone Press. London school of economics monographs on social anthropology no. 54. xv, 270 pp., 3 maps, 6 figs., 11 tables. - Peter Kloos, Paul Alexander, Sri Lanka Fishermen. Rural capitalism and peasant society. Canberra, Australian National University Monographs no. 7, 1982, 328 pp. - Peter Kloos, James Brow, Vedda villages of Anuradhapura. The

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    Danker H. Schaareman

    1980-01-01

    Full Text Available - H.J.M. Claessen, Jan van Bremen, Symposion. Tijdschrift voor Maatschappijwetenschap. Onder redactie van Jan van Bremen, Cees Cruson, Helle Snel, Jojada Verrips, Willem Wolters en Ton Zwaan. Uitgave: Stichting voor Maatschappijwetenschappelijk Onderzoek., Cees Cruson, Helle Snel (eds. - H.J.M. Claessen, Neil Lifuka, Logs in the current of the sea. Neil Lifuka’s story of Kioa and the Vaitupu colonists. Edited and introduced by Klaus-Friedrich Koch. With a foreword by Professor H.E. Maude. Cambridge, Mass.: Langdon Associates Press. 1978. - H.J.M. Claessen, R.R. Nayacakalou, Leadership in Fiji. 1975. Melbourne etc.: Oxford University Press. 170 pp. Appendices, tables, notes. - H.J.M. Claessen, Michael W. Young, The ethnography of Malinowski; The Trobriand Islands 1915-1918. London: Routledge and Kegan Paul, 1979. Bibliography, Index, illustrations. - P.E. de Josselin de Jong, G.B. Milner, Natural symbols in South East Asia. School of Oriental and African Studies, London 1978. 181 p., 13 plates. - P. Kloos, G.N. Appell, Ethical dilemmas in anthropological inquiry: A case book, Waltham (Mass., Crossroads Press, 1978, xii + 291 pp. - David S. Moyer, M.B. Hooker, A concise legal history of South-East Asia. Oxford: Clarendon Press, 1978. 289 pp. - J.G. Oosten, Henri J.M. Claessen, The early state. Mouton Publishers. The Hague, The Netherlands 1978. XII + 690 pages., P. Skalník (eds. - J.G. Oosten, Jean Poirier, Ethnologie Régionale 2. Asie-Amérique-Mascareignes. Sous la direction de Jean Poirier. Encyclopédie de la Pleiade. Gallimard, Paris 1978. - J.G. Oosten, A. de Ruyter, Een speurtocht naar het denken. Een inleiding tot het structuralisme van Claude Lévi Strauss. Van Gorcum & Comp. N.V., Assen 1979. Serie: Terreinverkenningen in de Culturele Anthropologie, nr. 16. - Anton Ploeg, Raymond C. Kelly, Etoro Social Structure. A study in structural contradiction. Foreword by Marshall Sahlins. The University of Michigan Press. Ann Arbor, 1974, 1977

  11. Radiology illustrated. Pediatric radiology

    Energy Technology Data Exchange (ETDEWEB)

    Kim, In-One (ed.) [Seoul National Univ. College of Medicine (Korea, Republic of). Dept. of Radiology

    2014-11-01

    Depicts characteristic imaging findings of common and uncommon diseases in the pediatric age group. Will serve as an ideal diagnostic reference in daily practice. Offers an excellent teaching aid, with numerous high-quality illustrations. This case-based atlas presents images depicting the findings typically observed when imaging a variety of common and uncommon diseases in the pediatric age group. The cases are organized according to anatomic region, covering disorders of the brain, spinal cord, head and neck, chest, cardiovascular system, gastrointestinal system, genitourinary system, and musculoskeletal system. Cases are presented in a form resembling teaching files, and the images are accompanied by concise informative text. The goal is to provide a diagnostic reference suitable for use in daily routine by both practicing radiologists and radiology residents or fellows. The atlas will also serve as a teaching aide and a study resource, and will offer pediatricians and surgeons guidance on the clinical applications of pediatric imaging.

  12. Book Review

    Science.gov (United States)

    Fritz, Steffen

    2017-07-01

    The book titled European Landscape Dynamics is a comprehensive compendium on the European CORINE land cover (CLC) and some other aspects such as fragmentation and ecosystem services in Europe. The authors constitute a wide selection of researchers and practitioners from across Europe active in this field. It contains 29 chapters of very different sizes ranging between 2 pages (Chapter 8) to 43 pages (Chapter 20). The book is structured in 5 different sections: 1. Introduction; 2. Methodology; 3. European CORINE data layers; 4. Case studies; and 5. CORINE Land Cover Perspective.

  13. Book Review

    Science.gov (United States)

    Mishchenko, Michael I.

    2016-08-01

    The main purpose of this exemplary book is to provide a systematic exposition of the entire field of optical tweezers and their applications. The book is divided into three (approximately equal) parts summarizing the electromagnetic theory of optical tweezers (Part I), the practice of designing and building optical tweezers (Part II), and extensive applications of optical tweezers in various branches of science (Part III). The exposition is highly methodical and addresses the needs of anyone dealing with optical tweezers, be it a theoretician, an engineer/experimentalist, a routine practitioner, or an interested scientist.

  14. An Algebraic Proof of Quillen's Resolution Theorem for K_1

    CERN Document Server

    Whale, Ben

    2009-01-01

    In his 1973 paper Quillen proved a resolution theorem for the K-Theory of an exact category; his proof was homotopic in nature. By using the main result of a paper by Nenashev, we are able to give an algebraic proof of Quillen's Resolution Theorem for K_1 of an exact category.

  15. [Surgeon and eye doctor Caspar Stromayr and the ophthalmological illustrations in his "Practica copiosa" (1559)].

    Science.gov (United States)

    Nover, A; Kümmel, W F

    1984-11-01

    In 1559 Caspar Stromayr wrote a richly illustrated book about hernias and their treatment. The manuscript also includes 3 chapters of a book on ophthalmological diseases which, however, was never published. In addition, it contains 6 separate watercolor illustrations of eye diseases, though without any explanatory texts. The authors attempt to interpret these first colored pictures of eye diseases.

  16. ABCs of an Author/Illustrator Visit. Professional Growth Series. Second Edition.

    Science.gov (United States)

    McElmeel, Sharron L.

    This book aims to help library media specialists and teachers build a love of reading and promote reading comprehension, all while experiencing the fun and excitement of an author or illustrator visit. The book provides step-by-step help in organizing actual author/illustrator visits or "virtual" celebrations--including curricular…

  17. Book Review:

    Science.gov (United States)

    Botet, R.

    2004-09-01

    The second edition of Mathematical Methods for Physics and Engineering by Riley et al is a great scientific textbook. The reader should not be intimidated by its size - over 1200 pages - and skimming through it, one is confronted with a vast amount of information (which could be daunting for students). However, when reading it in detail one realizes that the number of pages is justified and the result is a self-contained reference on mathematical methods for physics. The book is well organized: it starts at basic university undergraduate level and progresses to the highest graduate level. It is a tour de force to write mathematical sections that are both complete and at a appropriate academic level; the sequence of sections (and their content) has been chosen with great care in order that each section may introduce the following ones. The authors have clearly succeeded with this challenge, making this a remarkable pedagogical book. No precise knowledge is needed at the beginning, and all the material is presented in a logical progression. The student can confidently follow the material as it is presented. Even though this book is devoted to physics and engineering, it can be used by students in other scientific fields. The material covered in the book concentrates on applied theorems and formulae. But as the title of the book indicates, it is primarily written 'for physics and engineering' so this is to be expected and it greatly simplifies the text of the course. Consequently, derivations of the main results are essentially 'for physicists'. Frequently proofs are briefly outlined and are not as detailed as many mathematicians would like. Nevertheless, the final results are always clearly stated together with the technical conditions under which they should be used, thus providing a very comprehensive and practical textbook. The only criticism is that the sections on probability and statistics do not fit comfortably between their previous and following sections

  18. Engineering mathematics pocket book

    CERN Document Server

    Bird, John

    2008-01-01

    This compendium of essential formulae, definitions, tables and general information provides the mathematical information required by students, technicians, scientists and engineers in day-to-day engineering practice. A practical and versatile reference source, now in its fourth edition, the layout has been changed and the book has been streamlined to ensure the information is even more quickly and readily available - making it a handy companion on-site, in the office as well as for academic study. It also acts as a practical revision guide for those undertaking BTEC Nationals, Higher Nationals and NVQs, where engineering mathematics is an underpinning requirement of the course.All the essentials of engineering mathematics - from algebra, geometry and trigonometry to logic circuits, differential equations and probability - are covered, with clear and succinct explanations and illustrated with over 300 line drawings and 500 worked examples based in real-world application. The emphasis throughout the book is on ...

  19. Skylab Program Illustration

    Science.gov (United States)

    1971-01-01

    This image illustrates major areas of emphasis of the Skylab Program. In an early effort to extend the use of Apollo for further applications, NASA established the Apollo Applications Program (AAP) in August of 1965. The AAP was to include long duration Earth orbital missions during which astronauts would carry out scientific, technological, and engineering experiments in space by utilizing modified Saturn launch vehicles and the Apollo spacecraft. Established in 1970, the Skylab Program was the forerurner of the AAP. The goals of the Skylab were to enrich our scientific knowledge of the Earth, the Sun, the stars, and cosmic space; to study the effects of weightlessness on living organisms, including man; to study the effects of the processing and manufacturing of materials utilizing the absence of gravity; and to conduct Earth resource observations. The Skylab also conducted 19 selected experiments submitted by high school students. Skylab's 3 different 3-man crews spent up to 84 days in Earth orbit. The Marshall Space Flight Center (MSFC) had responsibility for developing and integrating most of the major components of the Skylab: the Orbital Workshop (OWS), Airlock Module (AM), Multiple Docking Adapter (MDA), Apollo Telescope Mount (ATM), Payload Shroud (PS), and most of the experiments. MSFC was also responsible for providing the Saturn IB launch vehicles for three Apollo spacecraft and crews and a Saturn V launch vehicle for the Skylab.

  20. Book Reviews.

    Science.gov (United States)

    Lance, Larry M.; And Others

    1987-01-01

    Reviews the following Human Sexuality books: "Taking Sides: Clashing Views on Controversial Issues in Human Sexuality" (Francoeur, R.T., 1987); "Annual Editions: Human Sexuality" (Pocs, O., 1987); "Personal Issues in Human Sexuality" (Gordon, S. and Snyder, W., 1986); "Journey Into Sexuality: An Exploratory Voyage" (Reiss, I.L., 1986); and…

  1. Book review

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is entirely dedicated to the functional role of fungi in all kind of ecosystems, and it attempts to show how the world would function if fungi were not there. It is conceived as an introduction to the subject for students in mycology and ecology. The introductory chapters deal with fundame

  2. BOOKS JBOEKE

    African Journals Online (AJOL)

    tions of the survivors of the Coconut Grove fire disaster. Since then, every aspect of ... preface to the first edition, 'as any grown child knows, the quality of a book is in ... undertaken, and will be of particular value for preparation for postgraduate ...

  3. Electronic Books

    Science.gov (United States)

    Clyde, Laurel A.

    2005-01-01

    Terje Hillesund points out that "information technology and especially the Internet have profoundly changed the ways of publishing." Recently, the book publishing industry has started to catch up, making digitized texts--including multimedia texts--available for sale through online bookstores, and in some cases, available for free downloading.…

  4. Recommended Books

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Book 1: (Editor-in-Chief: Shi Yafeng; Published by Elsevier and Science Press Beijing in 2008, 539 pages) Glaciers and Related Environments in China Since the professional institution for glaciology attached to the Chinese Academy of Sciences was established in 1958, studies of glaciers in alpine regions, and of Quaternary glaciations throughout

  5. Book review

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is entirely dedicated to the functional role of fungi in all kind of ecosystems, and it attempts to show how the world would function if fungi were not there. It is conceived as an introduction to the subject for students in mycology and ecology. The introductory chapters deal with

  6. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    Since the publication of the first edition of this book, important developments in biotechnology and mushroom production made a new, revised version necessary. As it is written for the mushroom industry, it emphasizes on nutritional, medical, and cultivating aspects of edible and medicinal fungi. A

  7. Thin book

    DEFF Research Database (Denmark)

    En lille bog om teater og organisationer, med bidrag fra 19 teoretikere og praktikere, der deltog i en "Thin Book Summit" i Danmark i 2005. Bogen bidrager med en state-of-the-art antologi om forskellige former for samarbejde imellem teater og organisationer. Bogen fokuserer både på muligheder og...

  8. BOOK REVIEW

    Institute of Scientific and Technical Information of China (English)

    CHEN Shuaifeng; ZHANG Yun

    2011-01-01

    @@ The generic term"Chinese tradition"can be viewed from various perspectives.One thinks first of classic texts like The Four Books and The Five Classics,or the poetry of the Tang and the Song,as key parts of the genealogy of the "Chinese tradition."

  9. Book reviews

    NARCIS (Netherlands)

    NN,

    1961-01-01

    H.H. Allan, Flora of New Zealand. Vol. 1, 1961, liv + 1085 pp., 40 text figs., 4 end paper maps. Owen, Wellington. The author died in 1957; this volume, which contains the pteridophytes, gymnosperms, and dicots, was seen through the press by Lucy B. Moore. The book weighs no more than 560 grams, so

  10. Book fair

    CERN Multimedia

    2006-01-01

    The Swiss academic publishing house 'Presses Polytechniques Universitaires Romandes'will be presenting its most recent scientific and technical publications at a book fair in the lobby of the Main Building (60) from 10 a.m. to 4 p.m. on Thursday 28 September 2006.

  11. Book Reviews.

    Science.gov (United States)

    Joyner, Christopher C.; And Others

    1986-01-01

    Scholarly reviews of nine books are presented. Topics include nuclear deterrence, urban planning in France, human rights in the Republic of China, the United States' support of Israel, U. S. military policy, an analysis of Rousseau's social contract, political influences on the U. S. presidency, the state and political theory, and the loss of…

  12. Book reviews

    NARCIS (Netherlands)

    NN,

    2003-01-01

    The mycoflora of Nepal, a remote and not easily accessible country, has been poorly known so far. This book offers a welcome compilation of current knowledge, brought together by the author, and supplemented with his extensive own research. Introductory chapters deal with the phytogeography and

  13. Book Reviews.

    Science.gov (United States)

    Cole, Michael; And Others

    1993-01-01

    Reviews four books: (1) "On Intelligence. . .More or Less: A Bioecological Treatise on Intellectual Development" (Stephen J. Ceci); (2) "Knowing Children: Experiments in Conversation and Cognition" (Michael Siegal); (3) "Adolescents and Their Families: Paths of Ego Development" (S. T. Hauser and others); and (4) "Adolescence: An Anthropological…

  14. Book review

    African Journals Online (AJOL)

    up for the new scientific outlook that these elite readily covet was relegated to the ... ness: Culture, Ideology and Discourse, his book published as issue number 44 of .... It Would Take Time projects two categories of pantheons with the first ... rin's recent text is a piece of poetry, a work of drama or a short form of prose fiction.

  15. Book Review

    African Journals Online (AJOL)

    New York: Columbia ... ISBN: 978-0-231-13350-2 by Archana Barua. The Present Personal is a book of our time. .... Chapter 2 (“The Limits of Language and the Dream ..... Archana Barua has also published a number of poems and short.

  16. Book review

    African Journals Online (AJOL)

    There is considerable overlap between the prison poems in the first section ... with which the new book opens, 'The Following Dawn the Boots', talks about the first ... Two spir- ited efforts express solidarity with the executed Nigerian writer, Ken ...

  17. !Book review

    African Journals Online (AJOL)

    In view of the fact that Soko's book was published in 1994, this is a belated review. The ... in by the further sub-title /zibongo Zesingoni (Ngoni praise poetry). ... two praise poets who are mentioned in the first chapter should have been .... attracts almost the whole population which is keen to witness the crowning of its new.

  18. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Zhang Jingwu and Tibetan Liberation The Research Office of Party History of the Committee of the Tibet Autonomous Region edited this book. In the 1950s, Zhang Jingwu received orders to Tibet. He was designated as the representative of the Central Government

  19. Books Reviews

    OpenAIRE

    家本, 秀太郎

    1998-01-01

    Books Reviewed: "The Balance of Payments: Free Versus Fixed Exchange Rates"; "The Economics of Irrigation"; "Farmers and a Hungry World"; "French and EEC Grain Policies and Their Price Effects, 1920-1970"; "Growth and Structure in the Economy of Modern Italy"; "Production Yearbook 1966"; "The Cotton Industry: An Essay in American Economic History. Part I. The Cotton Culture and the Cotton Trade"

  20. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Selected Works on Historical Documents of Tibet (XXI);Collection of Journals on Tibetan Studies;Guidance to Traditional Architecture in Tibet;Concise History of Tibetan Music;Concise History of Tibetan Fine Arts;Series Books on Himalayas;Trekking in Tibet。

  1. Digital books.

    Science.gov (United States)

    Wink, Diane M

    2011-01-01

    In this bimonthly series, the author examines how nurse educators can use the Internet and Web-based computer technologies such as search, communication, and collaborative writing tools; social networking and social bookmarking sites; virtual worlds; and Web-based teaching and learning programs. This article describes digital books.

  2. Book notice

    NARCIS (Netherlands)

    Adema, Frits

    1999-01-01

    FOCKO WEBERLING & WILHELM TROLL: Die Infloreszenzen Band II, Teil 2, Monotele und polytele Synfloreszenzen. Gustav Fischer Verlag, Jena, Germany, 1998. 483 pp., illus. ISBN 3-437-35436-1. Price: DEM 238. A new volume in the monumental series of books on inflorescences in the tradition of Troll’s mor

  3. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    Since the publication of the first edition of this book, important developments in biotechnology and mushroom production made a new, revised version necessary. As it is written for the mushroom industry, it emphasizes on nutritional, medical, and cultivating aspects of edible and medicinal fungi. A

  4. Book Reviews.

    Science.gov (United States)

    Coates, Elizabeth; And Others

    1993-01-01

    Reviews three books: (1) "Jeux Populaires Traditionnels pour les Enfants d'aujourd'hui" (Traditional Popular Games for Today's Children) (Jacqueline Theriault and Denise Garon); "Early Childhood Education" (B. Persky and L. Golubchick, editors); and "Playing to Learn: The Young Child, Teacher and the Classroom" (Weininger and Daniel). (AC)

  5. Electronic Books

    Science.gov (United States)

    Clyde, Laurel A.

    2005-01-01

    Terje Hillesund points out that "information technology and especially the Internet have profoundly changed the ways of publishing." Recently, the book publishing industry has started to catch up, making digitized texts--including multimedia texts--available for sale through online bookstores, and in some cases, available for free downloading.…

  6. Book reviews

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is dedicated to the world-known specialist in marine mycology, E. B. Gareth Jones on the occasion of his 65th birthday, for his substantial contribution to marine mycology. It contains 22 contributions by a multitude of authors, grouped around the central theme of Fungi in marine environme

  7. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    This book is a concise and rewritten version of the author’s ‘Anatomie der Hymenomyceten’, published in 1997 by Koeltz Verlag (CH), which, unfortunately, never has been reviewed in this journal. In almost 500 pages the author leads us through the exciting world of the anatomy, cytology, and histolog

  8. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang

  9. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the

  10. Book Reviews.

    Science.gov (United States)

    Eron, Leonard D.; And Others

    1994-01-01

    Reviews six books on developmental psychology: (1) "Children and Violence" (David Reiss and others); (2) "Television and the American Child" (George Comstock); (3) "Intellectual Development" (Robert Sternberg and Cynthia Berg); (4) "Context and Development" (Robert Cohen and Alexander Siegel); (5) "Adolescent Identity Formation" (Gerald Adams and…

  11. Book Reviews

    OpenAIRE

    Tauer, Loren; Dalrymple, Dana G.; Brink, Lars

    2004-01-01

    Books Reviewed include: A Comprehensive Assessment of the Role of Risk in US Agriculture by Just Richard E., Rulon D. Pope; Providing Global Public Goods: Managing Globalization by Inge Kaul, Pedro Conceicao, Katell Le Goulven and Ronald U. Mendoza; Agricultural Policy Reform-Politics and Process in the EU and US in the 1990s by Wayne Moyer and Tim Josling

  12. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA’S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China’s manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems

  13. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Study of Nuns of Tibetan Buddhism Nuns constitute a part of members of Tibetan Buddhism. Recent years have seen more girls and women apply to be nuns. Studying the why and the female body of the members of Tibetan Buddhism is therefore of practical significance. Authored by Degyi Zholma, the book provides a panoramic description of nuns, including history and status quo. To write

  14. BOOK REVIEWS

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    This book by Professor Chen Yunü is a multi-faceted study of Buddhism during the Ming dynasty (1368-1644).The aim of the research as stated by the author is to clarify the social role of Buddhist institutions during that period and to explicate the "laicization" of Buddhism during the Ming (pp.30-31).

  15. Book Review:

    Science.gov (United States)

    Fallone, B. G.

    2004-01-01

    This book represents the proceedings of the five day programme on IMRT techniques presented at the 2003 American Association of Physicists in Medicine (AAPM) Summer School held in Colorado Springs, Colorado. The book is essentially an overview of IMRT techniques, discussing the history, the mathematical processes involved in the planning stages, the biological indices for evaluations, the off-line and on-line medical imaging that is required, the various IMRT delivery techniques available, positioning and motion verification, shielding and QA issues, and some clinical applications. There is some additional discussion on modulated electron and proton therapy, views on the clinical and financial impact of IMRT, as well as some speculation on the future uses of IMRT. The fact that the book is an `overview' must be emphasized. Medical physicists who are well-read in IMRT, or have implemented IMRT, even partially, may be a little disappointed with the book. Although specific details were purposely omitted, the well-read physicist would have preferred to go right to the `heart of the matter', something this book fails to do. As is typical of many proceedings-type books, there is a certain level of inconsistency of writing styles, as well as some redundancy between the different chapters. It is unfortunate that such a large volume does not have an index to allow a reader to explore a particular subject pertaining to IMRT. The reader would have to guide himself/herself by the table of contents before each chapter which could be a problem if the reader requires some information quickly. It is interesting to note that the book lends itself to a variety of professionals interested in IMRT, including administrators. It may be a source of help for medical physicists who wish to discuss IMRT issues with higher level administration, for example. Some clinical applications are also reviewed. The lack of details concerning the advantages of IMRT with respect to clinical outcome is

  16. Illustrating Mathematics using 3D Printers

    OpenAIRE

    Knill, Oliver; Slavkovsky, Elizabeth

    2013-01-01

    3D printing technology can help to visualize proofs in mathematics. In this document we aim to illustrate how 3D printing can help to visualize concepts and mathematical proofs. As already known to educators in ancient Greece, models allow to bring mathematics closer to the public. The new 3D printing technology makes the realization of such tools more accessible than ever. This is an updated version of a paper included in book Low-Cost 3D Printing for science, education and Sustainable Devel...

  17. Neighborhood Union and Connected [k, k + 1]-Factors in Graphs%图的邻域并和连通的[k,k+1]-因子

    Institute of Scientific and Technical Information of China (English)

    刘红霞; 乔贵平

    2013-01-01

    Let G be a graph of order n. A spanning subgraph F of G is called a[ k, k + 1 ] -factor if k≤dF(x) ≤ k + 1 holds for each x∈V(G). A [k, k + 1]-factor is called a connected [k, k + 1 ] -factor if it is connected. A [k, k + 1 ]-factor F is called a Hamilton [k, k + 1 ] -factor if F contains a Hamilton cycle. In this paper, sev-eralsufficient conditions related to neighborhood union for graphs to have connected [ k, k + 1 ] -factors or Hamilton [k, k + 1]-factors are given.%设G是阶为n的图.F是G的支撑子图且对所有的x∈ V(G)都有k≤dF(x)≤k+1,则称F为G的[k,k+1]-因子.一个[k,k+1]-因子如果连通,则称为连通的[k,k+1]-因子.一个[k,k+1]-因子若包含一个哈密顿圈,则称为哈密顿[k,k+1]-因子.给出了图有哈密顿[k,k+1]-因子或连通的[k,k+1]-因子关于邻域并的若干新的充分条件.

  18. 从宋代版刻中拓展版本研究的途径与方法——读《上海图书馆藏宋本图录》札记%The way and method to expand bibliology from books printed in song dynasty --the reading notes about an illustrated catalog of song block-printed editions in the shanghai library collection

    Institute of Scientific and Technical Information of China (English)

    刘明

    2011-01-01

    The book named an illustrated catalog of song block-printed editions in the shanghai library collection is the rarely and important illustrated catalog in the meaning of bibliology in lated years, which reflect the new way of bibliology studies. It is also reference book with reprensentative value of bibtiotogy, and nearty coUectes song block-printed editions feature, which means another researching importance.%《上海图书馆藏宋本图录》是近些年来难得一见的带有版本学意义的“图录”,展现了版本研究的新路径与新探索,其学术价值不容忽视。同时,也是一部颇具标本价值的版本工具书,宋刻面貌大致赅备其中,故而此书触发管见而具备另外一重学术意义。

  19. Integrating self-help books into psychotherapy.

    Science.gov (United States)

    Campbell, Linda F; Smith, Thomas P

    2003-02-01

    This article describes a systematic and integral method of incorporating self-help books into psychotherapy as a collaborative function. We address the distinctions between self-help and bibliotherapy, consider bibliotherapy as adjunctive or integrative to psychotherapy, and outline the multiple uses of bibliotherapy for clinical purposes. How to apply self-help books in psychotherapy and ways to select books are illustrated by a case example. Indications and contraindications for bibliotherapy in therapy are outlined.

  20. Suggested Books for Children: An Annotated Bibliography

    Science.gov (United States)

    NHSA Dialog, 2008

    2008-01-01

    This article provides an annotated bibliography of various children's books. It includes listings of books that illustrate the dynamic relationships within the natural environment, economic context, racial and cultural identities, cross-group similarities and differences, gender, different abilities and stories of injustice and resistance.

  1. Book of Greek Myths. A Yearling Special.

    Science.gov (United States)

    d'Aulaire, Ingri; d'Aulaire, Edgar Parin

    This oversized, illustrated book discusses the gods, goddesses, and legendary figures of ancient Greece in a relaxed and humorous tone to entertain, enlighten, and educate young people. The first section of the book discusses the "olden times," Gaea, and the Titans. The second section tells the story of Zeus and his family, with sections…

  2. The Untapped Potential of Picture Books

    Science.gov (United States)

    Hager, Stephanie

    2015-01-01

    This article discusses the role picture books play in helping young writers. Third-grade students were read engaging picture books for the sole purpose of noticing and naming different features they encountered during the read-alouds. Students were able to recognize the tools many authors and illustrators use such as onomatopoeia, varied font…

  3. Censoring the Imagination: Challenges to Children's Books.

    Science.gov (United States)

    Saltman, Judith

    1998-01-01

    Presents a brief history of the censorship of children's books, and then focuses on recent challenges. The view of literature as a socializing force is discussed, and examples of challenged books in the United States and Canada are provided, illustrating different reasons for censorship on both sides of the political and social spectrum. (AEF)

  4. Selling pictures: the illustrated auction catalogue

    Directory of Open Access Journals (Sweden)

    Elizabeth Pergam

    2014-12-01

    Full Text Available This essay is based upon a survey of reproductions in auction catalogues – from their first appearance in the early eighteenth century until their more consistent use in the second decade of the twentieth century. Examining the role of these illustrations sheds light on how auctions functioned; it was not just the works of art that were traded, but knowledge about those works of art became currency to be exchanged. In contrast to the high end engravings and photographs of luxury illustrated art books, reproductions in auction catalogues – publications produced as ephemeral marketing tools – were of noticeably lower quality. This study of the status of reproductions, therefore, investigates the evolving understanding of art knowledge, both aesthetic and economic, and the interdependence of the market and connoisseurship.

  5. The history and illustration of anatomy in the Middle Ages.

    Science.gov (United States)

    Gurunluoglu, Raffi; Gurunluoglu, Aslin; Williams, Susan A; Cavdar, Safiye

    2013-11-01

    This article reviews the influence of key figures on the pictorial representation of anatomy and the evolution of anatomical illustration during the Middle Ages until the time of the Renaissance, based on medical history books, journals and ancient medical books. During the early period in the Middle Ages, most illustrations were traditional drawings of emblematic nature, oftentimes unrealistic, not only because the precise knowledge of anatomy was lacking but also because the objective was to elucidate certain principles for teaching purposes. Five figure-series that came down to us through ancient manuscripts and textbooks represent the best examples of such traditional illustrations. With the advent of human dissection in the 13th and 14th centuries, a significant transformation in the depiction of anatomy began to project the practice of human dissection, as we see in the works of Mondino de Luzzi, Henri de Mondeville and Guido de Vigevano. After the invention of book printing in the second half of the 15th century, the reproduction of books was commonly practised and the woodcut made multiplication of pictures easier. Peter of Abano, Hieronymous Brunschwig, Johannes de Ketham, Johannes Peyligk, Gregory Reisch, Magnus Hundt, Laurentius Phryesen and many more included several anatomical illustrations in their treatises that demonstrated the development of anatomical illustration during the later Middle Ages.

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Bastin

    1982-04-01

    . - F.G.P. Jaquet, H.J. de Graaf, Wonderlijke verhalen uit de Indische historie, ‘s-Gravenhage, Moesson 1981. 173 pp. Ills. - F.G.P. Jaquet, J. Landwehr, De Nederlander uit en thuis; spiegel van het dagelijks leven uit bijzondere zeventiende-eeuwse boeken. Alphen aan den Rijn, Sijthoff, 1981. 200 pp. Ills. - P.E. de Josselin de Jong, Michael G. Peletz, Social history and evolution in the interrelationship of adat and Islam in Rembau, Negeri Sembilan, Research Notes and Discussions Paper no. 27, Institute of Southeast Asian Studies, Singapore 1981. 59 pages. - P.E. de Josselin de Jong, Anthony Reid, Perceptions of the past in Southeast Asia, Heinemann Educational Books for Asian Studies Asociation of Australia, Singapore 1979. 436 pp. Bibliographical Appendix, Index, 3 maps., David Marr (eds. - J.E. van Lohuizen-de Leeuw, J. Bastin, Prints of Southeast Asia in the India Office Library - The East India Company in Malaysia and Indonesia 1786-1824, Her Majesty’s Stationery Office, London, 1979, XIII + 228 pp. including 98 pls., frontispiece in colour., P. Rohatgi (eds. - Anke Niehof, Victor T. King, Essays on Borneo Society, Hull Monographs on South-East Asia 7, Oxford University Press, 1978, 256 pp. - C.H.M. Nooy-Palm, Renato Rosaldo, Ilongot headhunting 1883-1974, a study in society and history. Stanford University Press, Stanford, California, 1980. 313 pp., maps, photographs and diagrams. Chronological and general index. - Els Postel-Coster, Clio Presvelou, The household, women and agricultural development, Proceedings of a symposium organised by the Department of Home Economics, Agricultural University, Wageningen, Miscellaneous Papers 17, 1980, Landbouwhogeschool Wageningen, The Netherlands., Saskia Spijkers-Zwart (eds. - G.J. van Reenen, Claudine Salmon, Les Chinois de Jakarta; Temples et vie collective [The Chinese of Jakarta; Temples and communal life], Etudes insulindiennes - Archipel 1, Association Archipel, Paris, 1980 (deuxième impression, xxviii + 358 pp

  7. Book Review:

    Science.gov (United States)

    Sanders, J. H.

    1984-01-01

    The NATO Advanced Study Institute held at Erice, Sicily, in November 1981 brought together specialists in precise measurement to present a tutorial introduction to quantum metrology and the measurement of the fundamental physical constants. Ever since the evolution of experimental physics as a scientific pursuit the measurement of the values of quantities accepted to be constants of nature has commanded the attention of some of the world's most accomplished workers in this field. Their efforts to seek out the sources of systematic error and to reduce the random errors have produced significant advances in techniques and a continual interest in their results from users and critics: as Raymond T Birge, who pioneered the evaluation of the 'best' values of the constants from the available measurements, observed (perhaps with tongue-in-cheek) "it is the continual variation in the values of these quantities that furnishes most of the interest in the subject". Long before the recognition of the fundamental constants the measurement of mass, length and time grew as a matter of necessity in organized communities, especially in agriculture, commerce and navigation. The adoption of standards, first local, then national, and now international, was a natural consequence. It is particularly relevant that the published proceedings of the NATO school opens with a historical survey by Pierre Giacomo of the Bureau International des Poids et Mesures, which places the subsequent papers in perspective. Measurements which realize the standards of length and time, and those from which values of the fundamental constants are derived, are of such a nature that a considerable background knowledge of physics is needed for their understanding. (The principle of the caesium frequency standard and the physics of the Josephson junction are a long haul from Michelson's measurement of the speed of light and the Millikan oil drop experiment familiar in the school books.) With this in mind, George

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-01-01

    Full Text Available -Peter Hulme, Simon Gikandi, Writing in limbo: Modernism and Caribbean literature. Ithaca: Cornell University Press, 1992. x + 260 pp. -Charles V. Carnegie, Alistair Hennessy, Intellectuals in the twentieth-century Caribbean (Volume 1 - Spectre of the new class: The Commonwealth Caribbean. London: Macmillan, 1992. xvii 204 pp. -Nigel Rigby, Anne Walmsley, The Caribbean artists movement, 1966-1972: A literary and cultural history. London: New Beacon Books, 1992. xx + 356 pp. -Carl Pedersen, Tyrone Tillery, Claude McKay: A black poet's struggle for identity. Amherst: University of Massachusetts Press, 1992. xii + 235 pp. -Simone Dreyfus, Irving Rouse, The Tainos: Rise and decline of the people who greeted Columbus. New Haven: Yale University Press, 1992. xii + 211 pp. -Louis Allaire, Antonio M. Stevens-Arroyo, Cave of the Jagua: The mythological world of the Taino. Alburquerque: University of New Mexico Press, 1988. xiii + 282 pp. -Irving Rouse, William F. Keegan, The people who discovered Columbus: The prehistory of the Bahamas. Gainesville: University of Florida Press, 1992. xx + 279 pp. -Neil L. Whitehead, Philip P. Boucher, Cannibal encounters: Europeans and Island Caribs, 1492-1763. Baltimore: John Hopkins University Press, 1992. xii + 217 pp. -Peter Kloos, Kaliña, des amérindiens à Paris: Photographies du prince Roland. Présentées par Gérard Collomb. Paris: Créaphis, 1992. 119 pp. -Maureen Warner-Lewis, Alan Gregor Cobley ,The African-Caribbean connection: Historical and cultural perspectives. Bridgetown, Barbados: Department of History, University of the West Indies, Cave Hill, 1990. viii + 171 pp., Alvin Thompson (eds -H. Hoetink, Jean-Luc Bonniol, La couleur comme maléfice: une illustration créole de la généalogie des 'Blancs' et des 'Noirs'. Paris: Albin Michel, 1992. 304 pp. -Michael Aceto, Richard Price ,Two evenings in Saramaka. Chicago and London: University of Chicago Press, 1991. xvi + 417 pp., Sally Price (eds -Jorge P

  9. Book Review

    Directory of Open Access Journals (Sweden)

    Peralam Yegneswaran Prakash

    2016-08-01

    Full Text Available Since its primary release in 1992 and a second version in 2007 the book ‘Descriptions of Medical Fungi’ has been impressively advanced in its utility for identification of fungi. The initial editions of this book titled ‘Descriptions of Medical QAP Fungi’ were prepared as description sheets to facilitate identification of fungi at participant laboratories in the Royal College of Pathologists of Australasia (RCPA Mycology Quality Assurance Program (QAP. Keeping pace with the major shifts in fungal nomenclature, an updated and refurbished third edition is now available. The authors have attempted to reconcile and portray the present-day morphological description of medically important fungi with supplementary phylogenetic studies.

  10. Book Review

    Science.gov (United States)

    Tanona, Scott

    There is more to this book than readers of this journal might expect from an author who has associated Bohr and Heisenberg with Derrida and Lacan (Plotnitsky, 1994, 2002). Plotnitsky has written in the past on trying to bridge the "two cultures" of the "science wars" by defending Derrida and others against what he perceives to have been too-quickly dismissive critiques (Plotnitsky, 1997), but he has not provided an extended philosophical analysis of Bohr to support the connections he has made. This book seems to be an attempt to engage in a careful analysis of Bohr in a way meant to satisfy critical readers and also support what he here calls "nonclassical epistemology".

  11. Book review

    Directory of Open Access Journals (Sweden)

    Agnieszka Szefer

    2012-10-01

    Full Text Available Sally Meets Harry: Practical Primer to English Pronunciation and Spelling Author: Marta Nowacka, Piotr Cymbalista and Grzegorz A. Kleparski Publisher: Wydawnictwo Uniwersytetu Rzeszowskiego ISBN: 978-837-33867-3-0 Pages: 208;How Much Wood Would a Woodchuck Chuck?’ English Pronunciation Practice Book Author: Anna Mańkowska, Marta Nowacka and Magdalena Kłoczowska Publisher: Konsorcjum Akademickie ISBN: 978-839-28763-2-8 Pages: 200.

  12. Book Review

    Directory of Open Access Journals (Sweden)

    Salvatore Filippone

    2014-01-01

    Full Text Available The book by Arjen Markus is a veritable tour de force among the possibilities opened up by the latest incarnation of Fortran, the longest-lived programming language on the planet and still one of the favourites by scientific programmers. It is not an introduction to the syntax and semantics of the latest language standard: it is more of a gourmet cookbook showing off a wide range of examples of what the new features allow a daring programmer to do.

  13. Book Information

    Institute of Scientific and Technical Information of China (English)

    Li; Caige

    2015-01-01

    The Cultural Gene of Ancient Chinese SpaceAuthor:Zhang Jie Year:2012Publisher:Tsinghua University Press ISBN:9787302273646(413 pages,in Chinese)From multiple perspectives of ancient astronomy,cultural geography and mountain modes,etiquette culture and system,artifacts and space archaeology,traditional painting,geomantic theory,etc.,this book systematically explores the main origins,concepts,con-

  14. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    CHINA'S SPACE TRAVEL On October 16, 2003 China successfully launched its first manned space flight. This book records the course of China's manned space undertaking, and development of its manned space flight. It includes 200 color plates relating to the Seven Systems of China's Manned Space Mission; Development of the Shenzhou Spacecraft; City of Dreams in the Gobi Desert; Yang Liwei-China's First Astronaut; and Chronology of the First

  15. Book Information

    Institute of Scientific and Technical Information of China (English)

    Qian; Fang

    2015-01-01

    Worlding Cities:Asian Experiments anthe Art of Being Global Author:Ananya Roy;Editor:Aihwa Ong Year:2012Publisher:Wiley-Blackwell ISBN:1405192763(376 pages,in English)From Dubai to Delhi and from Singapore to Shanghai,cities across Asia are sites of intense experiments with different ways of being global.This book intervenes in urban theory focused on established

  16. Radiology illustrated. Hepatobiliary and pancreatic radiology

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Byung Ihn (ed.) [Seoul National Univ. Hospital (Korea, Republic of). Dept. of Radiology

    2014-04-01

    Clear, practical guide to the diagnostic imaging of diseases of the liver, biliary tree, gallbladder, pancreas, and spleen. A wealth of carefully selected and categorized illustrations. Highlighted key points to facilitate rapid review. Aid to differential diagnosis. Radiology Illustrated: Hepatobiliary and Pancreatic Radiology is the first of two volumes that will serve as a clear, practical guide to the diagnostic imaging of abdominal diseases. This volume, devoted to diseases of the liver, biliary tree, gallbladder, pancreas, and spleen, covers congenital disorders, vascular diseases, benign and malignant tumors, and infectious conditions. Liver transplantation, evaluation of the therapeutic response of hepatocellular carcinoma, trauma, and post-treatment complications are also addressed. The book presents approximately 560 cases with more than 2100 carefully selected and categorized illustrations, along with key text messages and tables, that will allow the reader easily to recall the relevant images as an aid to differential diagnosis. At the end of each text message, key points are summarized to facilitate rapid review and learning. In addition, brief descriptions of each clinical problem are provided, followed by both common and uncommon case studies that illustrate the role of different imaging modalities, such as ultrasound, radiography, CT, and MRI.

  17. Vitamins K1 and K2: The Emerging Group of Vitamins Required for Human Health

    Directory of Open Access Journals (Sweden)

    Gerry Kurt Schwalfenberg

    2017-01-01

    Full Text Available Objective. To review the evidence for the use of vitamin K supplementation in clinical conditions such as osteoporosis, vascular calcification, arthritis, cancer, renal calculi, diabetes, and warfarin therapy. Quality of Evidence. PubMed was searched for articles on vitamin K (K1 and K2 along with books and conference proceedings and health conditions listed above. Level I and II evidence supports the use of vitamins K1 and K2 in osteoporosis and Level II evidence supports vitamin K2 in prevention of coronary calcification and cardiovascular disease. Evidence is insufficient for use in diabetes, arthritis, renal calculi, and cancer. Main Message. Vitamin K2 may be a useful adjunct for the treatment of osteoporosis, along with vitamin D and calcium, rivaling bisphosphonate therapy without toxicity. It may also significantly reduce morbidity and mortality in cardiovascular health by reducing vascular calcification. Vitamin K2 appears promising in the areas of diabetes, cancer, and osteoarthritis. Vitamin K use in warfarin therapy is safe and may improve INR control, although a dosage adjustment is required. Conclusion. Vitamin K supplementation may be useful for a number of chronic conditions that are afflicting North Americans as the population ages. Supplementation may be required for bone and cardiovascular health.

  18. On the book thickness of $k$-trees

    CERN Document Server

    Dujmović, Vida

    2009-01-01

    Every $k$-tree has book thickness at most $k+1$, and this bound is best possible for all $k\\geq3$. Vandenbussche et al. (2009) proved that every $k$-tree that has a smooth degree-3 tree decomposition with width $k$ has book thickness at most $k$. We prove this result is best possible for $k\\geq 4$, by constructing a $k$-tree with book thickness $k+1$ that has a smooth degree-4 tree decomposition with width $k$. This solves an open problem of Vandenbussche et al. (2009)

  19. Book Review:

    Science.gov (United States)

    Folacci, Antoine; Jensen, Bruce

    2003-12-01

    Thanks to its impressive success in the second half of the 20th century, both in high-energy physics and in critical phenomena, quantum field theory has enjoyed an abundant literature. We therefore greet yet another book on this subject with caution: what can a monograph on quantum field theory bring now that is new, either conceptually or pedagogically? But when it is written by a physicist such as Bryce DeWitt, who has made his own contribution to the collection of field theory books with The Global Approach to Quantum Field Theory, all suspicion is naturally abandoned. One knows in advance that this book can only lead to a genuine enrichment of the literature. DeWitt has made a formidable contribution to various areas of physics: general relativity, the interpretation of quantum mechanics, and most of all the quantization of non-Abelian gauge theories and quantum gravity. In addition, his pedagogical publications, especially the Les Houches schools of 1963 and 1983 [1, 2], have had a great impact on quantum field theory. All this makes the reader keen to pick up his new work and a deeper reading confirms the reviewer's initial enthusiasm. We must begin by alerting the potential readers of this book that it cannot be compared to any other book in the field (unless of course we are talking about references [1] and [2], of which the book under review is an extension and reworking). This uniqueness applies to both the scientific content and the way the ideas are presented. A quick description of this book and a brief explanation of its title should convince the reader of the book's unique quality. For DeWitt, a central concept of field theory is that of `space of histories'. For a field varphii defined on a given spacetime M, the set of all varphii(x) for all x in all charts of M defines its history. It is the space Phi of all possible histories (dynamically allowed or not) of the fields defined on M which is called the `space of histories' by DeWitt. If only

  20. Book Review:

    Science.gov (United States)

    Beenakker, C. W. J.

    2005-08-01

    Quantum Noise is advertised as a handbook, and this is indeed how it functions for me these days: it is a book that I keep within hand's reach, ready to be consulted on the proper use of quantum stochastic methods in the course of my research on quantum dots. I should point out that quantum optics, the target field for this book, is not my field by training. So I have much to learn, and find this handbook to be a reliable and helpful guide. Crispin Gardiner previously wrote the Handbook of Stochastic Methods (also published by Springer), which provides an overview of methods in classical statistical physics. Quantum Noise, written jointly with Peter Zoller, is the counterpart for quantum statistical physics, and indeed the two books rely on each other by frequent cross referencing. The fundamental problem addressed by Quantum Noise is how the quantum dynamics of an open system can be described statistically by treating the environment as a source of noise. This is a general problem in condensed matter physics (in particular in the context of Josephson junctions) and in quantum optics. The emphasis in this book in on the optical applications (for condensed matter applications one could consult Quantum Dissipative Systems by Ulrich Weiss, published by World Scientific). The optical applications centre around the interaction of light with atoms, where the atoms represent the open system and the light is the noisy environment. A complete description of the production and detection of non-classical states of radiation (such as squeezed states) can be obtained using one of the equivalent quantum stochastic formulations: the quantum Langevin equation for the field operators (in either the Ito or the Stratonovich form), the Master equation for the density matrix, or the stochastic Schrödinger equation for the wave functions. Each formulation is fully developed here (as one would expect from a handbook), with detailed instructions on how to go from one to the other. The

  1. BOOK REVIEW: Complete Physics

    Science.gov (United States)

    Carson, Simon

    2000-03-01

    This book contains all the essential concepts for GCSE (or equivalent) physics courses or for general science courses at Key Stage 4. It claims to be ideal for use as a bridging resource for those intending to take physics beyond GCSE: it is no surprise, then, that the book is written at a level above that of the average Key Stage 4 student. It includes material not included in many GCSE syllabuses; this is clearly identified in the contents pages. It would be a useful resource for more able students at GCSE or for beginning A-level students. The layout of the book is attractive. It is well illustrated and colourful. Some of the illustrations are striking: each of the 12 main sections of the book begins with a title page that includes some unusual photographs illustrating physical ideas. Section 2, Forces and Motion, has a photograph of a bungee jumper leaping from the Sky Tower in New Zealand, taken at night looking along the length of the tower from its foot. Section 9, Magnets and Currents, has a computer-generated picture of the magnetic field in a fusion generator. These pictures, as well as contributing to the attractiveness of the book, could be used to initiate discussions of some of the physics. However, there are pictures that serve little useful purpose: a photograph of a recording station for seismic waves looks like any other building lit up at night. A photograph of a rock band in the middle of a section on sound carries no explanatory caption at all and is purely decorative. Other illustrations - in a variety of styles - do illustrate some physical ideas very well: the diagrams of motors and generators, for instance, are far clearer than my efforts on the blackboard! The book is divided into 14 sections with titles reflecting the traditional divisions of physics syllabuses, together with a beginning section on measurement and units and two final sections, `History of Key Ideas' and `Experimental Physics'. The first section, `Measurement and Units

  2. On Potentially K1,4+P2-graphic Sequences%蕴含K1,4+P2的可图序列

    Institute of Scientific and Technical Information of China (English)

    王艳

    2008-01-01

    本文刻划了蕴含K1,4+P2的可图序列,其中K1,4+P2是向完全二部图K1,4添加一条被剖分的边后构成的简单图.%In this paper, we characterize the potentially K1,4+P2-graphic sequences, where K1,4+P2 be a graph obtained by adding an edge e which is subdivided to complete bipartite graph K1,4.

  3. Best Books 1982.

    Science.gov (United States)

    School Library Journal, 1982

    1982-01-01

    This annotated bibliography lists 45 children's books and 29 young adult books selected by School Library Journal's Book Review staff and Young Adult Review committee, respectively. Arrangement is alphabetical by author with the grade level indicated for children's books. (EJS)

  4. BOOK REVIEW

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    <正>Review article:Alain SCHNAPP et al.(eds.).2014.World Antiquarianism.Comparative Perspectives.Los Angeles:Getty Research Institute.ISBN:978-1-60606-148-0,pp.464,23 color and 81 b/w illustrations,4 maps,$60.Reviewed by Sven Günther,Institute for the History of Ancient Civilizations,

  5. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    Full Text Available - J. Abbink, Edward LiPuma, The gift of kinship; Structure and practice in Maring social organisation. Cambridge, etc.: Cambridge University Press, x + 241 pp. - Martin A. van Bakel, P. Bonte, Dictionnaire de l éthnologie et de l ànthropologie. Paris: Presses Universitaires de France, 1991., M. Izard, et al (eds. - M.A. van Bakel, C.J. Healey, Maring hunters and traders; Production and exchange in the Papua New Guinea highlands, Berkeley: University of California press, 1990. - Guido P.F. van den Boorn, H.J.M. Claessen, Verwenen koninkrijken en verloren beschavingen; Opkomst en ondergang van de vroege staat. Assen/Maastricht: Van Gorcum, 1991. VIII + 250 pp.; 21 zw/w kaarten. - Martin van Bruinessen, Werner Kraus, Islamische mystische Bruderschaften im heutigen Indonesien, Hamburg: Mitteilungen des Instituts für Asienkunde 183, 1990. 205 pp., bibliography, index. - Martin van Bruinessen, Michael Charles Williams, Communism, religion, and revolt in Banten. Athens, Ohio: Ohio University, 1990 (Monographs in international studies, Southeast Asia Series, no.86. - J. Bijlmer, R. Jordaan, A. Niehof, Paul Alexander, Creating Indonesian cultures, (Oceania ethnographies 3, Sydney: University of Sydney, 1989, vii + 230 pp. - J.G. De Casparis, J. Fontein, The law of cause and effect in ancient Java. Koninklijke Academie van Wetenschappen, Verhandelingen Afdeling Letterkunde, Niewe Reeks, Deel 140, 1989. - Victoria M. Clara van Groenendael, Mally Kant-Achilles, Wayang Bèbèr; Das wiederentdeckte Bildrollen drama zentral Javas. Stuttgart: Franz Stiener Verlag, 1990. 262 pp. + 133 pp. of illustrations. Photographs, maps, bibliography, glossary cum index, authors’ index, appendices., Friedrich Seltmann, Rüdiger Schumacher (eds. - J.R. van Diessen, Susan Abeyasekere, Jakarta - A history. Oxford, etc.: Oxford University Press, 1989. - Caroline Dissel, Colin Clarke, South Asians overseas; Migration and ethnicity. Cambridge: Cambridge University Press, 1990

  6. Book Review:

    Science.gov (United States)

    Vespignani, A.

    2004-09-01

    Networks have been recently recognized as playing a central role in understanding a wide range of systems spanning diverse scientific domains such as physics and biology, economics, computer science and information technology. Specific examples run from the structure of the Internet and the World Wide Web to the interconnections of finance agents and ecological food webs. These networked systems are generally made by many components whose microscopic interactions give rise to global structures characterized by emergent collective behaviour and complex topological properties. In this context the statistical physics approach finds a natural application since it attempts to explain the various large-scale statistical properties of networks in terms of local interactions governing the dynamical evolution of the constituent elements of the system. It is not by chance then that many of the seminal papers in the field have been published in the physics literature, and have nevertheless made a considerable impact on other disciplines. Indeed, a truly interdisciplinary approach is required in order to understand each specific system of interest, leading to a very interesting cross-fertilization between different scientific areas defining the emergence of a new research field sometimes called network science. The book of Dorogovtsev and Mendes is the first comprehensive monograph on this new scientific field. It provides a thorough presentation of the forefront research activities in the area of complex networks, with an extensive sampling of the disciplines involved and the kinds of problems that form the subject of inquiry. The book starts with a short introduction to graphs and network theory that introduces the tools and mathematical background needed for the rest of the book. The following part is devoted to an extensive presentation of the empirical analysis of real-world networks. While for obvious reasons of space the authors cannot analyse in every detail all the

  7. Book Review:

    Science.gov (United States)

    Fabris, Júlio C.

    2004-04-01

    General relativity is one of the cornerstones of modern physics. In spite of this, the teaching of general relativity at undergraduate level remains quite marginal. The reasons for this particular situation are quite well known. We can quote, for example, two of them: general relativity requires specific mathematical tools that are somehow outside the mainstream of undergraduate technical development; moreover, this is a branch of physics whose observational and experimental applications have remained rare until recent times, and even though this scenario has changed dramatically in the last few years, the new situation has not yet been absorbed into undergraduate teaching. However, there are many textbooks devoted to the teaching of general relativity at undergraduate level. The recent book of J B Hartle, Gravity: An Introduction to Einstein's General Relativity, is a new proposal in this sense. It is perhaps one of the most interesting pedagogical approaches seeking to surmount the difficulties that arise when one tries to include general relativity in undergraduate teaching. In this new book, Hartle attempts to address the difficuties that must be faced by anyone who teaches general relativity at undergraduate level. In order to not scare the student with the hard technical preparation needed to obtain the basic equations of general relativity, Einstein's equations, he simply gives up the idea of introducing these equations at the very beginning. Instead, he chooses to present Einstein's equations, with most of the mathematics needed to do them, in the last part of the book. This delicate (and of course dangerous) choice has the advantage of introducing the reader first to the physical aspects of general relativity. This approach can be dangerous because the relevant solutions of the equations necessary to discuss the physical content of general relativiy are presented first without a formal derivation. But the author circumvents this potential drawback in a

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    Cyril Skinner

    1968-10-01

    Full Text Available - Soebardi, Poerwanto Danoesoegondo, Bahasa Indonesia for beginners. Sydney University Press, 1966, Book I, 160 pp. - Soebardi, J.P. Sarumpaet, The structure of bahasa Indonesia. Department of Indonesian and Malayan Studies, University of Melbourne, 1966, 167 pp. Off-set Print. - Soebardi, J.P. Sarumpaet, Introduction to Bahasa Indonesia. Melbourne University Press, 1967, 111 pp., J.A.C. Mackie (eds. - Soebardi, T.S. Lie, Introducing Indonesian. Sydney, Angus & Robertson Ltd. Book I, 1965, 115 pp. Book II, 1966, 184 pp. - A. Teeuw, Joseph Verguin, Le Malais. Essai d’analyse fonctionnelle et structurale. Cahiers de l’Homme, Ethnologie - Géographie - Linguistique. Nouvelle Série VII. Mouton & Co. Paris, La Haye 1967, 146 pp. - R. Roolvink, Cyril Skinner, The civil war in Kelantan in 1839. Monographs of the Malaysian Branch of the Royal Asiatic Society, II, 1965. vii, 175 pp., 3 maps. - H.J. de Graaf, Generale missiven van Gouverneur-Generaal en Raden aan Heren XVII der Verenidge Oostindische Compagnie. Deel III: 1655-1674. Uitgegeven door Dr. W. Ph. Coolhaas. ‘s-Gravenhage. Rijks Geschiedkundige Publicatiën. Grote Serie 125. Verkrijkbaar bij Martinus Nijhoff. 1968. - Anthony Reid, G.J. Resink, Indonesia’s history between the myths: Essays in legal history and historical theory. Selected Studies on Indonesia, Vol. 7; The Hague, Van Hoeve, 1968, 457 pp. - R.F. Beerling, S. Takdir Alisjahbana, Values as integrating forces in personality, society and culture. University of Oxford Press, Kuala Lumpur, 1966, 248 bldz.

  9. Golden book

    CERN Document Server

    2004-01-01

    On 19 October, CERN reached the climax of its Jubilee with the official celebration in the presence of very high representatives of the Member and Observer States. Above, one of the high moments of the day: the signing of the golden book by the King of Spain, Juan Carlos, and at his right the Director-General of CERN, Robert Aymar, the President of the Swiss Confederation, Joseph Deiss, and the President of the Republic of France, Jacques Chirac. A complete report of this event will be in the next issue of the Bulletin.

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    Daniel Eltringham

    2016-05-01

    Full Text Available Book reviews of the following academic titles: 'Late Modernism' and The English Intelligencer: 'On the Poetics of Community' by Alex Latter, London: Bloomsbury Academic, 276 pp., 2015 'The Writing Occurs as Song: A Kelvin Corcoran Reader' by Andy Brown (ed., Bristol: Shearsman, 260 pp., 2014 'Out of Everywhere 2: Linguistically Innovative Poetry by Women in North America & the UK' by Emily Critchley (ed., Hastings: Reality Street, 362 pp., 2015  'Women’s Experimental poetry in Britain 1970–2010: Body, Time, Locale' by David Kennedy and Christine Kennedy, Liverpool: Liverpool University Press, 192 pp., 2013

  11. [Illustrations of visceral referred pain. "Head-less" Head's zones].

    Science.gov (United States)

    Henke, C; Beissner, F

    2011-04-01

    Reviewing anatomical, physiological and neurological standard literature for illustrations of referred visceral pain only one type of illustration can frequently be found, which is referred to as Treves and Keith. In fact, the original illustration as a model for most current pictures stems from the German edition of Sir Frederick Treves' famous book "Surgical Applied Anatomy" from 1914, which was reillustrated for didactical reasons for the German readership. While neither Treves and Keith nor the German illustrator Otto Kleinschmidt ever published any work on referred pain this illustration must have been adapted or copied from older sources by the illustrator. Therefore the comprehensive systematic original works before 1914 were reviewed, namely those of Sir Henry Head and Sir James Mackenzie. Due to the name of the phenomenon in the German literature of Head's zones, the illustrations were expected to be based mainly on Head's work. However, a comparison of all available illustrations led to the conclusion that Kleinschmidt chiefly used information from Mackenzie as a model for his illustration. Due to the inexact reproduction of Mackenzie's work by the illustrator some important features were lost that had been reported by the original authors. These include the phenomenon of Head's maximum points, which nowadays has fallen into oblivion.Therefore current charts, based on the illustration by Kleinschmidt from 1914, lack experimental evidence and appear to be a simplification of the observational results of both Head's and Mackenzie's original systematic works.

  12. Picture Books about Blacks: An Interview with Opal Moore.

    Science.gov (United States)

    MacCann, Donnarae; Richard, Olga

    1991-01-01

    Presents an interview with Opal Moore, who discusses Black imagery in picture books published in the last four years and the institutions that circulate that imagery. Topics discussed include the issue of race pride; interracial themes; appropriate illustrations; African versus African-American books; and the roles of publishers, books reviewers,…

  13. Resource Book for Furniture Renovation, Refinishing and Reupholstering.

    Science.gov (United States)

    Barton, Diane; Robinson, Jay

    This resource book for furniture renovation (refinishing and reupholstering) is one of four resource books developed for use in Code 30 or adult vocational programs in the home furnishings service area. Representative, illustrative, and informative materials contained in the resource book are Furniture Woods, Cuts and Matching Veneers, Wood…

  14. Open-Book Testing and Education for the Future.

    Science.gov (United States)

    Feller, Morris

    1994-01-01

    The educational advantages of open-book testing are explored, considering the changes in teaching method that are necessary for open-book testing to be successful. How open-book testing should work is illustrated through the example of tests for Spanish-language classes. (SLD)

  15. Book Review

    Science.gov (United States)

    Kragh, Helge

    2015-11-01

    Ever since the days of William Blake there has been an underground resistance against the soulless yet triumphant science and its unholy alliance with money, technology and political power. With the nearly undisputed hegemony that science and technological innovation has attained in the post-World War II era, this kind of resistance has resulted in numerous books and articles that in different ways warn against the dark sides of science and the socio-economic system that nourishes a science in degeneration. Classical examples include Herbert Marcuse's One-Dimensional Man (1964), Jacques Ellul's The Technological Society (1965), Theodore Roszak's The Making of a Counter Culture (1968), and Paul Feyerabend's Science in a Free Society (1978). A fair part of the literature written by sociologists and philosophers is not only critical to trends in modern science, but tends to or is overtly anti-science. The book under review belongs in some respects to this heterogeneous literary tradition, but Twilight of the Scientific Age is primarily directed against the institutional system of science and its associated ideology and not against science itself. Indeed, the author is himself a practicing scientist, an astrophysicist, and he emphasizes several times that he firmly believes in science, even that he loves it. He is not a "stupid cultural relativist," he asserts (p. 11), but a critical freethinker independent of dogmatic beliefs.

  16. Book Review:

    Science.gov (United States)

    Das, Ashok

    2007-01-01

    It is not usual for someone to write a book on someone else's Ph.D. thesis, but then Feynman was not a usual physicist. He was without doubt one of the most original physicists of the twentieth century, who has strongly influenced the developments in quantum field theory through his many ingenious contributions. Path integral approach to quantum theories is one such contribution which pervades almost all areas of physics. What is astonishing is that he developed this idea as a graduate student for his Ph.D. thesis which has been printed, for the first time, in the present book along with two other related articles. The early developments in quantum theory, by Heisenberg and Schrödinger, were based on the Hamiltonian formulation, where one starts with the Hamiltonian description of a classical system and then promotes the classical observables to noncommuting quantum operators. However, Dirac had already stressed in an article in 1932 (this article is also reproduced in the present book) that the Lagrangian is more fundamental than the Hamiltonian, at least from the point of view of relativistic invariance and he wondered how the Lagrangian may enter into the quantum description. He had developed this idea through his 'transformation matrix' theory and had even hinted on how the action of the classical theory may enter such a description. However, although the brief paper by Dirac contained the basic essential ideas, it did not fully develop the idea of a Lagrangian description in detail in the functional language. Feynman, on the other hand, was interested in the electromagnetic interactions of the electron from a completely different point of view rooted in a theory involving action-at-a-distance. His theory (along with John Wheeler) did not have a Hamiltonian description and, in order to quantize such a theory, he needed an alternative formulation of quantum mechanics. When the article by Dirac was brought to his attention, he immediately realized what he was

  17. Book Review:

    Science.gov (United States)

    Poisson, E.

    2006-09-01

    The motion of a charged particle interacting with its own electromagnetic field is an area of research that has a long history; this problem has never ceased to fascinate its investigators. On the one hand the theory ought to be straightforward to formulate: one has Maxwell's equations that tell the field how to behave (given the motion of the particle), and one has the Lorentz-force law that tells the particle how to move (given the field). On the other hand the theory is fundamentally ambiguous because of the field singularities that necessarily come with a point particle. While each separate sub-problem can easily be solved, to couple the field to the particle in a self-consistent treatment turns out to be tricky. I believe it is this dilemma (the theory is straightforward but tricky) that has been the main source of the endless fascination. For readers of Classical and Quantum Gravity, the fascination does not end there. For them it is also rooted in the fact that the electromagnetic self-force problem is deeply analogous to the gravitational self-force problem, which is of direct relevance to future gravitational wave observations. The motion of point particles in curved spacetime has been the topic of a recent Topical Review [1], and it was the focus of a recent Special Issue [2]. It is surprising to me that radiation reaction is a subject that continues to be poorly covered in the standard textbooks, including Jackson's bible [3]. Exceptions are Rohrlich's excellent text [4], which makes a very useful introduction to radiation reaction, and the Landau and Lifshitz classic [5], which contains what is probably the most perfect summary of the foundational ideas (presented in characteristic terseness). It is therefore with some trepidation that I received Herbert Spohn's book, which covers both the classical and quantum theories of a charged particle coupled to its own field (the presentation is limited to flat spacetime). Is this the text that graduate students

  18. Projeto Grafico, Illustracao e Leitura do Texto Poetico (Graphic Project, Illustration and Reading of the Poetic Text).

    Science.gov (United States)

    Camargo, Luis

    1997-01-01

    Discusses the presence of graphic organization in books, which creates peculiar, constitutive reading signals regarding the nature of illustration. Analyzes the graphic organization of five different illustrations of poems. (PA)

  19. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Studies of Historical Archives Written in Tibetan The historical archives in Tibetan language,particularly historical records, have a long history and are abundant.In accordance with the method of recording, the form of an archive varies in its use of characters,illustrations,language,and the art of engraving.By focusing on historical archives in Tibetan,Hua Lin(the author)

  20. Book Review:

    Science.gov (United States)

    Poisson, E.

    2005-10-01

    The ever growing relevance of general relativity to astrophysics and cosmology continues to motivate the publication of new textbooks which put the theory in a fresh perspective informed by recent developments. In the last few years we have witnessed the appearance of two new books which reflect this trend, and which stand proud among the classic relativity texts. While the 1970s were the decade of Weinberg [1] and Misner et al [2], and the 80s the decade of Schutz [3] and Wald [4], this is clearly the decade of Hartle [5] and Carroll. Hartle has introduced a novel pedagogical approach to teaching general relativity, which he convincingly argues [6] should be done in the standard undergraduate physics curriculum. His 'physics-first approach' emphasizes physical phenomena and minimizes mathematical formalism. Hartle achieves a lot by introducing only the spacetime metric and the geodesic equation, which are the main tools needed to explore curved spacetime and extract physical consequences. To be sure, to explain how the metric is obtained in the first place does require a background of differential geometry and the formulation of the Einstein field equations. But in Hartle's book this material is wisely presented at a later stage, after an ample sampling of the physics of curved spacetime has motivated the need for the advanced mathematics. Carroll follows instead the traditional route, what Hartle calls the 'math-first approach', in which one introduces first the required mathematical formalism and only then derives the physical consequences. He is, of course, in good company, as this is the method followed in all existing textbooks (with Hartle's being the sole exception). Carroll's approach may not be original, but it is tried and true, and the result of Carroll's efforts is an excellent introduction to general relativity. The book covers the standard topics that would be found in virtually all textbooks (differential geometry, the field equations, linearized

  1. Robert Carswell: the first illustrator of MS.

    Science.gov (United States)

    Murray, T J

    2009-09-01

    The first illustration of multiple sclerosis (MS) was by a young Scottish physician and artist, Dr Robert Carswell. Recognized as a talented illustrator by his teachers, he was encouraged to create an anatomy and pathology atlas. He spent years in the hospitals and mortuaries of Paris and Lyon painting watercolours and pen and ink drawings of patients and post mortem preparations. Of the 1034 paintings, 99 are of the brain and spinal cord and Plate 4, figure 4.4 in the atlas (Figure 2), is of MS. Carswell indicated he saw two examples of this pathology, but had not examined either patient, but illustrated one of them. We know little about the clinical history other than that the patient was paralyzed. About 200 of the atlases were printed, and it is still regarded as one of the greatest and most beautiful of all medical books. Carswell was appointed as the first Professor of Anatomy at the North London Hospital, later renamed the University College Hospital UK, where the original copy of his great atlas is archived. Due to ill health he resigned after a few years to reside in the healthier air outside Brussels, Belgium. He was appointed physician to King Leopold, but was also noted for his care of the poor. Queen Victoria knighted him for his care of King Louis Philippe of France when he was in exile. Although English journals did not note his passing at the age of 64 years, his great atlas remains as his memorial.

  2. Book Review:

    Science.gov (United States)

    Borcherds, P.

    2005-03-01

    This book achieves what its subtitle indicates. The author skilfully weaves together the story of Bragg's life and of the scientific developments with which he was most closely involved. The author has a good understanding of Bragg's scientific work which he explains in considerable detail, with a number of diagrams reproduced from Bragg's papers, and manages to convey the excitement generated by Bragg's discoveries. The salient points of Bragg's life are well known. He was born and brought up in Australia and is still the youngest ever winner of a Nobel prize (though Josephson did his seminal work at a comparable age, it took many years for him to get his Prize). From 1914 to 1918 Bragg was involved with acoustic methods of detecting enemy guns. From 1919 to 1938 he was Professor of Physics in Manchester, and for about a year he was Director of the National Physical Laboratory. He then went to Cambridge as Cavendish Professor until 1953, when he moved to the Royal Institution (where his father had been). While an undergraduate at Cambridge 'Bragg's most influential teacher was...C T R Wilson [Nobel Laureate, 1927]...[whose] lectures "were the best, and delivery the worst, of any lectures to which I have ever been. He mumbled facing the board, he was very hesitant in his delivery, and yet the way he presented the subject was quite brilliant'' '. One wonders how long Wilson's inspirational teaching would survive today, with continual inspections and the requirement to satisfy the demands of the jobsworths. Bragg's comments on this would make interesting reading! Bragg was a very successful public lecturer on science. He made use of vivid analogies, many of which are quoted by Hunter. Since this book is published by Oxford University Press, I hope that some of them may appear in future editions of The Oxford Dictionary of Quotations. (Bragg is included in Mackay's A Dictionary of Scientific Quotations (Bristol: Institute of Physics Publishing)). There are too many

  3. Book Review:

    Science.gov (United States)

    Kiefer, C.

    2005-10-01

    The most difficult unsolved problem in fundamental theoretical physics is the consistent implementation of the gravitational interaction into a quantum framework, which would lead to a theory of quantum gravity. Although a final answer is still pending, several promising attempts do exist. Despite the general title, this book is about one of them - loop quantum gravity. This approach proceeds from the idea that a direct quantization of Einstein's theory of general relativity is possible. In contrast to string theory, it presupposes that the unification of all interactions is not needed as a prerequisite for quantum gravity. Usually one divides theories of quantum general relativity into covariant and canonical approaches. Covariant theories employ four-dimensional concepts in its formulation, one example being the path integral approach. Canonical theories start from a classical Hamiltonian version of the theory in which spacetime is foliated into spacelike hypersurfaces. Loop quantum gravity is a variant of the canonical approach, the oldest being quantum geometrodynamics where the fundamental configuration variable is the three-metric. Loop quantum gravity has developed from a new choice of canonical variables introduced by Abhay Ashtekar in 1986, the new configuration variable being a connection defined on a three-manifold. Instead of the connection itself, the loop approach employs a non-local version in which the connection is integrated over closed loops. This is similar to the Wilson loops used in gauge theories. Carlo Rovelli is one of the pioneers of loop quantum gravity which he started to develop with Lee Smolin in two papers written in 1988 and 1990. In his book, he presents a comprehensive and competent overview of this approach and provides at the same time the necessary technical background in order to make the treatment self-contained. In fact, half of the book is devoted to 'preparations' giving a detailed account of Hamiltonian mechanics, quantum

  4. Practical opto-electronics an illustrated guide for the laboratory

    CERN Document Server

    Protopopov, Vladimir

    2014-01-01

    This book explains how to create opto-electronic systems in a most efficient way, avoiding typical mistakes. It covers light detection techniques, imaging, interferometry, spectroscopy, modulation-demodulation, heterodyning, beam steering, and many other topics common to laboratory applications. The focus is made on self-explanatory figures rather than on words. The book guides the reader through the entire process of creating problem-specific opto-electronic systems, starting from optical source, through beam transportation optical arrangement, to photodetector and data acquisition system. The relevant basics of beam propagation and computer-based raytracing routines are also explained, and sample codes are listed. the book teaches important know-how and practical tricks that are never disclosed in scientific publications.  The book can become the reader's personal adviser in the world of opto-electronics and navigator in the ocean of the market of optical components and systems. Succinct, well-illustrate...

  5. Creating a digital medical illustration.

    Science.gov (United States)

    Culley, Joanna

    2016-01-01

    This paper covers the steps required to complete a medical illustration in a digital format using Adobe Illustrator and Photoshop. The project example is the surgical procedure for the release of the glenohumeral joint for the condition known as 'frozen shoulder'. The purpose is to demonstrate one method which an artist can use within digital media to create a colour illustration such as the release of the glenohumeral joint. Included is a general overview as how to deal with the administration of a medical illustration commission through the experience of a professional freelance artist.

  6. Illustrations

    OpenAIRE

    2014-01-01

    Facettes multiples de la mangrove Divers faciès végétaux de la mangrove Rhizophora et Avicennia. © Cormier. Avicennia et Laguncularia. © Cormier. Mangrove : un écosystème forestier parcouru de bolons. © Cormier. Écosystème à mangrove (du rebord de plateau au bolon, y compris rizières de mangrove et tannes). Cormier © Orstom. Faune typique de la mangrove Monodactylus (Psettia sebae). Vidy © Orstom. Crabes violonistes (Uca spp.) Intès © Orstom. Les Rivières du Sud : des mangroves densémen...

  7. Illustration

    OpenAIRE

    2016-01-01

    Fragment de la « Carte generale de la Nouvelle France [...] », datée de 1692, publiée dans Premier Etablissement de la foy Dessins à l’encre, probablement de Leclercq ou du père Jumeau, trouvés dans un exemplaire de la Nouvelle Relation de la Gaspesie (voir éd. Ganong, p. 27, n. 2). Dessins à l’encre, probablement de Leclercq ou du père Jumeau, trouvés dans un exemplaire de la Nouvelle Relation de L· Gaspesie (voir éd. Ganong, p. 27, n. 2).

  8. Illustration

    OpenAIRE

    2016-01-01

    Fragment de la « Carte generale de la Nouvelle France [...] », datée de 1692, publiée dans Premier Etablissement de la foy Dessins à l’encre, probablement de Leclercq ou du père Jumeau, trouvés dans un exemplaire de la Nouvelle Relation de la Gaspesie (voir éd. Ganong, p. 27, n. 2). Dessins à l’encre, probablement de Leclercq ou du père Jumeau, trouvés dans un exemplaire de la Nouvelle Relation de L· Gaspesie (voir éd. Ganong, p. 27, n. 2).

  9. Book Review:

    Science.gov (United States)

    Webb, Steve

    2008-11-01

    The Polish physicist Józio (Joseph, Josh, Jo) Rotblat was catapulted into the public eye when he (and the 'Pugwash Conferences' organization) received the 1995 Nobel Peace Prize. His life prior to that had been most distinguished but conducted well out of the public eye. Born and raised as a Jewish physicist in pre-World War II Poland, and thus potentially educationally disadvantaged, he battled away for education and scientific achievement. He came to Liverpool University just before the outbreak of World War II, worked in James Chadwick's laboratory on the early beginnings of neutron fission physics, moved to Los Alamos to take part in the US-UK collaborative Manhattan Project to build a nuclear bomb and was motivated by a desire to rid Poland of Nazi 'racial cleansing'. On realizing the US-UK goal was somewhat wider, he resigned this work and dedicated his life to the peaceful uses of radiation and the campaigns to rid the world of the potential world-eliminating possibility of nuclear war. For this purpose he interacted with Albert Einstein and Bertrand Russell, and in July 1957 founded the 'Pugwash Conferences', named for a small fishing village in Nova Scotia, Canada where the first was held. Along the way his personal life was no less dramatic. Cruel events conspired, and his wife Tola remained in Poland and was killed in the Nazi extermination camp at Majdanek. He grieved for his beloved Poland and those left behind or unaccounted for. He was suspected by some Americans of being a spy and had his personal papers and family artefacts impounded. After the war he was Professor of Medical Physics at St Bartholomew's Hospital, London for 30 years up to retirement. After John Roberts, he was the second editor of this journal Physics in Medicine and Biology from 1961-72 (see e.g. Bob Burns' paper in our 50th birthday issue, 2006. Kit Hill's little book which chronicles the life and times of Rotblat weaves together the key events in his personal and professional

  10. Book Review:

    Science.gov (United States)

    Barbour, J. B.

    2007-02-01

    These colloquium proceedings will be valuable, the blurb says, for graduate students and researchers in cosmology and theoretical astrophysics. Specifically, the book 'looks at both the strengths and weaknesses of the current big bang model in explaining certain puzzling data' and gives a 'comprehensive coverage of the expanding field of cosmology'. The reality is rather different. Conference proceedings rarely compare in value with a solid monograph or good review articles, and Current Issues in Cosmology is no exception. The colloquium was convened by the two editors, who have both long harboured doubts about the big bang, and was held in Paris in June 2004. The proceedings contain 19 presented papers and relatively brief summary comments by four panel speakers. The questions and answers at the end of each talk and a general discussion at the end were recorded and transcribed but contain little of interest. The nature of the colloquium is indicated by panellist Francesco Bertola's comment: 'While in the 1950s it was possible to speak of rival theories in cosmology, now the big-bang picture has no strong rivals. This is confirmed by the fact that out of 1500 members of the IAU Division VIII (Galaxies and the Universe) only a dozen, although bright people, devote their time to the heterodox views.' This was largely a platform for them to give their views. At least half of the dozen, all the 'usual suspects', were present: Geoffery and Margaret Burbidge, Jayant Narlikar, Halton Arp, Chandra Wickramasinghe and, in spirit only but playing a role somewhat like the ghost of Hamlet's father, the late Fred Hoyle. Doubters presented 12 of the 19 papers. Orthodoxy should certainly be challenged and the sociology of science questioned, but I found two main problems with this book. The papers putting the orthodox view are too short, even perfunctory. The most that a serious graduate student would get out of them is a reference to a far better review article or book on modern

  11. Book Review:

    Science.gov (United States)

    Dray, T.

    2006-06-01

    Null hypersurfaces are a mathematical consequence of the Lorentzian signature of general relativity; singularities in mathematical models usually indicate where the interesting physics takes place. This book discusses what happens when you combine these ideas. Right from the preface, this is a no-nonsense book. There are two principal approaches to singular shells, one distributional and the other 'cut and paste'; both are treated in detail. A working knowledge of GR is assumed, including familiarity with null tetrads, differential forms, and 3 + 1 decompositions. Despite my own reasonably extensive, closely related knowledge, there was material unfamiliar to me already in chapter 3, although I was reunited with some old friends in later chapters. The exposition is crisp, with a minimum of transition from chapter to chapter. In fact, my main criticism is that there is no clear statement of the organization of the book, nor is there an index. Everything is here, and the story is compelling if you know what to look for, although it is less easy to follow the story if you are not already familiar with it. But this is really a book for experts, and the authors certainly qualify, having played a significant role in developing and extending the results they describe. It is also entirely appropriate that the book is dedicated to Werner Israel, who pioneered the thin-shell approach to (non-null) singular surfaces and later championed the use of similar methods for analysing null shells. After an introductory chapter on impulsive signals, the authors show how the Bianchi identities can be used to classify spacetimes with singular null hypersurfaces. This approach, due to the authors, generalizes the framework originally proposed by Penrose [1]. While astrophysical applications are discussed only briefly, the authors point out that detailed physical characteristics of signals from isolated sources can be determined in this manner. In particular, they describe the behaviour

  12. Book Review:

    Science.gov (United States)

    Unruh, W. G.

    2006-02-01

    Quantum mechanics is one of the most successful theoretical structures in all of science. Developed between 1925-26 to explain the optical spectrum of atoms, the theory over the succeeding 80 years has been extended, first to quantum field theories, gauge field theories, and now even string theory. It is used every day by thousands of physicists to calculate physical phenomena to exquisite precision, with no ambiguity in the results. To claim that this is a theory which is not understood by those physicists is absurd. And yet, as eminent a physicist as Richard Feynman, who did as much as anyone else to extend quantum theory to field theories and was a master at producing those exquisite calculations, could say that anyone who claimed they understood quantum theory clearly did not understand quantum theory. One hundred years ago Einstein postulated one of the most unsettling features of the theory, the wave-particle duality, with his particulate explanation for light of the photoelectric effect, and an explanation which was in direct conflict with Maxwell's brilliant development of a wave, or field, theory of light. Einstein believed that the particulate nature would ultimately be explainable by some sort of non-linear theory of electromagnetism, and was outraged by the acceptance of the community of the probabilistic quantum theory. His programme was of course dealt a (near?) fatal blow by Bell's discovery that the three desiderata - a theory which agrees with experiment, a theory which is local in its effects, and a theory in which nature, at its heart, is not probabilistic - are incompatible. That discomfort felt by Einstein and by Feynman is felt by numerous other people as well. This discomfort is heightened by the fact that the theory of gravity, another of Einstein's great achievements, has resisted all efforts at reconciliation with quantum mechanics. This book explores that discomfort, and tries to pin down what the locus of that discomfort is. For many

  13. Book Review "William R.Spillers and Keith M.MacBain.Structural Optimization,Springer Dordrecht Heidelberg London New York,2009"

    Institute of Scientific and Technical Information of China (English)

    H.W.ZHANG; Z.KANG

    2010-01-01

    @@ This book presents general theories and applications of structural optimization methods. The first chapter of the book introduces various basic concepts of structural optimization through several illustrative examples.

  14. Training the renaissance medical illustrator.

    Science.gov (United States)

    Winn, W M

    1976-11-01

    The professional training of the medical illustration student has been a subject of controvery for the last few years. Curricula of the schools accredited by the Association of Medical Illustrators have, to varying degrees, undergone change due to new demands on the practicing illustrator. The curriculum in Biomedical Illustration at The University of Texas Health Science Center at Dallas attempts to balance time-proven courses with contemporary problem-solving approaches to the training of the medical illustrator. This paper reflects the history, philosophy and methods of implementation of the course of study leading to the M.A. degree in Biomedical Communication at the University of Texas Health Science Center at Dallas.

  15. Automated illustration of patients instructions.

    Science.gov (United States)

    Bui, Duy; Nakamura, Carlos; Bray, Bruce E; Zeng-Treitler, Qing

    2012-01-01

    A picture can be a powerful communication tool. However, creating pictures to illustrate patient instructions can be a costly and time-consuming task. Building on our prior research in this area, we developed a computer application that automatically converts text to pictures using natural language processing and computer graphics techniques. After iterative testing, the automated illustration system was evaluated using 49 previously unseen cardiology discharge instructions. The completeness of the system-generated illustrations was assessed by three raters using a three-level scale. The average inter-rater agreement for text correctly represented in the pictograph was about 66 percent. Since illustration in this context is intended to enhance rather than replace text, these results support the feasibility of conducting automated illustration.

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    A. Teeuw

    1977-10-01

    Full Text Available - P.E. de Josselin de Jong, J.H. Beaglehole, The district: A study in decentralization in West Malaysia. Hull Monographs on South-East Asia no. 6. Published for the University of Hull by Oxford University Press, 1976. 122 pages. - C.D. Grijns, Sri Soekesi Adiwimarta, Omong Djakarta-Texte (bearbeitet und übersetzt von -. Veröffentlichung des Seminars für Indonesische und Südsesprachen der Universität Hamburg Band 8. Verlag von Dietrich Reimer, Berlin, 1973. - H.K.J. Cowan, V.I. Braginskij, Evoljutsija Malajskogo klassitsjeskogo sticha. Uitg. “Nauka”, glavnaja redaktsija vostotsjnoj literatury, Moskou 1975. 206 blzn. - J.J. Ras, Wolfgang Marschall, Der Berg des Herrn der Erde, Alte Ordnung und Kulturkonflikt in einem indonesischen Dorf. Deutscher Taschenbuch Verlag, München 1976. 204 pp., 30 illustrations. - A. Teeuw, Muhammad Haji Salleh, Tradition and change in contemporary Malay-Indonesian poetry. Penerbit Universiti Kebangsaan Malaysia, Kuala Lumpur 1977. IX, 190 pp. - J.J. Ras, Beryl de Zoete, Dance and drama in Bali. Oxford University Press, Kuala Lumpur 1973. XX 343 pp., 112 illustrations., Walter Spies (eds.

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. van Goor

    1997-07-01

    Full Text Available - Peter Boomgaard, Christine Dobbin, Asian entrepreneurial minorities; Conjoint communities in the making of the world economy, 1570-1940. Richmond: Curzon Press, 1996, xiii + 246 pp. [Nordic Institute of Asian Studies Monograph Series 71.] - Ian Brown, Fukuda Shozo, With sweat and abacus; Economic roles of Southeast Asian Chinese on the eve of World War II, edited by George Hicks. Singapore: Select Books, 1995, xii + 246 pp. - Ian Brown, George Hicks, Chinese organisations in Southeast Asia in the 1930s. Singapore: Select Books, 1996, xv + 168 pp. - Matthew I. Cohen, Laurie J. Sears, Shadows of empire; Colonial discourse and Javanese tales. Durham/London: Duke University Press, 1996, xxi + 349 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. II: Expansion and crisis. New Haven/London: Yale University Press, 1993, xv + 390 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. I: The lands below the winds. New Haven/London: Yale University Press, 1988, xvi + 275 pp. - David Henley, Saya S. Shiraishi, Young heroes; The Indnesian family in politics. Ithaca/New York: Southeast Asia Program, Cornell University, Southeast Asia Program Publications, 1997, 183 pp. [Studies on Southeast Asia 22.] - Gerrit Knaap, P. Jobse, Bronnen betreffende de Midden-Molukken 1900-1942. Den Haag: Instituut voor Nederlandse Geschiedenis, 1997. 4 volumes. Rijks Geschiedkundige Publicatiën, Kleine Serie, 81, 82, 83, 84. Volume 1 bewerkt door P. Jobse, 2 en 3 door Ch.F. van Fraassen, 4 door Ch.F van Fraassen en P. Jobse. xii + 578, xii + 578, xii + 711, x + 655, xi + 261 pp., Ch. F. van Fraassen (eds. - Indro Nugroho-Heins, Clara Brakel-Papenhuyzen, Classical Javanese dance; The Surakarta tradition and its terminology. Leiden: KITLV Press, 1995, xi + 252 pp. [Verhandelingen 155.] - László Sluimers, Shigeru Sato, War, nationalism and peasants; Java under the Japanese occupation, 1942-1945. Armonk, New

  18. Best Books of 1977

    Science.gov (United States)

    Gerhardt, Lillian N.; And Others

    1977-01-01

    School Library Journal book review editors have selected and annotated their choices for the best children's and young adults' books from those books that were submitted for review during 1977 by general book trade book publishers. Included in the annotations are: author, title, publisher, price, and recommended reading and interest levels. (JPF)

  19. The Economics of Books

    NARCIS (Netherlands)

    Canoy, M.F.M.; van Ours, J.C.; van der Ploeg, F.

    2005-01-01

    The tensions between books and book markets as expressions of culture and books as products in profit-making businesses are analysed and insights from the theory of industrial organisation are given.Governments intervene in the market for books through laws concerning prices of books, grants for aut

  20. Book Review:

    Science.gov (United States)

    Peacock, John

    2007-04-01

    ), but the latter is surprising in the context of a subject whose whole purpose is to observe the properties of primordial perturbations that may have arisen from inflation. Instead, the text concentrates on the technical heartland of the transport theory for CMB photons, and the Newtonian and relativistic theory for the development of CMB anisotropies, including polarization. It closes with more observationally-based chapters on general statistical aspects of the CMB sky, a digest of the recent results from WMAP, and an outlook. These are welcome, but the book really stands or falls on its treatment of the core physics of anisotropies. Without going too much into specifics, it can be fairly stated that the treatment given of the main material on CMB fluctuations is geared more to working professionals than to students. There is a good deal of useful technical detail, but it is not always derived systematically, and sometimes arises by reference to the research literature. There are no problem sets or worked examples, and not much attempt at intuitive illumination. As an example, one might point to the large-angle anisotropies of the CMB, which were first analysed in the classic Sachs Wolfe paper of 1967. The relativistic transport equation is there, but one looks in vain for the separation into the Sachs Wolfe effect proper (potential perturbations at last scattering) and the integrated effect of evolution since then. This latter ISW effect is in fact of huge interest in current research, since it is one of the methods for probing whether the vacuum energy differs from a cosmological constant. In general, the text seems strangely patchy on issues of contemporary interest, certainly in terms of its emphasis. It is as if the three authors contributed material separately without achieving a full integration. On the more positive side, the book has the advantage that it presents a Russian view of the subject. So much of the initial work on the `Relic Radiation' (a much

  1. NEW BOOKS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Qing Dynasty Archives On the Dalai lamasThe Dalai Lama was one of the two leaders of the Gelug (Yellow) Sect of Tibetan Buddhism. It won the honorific title of the Dalai lama in 1653 from Qing Emperor Shunzhi, and the Living Buddha had since been following the reincarnation system under the supervision of the Central Government. His soul boy was not legal until he won the confirmation of the Central Government. Whenever there is the need not to go through the set system, Central Government permission is a must.The Dalai Lama also did his best to seek authorization of the Central Government which would therefore issue him certificate of authority and seal of power.All these were recorded in archives, part of which are contained in the book. Its major chapters contain 154 pieces of archives related with certification of the Dalai Lama and the Panchen Erdeni under the reign of Qing Emperor Shunzhi, the demise of the Dalai Lama and the Panchen Erdeni, efforts made to look for their soul boys, selection of th

  2. Book reviews

    Directory of Open Access Journals (Sweden)

    T. Abdel-Motey., C. Urfels., K. Rodriguez., J. Mardikian., J.A. Drobnicki., V. Diodato.

    2000-10-01

    Full Text Available Title:(1 The Library and Information Professional’s Guide to the Internet. (2 Reinvention of the Public Library for the 21st Century. (3 Public Library Collection Development in the Information Age. (4 Making Sense of Journals in the Life Science: From Specialty Origins to Contemporary Assortment. (5 The Holocaust: Memories, Research, Reference. (6 How to Index Your Local Newspaper Using WordPerfect or Microsoft Word for Windows. (7 Effective Utilization and Management of Emerging Information Technologies. (8 Information Technology and Organizations: Challenges of New Technologies. (9 Facilities Planning for School Media and Technology Centers. (10 Libraries Without Walls 2: The Delivery of Library Services to Distance Users. (11 New International Directions in HIV Prevention for Gay and Bisexual Men. (12 Soaring to Excellence Videos: Tools of Our Trade III: Books, the Internet, and Beyond.Author:(1Reviewed by Teresa Abdel-Motey. (2Review by Claire Urfels. (3Reviewed by Dr. Ketty Rodriguez. (4Reviewed by Jackie Mardikian. (5Reviewed by John A. Drobnicki.(6Reviewed by Dr. Virgil Diodato. (7Reviewed by Dr. Lisa M. Covi. (8Reviewed by Tom Zillner. (9Reviewed by Dr. W. Bernard Lukenbill. (10Reviewed by Dr. Elizabeth Buchanan. (11Reviewed by Aisha White. (12Reviewed by Phyllis Tragash

  3. Book Reviews

    Directory of Open Access Journals (Sweden)

    Hans Antlöv

    1996-04-01

    , vii + 231 pp., Ulricht Mai (eds. - Tineke Hellwig, Brigitte Müller, Op de wipstoel; De niet-gewettigde inheemse vrouw van de blanke Europeaan in Nederlands-Indië (1890-1940; Een literatuuronderzoek naar beeldvorming en werkelijkheid. Amsterdam: Vakgroep Culturele Antropologie/Sociologie der Niets-Westerse Samenlevingen, 1995, xii + 131 pp. - Jan van der Putten, Liaw Yock Fang, Standard Malay made simple. Singapore: Times Books International, 1988. - Jan van der Putten, Liaw Yock Fang, Standard Indonesian made simple, written with the assistance of Nini Tiley-Notodisuryo, Singapore: Times Books International, 1990. - Jan van der Putten, Liaw Yock Fang, Speak standard Malay; A beginner’s guide. Singapore: Times Books International, 1993, xxii + 280 pp. - Jan van der Putten, Liaw Yock Fang, Speak Indonesian; A beginner’s guide, written in collaboration with Munadi Padmadiwiria and Abdullah Hassan. Singapore: Times Books International, 1990. - Alle G. Hoekema, Chr.G.F. de Jong, Geschiedenis van de Nederlandse Zending op Zuid-Sulawesi 1852-1966; Een bronnenpublicatie. Oegstgeest: Raad voor de Zending der Nederlands Hervormde Kerk, 1995, xi + 524 pp. - George Hotze, Ronald G. Gill, De Indische stad op Java en Madura; Een morfologische studie van haar ontwikkeling. Delft: Publikatieburo Bouwkunde, Technische Universiteit Delft, 1995, 350 pp. - H.A.J. Klooster, Holk H. Dengel, Neuere Darstellung der Geschichte Indonesiens in Bahasa Inonesia; Entwicklung und Tendenzen der indonesischen Historiographie. Stuttgart: Steiner, 1994, vii + 269 pp. - Harry A. Poeze, Hans Antlöv, Imperial policy and Southeast Asian nationalism 1930-1957. Richmond: Curzon Press, 1995, xiii + 323 pp., Stein Tonnesson (eds. - P.W. Preston, Michael Hill, The politics of nation building and citizenship in Singapore. London: Routledge, 1995, x + 285 pp., Lian Kwen Fee (eds. - J.W. (Pim Schoorl, Michael Southon, The navel of the perahu; Meaning and values in the maritime trading economy of a Butonese

  4. Book Reviews

    Directory of Open Access Journals (Sweden)

    Christopher Clapham

    2014-07-01

    Full Text Available This publication includes reviews of the following books:The Horn of Africa by Kidane Mengisteab. Cambridge: Polity, 2014. £15.99 (pbk.. Pp. 240+index. ISBN: 9780745651217. Review by Christopher Clapham. Ethiopia: the last two frontiers by John Markakis. Woodbridge: James Currey, 2011. Pp. 399. $34.95 (pbk.. ISBN: 9781847010742. Review by Christopher Clapham.Regime change and succession politics in Africa: five decades of misrule, edited by Maurice Nyamanga Amutabi and Shadrack Wanjala Nasong’o. New York and London: Routledge, 2013. Pp. 237+bibliography+index, £80.00 (hbk. ISBN13: 9780415534086. Review by Tim Kelsall.China’s resource diplomacy in Africa: powering development? by Marcus Power, Giles Mohan and May-Tan Mullins. New York and Basingstoke: Palgrave MacMillan, 2012. Pp. 329 + xix, £63 (hbk.. ISBN: 9780230229129. Review by Pádraig Carmody.Dealing with government in South Sudan: histories of chiefship, community and state by Cherry Leonardi. Suffolk: James Currey (Eastern African Series, 2013. Pp. 224 + notes + bibliography + index. £45.00 (hbk. ISBN: 9781847010674. Review by Jonathan Fisher. 

  5. Book Reviews

    Directory of Open Access Journals (Sweden)

    Alistair Lamb

    1964-10-01

    Full Text Available - B.V.A. Röling, Paul Shepard, Psycholex. Megwa, New York, 1960. 144 blz. - L. Sluimers, J.F. Cady, Southeast Asia: Its historical development. New York etc., McGraw-Hill Book Company, 1964. XVII, 657, IX blz., foto, krtn. - H.J. de Graaf, Nicholas Tarling, Piracy and politics in the Malay world. A study of British imperialism in nineteenth-century Sout-East Asia. F.W. Cheshire, Melbourne, Canberra, Sydney, 1963. 273 pp., frontispiece, endpaper maps. - W. Brand, N.A. Simoniya, Overseas Chinese in Southeast Asia - A Russian study. Data Paper Number 45, Southeast Asia Program, Department of Far Eastern Studies, Cornell University Press, Ithaca, New York, December 1961, 151 blz. - B.H.M. Vlekke, Alistair Lamb, The China-India border, The origins of the disputed boundaries. Published for the Royal Institute of International Affairs by Oxford University Press, London 1964, XVI + 192 pp. - R.S. Karni, Beda Lim, Malaya, a background bibilography. Journal Malayan Branch, RAS, vol. XXXV, pts. 2 & 3, 1962; V. 199 pp. - L. Sluimers, R.K. Goldsen, Factors related to acceptance of innovation in Bang Chan, Thailand; Analysis of a survey conducted by the Cornell Cross-cultural Methodology Project, May 1955. Cornell Thailand Project Interim Report Series no. 3. Data Paper: No. 25 Southeast Asia Program Department of Far Eastern Studies Cornell University. 3de druk, Ithaca, Cornell University Press, 1963. VIII, 72, X blz., M. Rallis (eds.

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    A.J. Bernet Kempers

    1978-10-01

    Full Text Available - B.J. Boland, G.F. Pijper, Studiën over de geschiedenis van de Islam in Indonesia, 1900-1950. Leiden: E.J. Brill, 1977. 160 pp., 10 ill. - H.J.M. Claessen, Francis Edgar Williams, “The Vailala Madness” and other essays. Edited and with an introduction by Erik Schwimmer. London: C. Hurst and Company. 1976. 432 pp. Maps, bibliography, index. - J.E. van Lohuizen-de Leeuw, A.J. Bernet Kempers, Ageless Borobudur - Buddhist mystery in stone - Decay and restoration - Mendut and Pawon - Folklife in ancient Java. Katwijk aan Zee, Servire, 1976. 288 pp., 225 illustrations. - A. de Ruijter, G.N. Appell, The societies of Borneo. Explorations in the theory of cognatic social structure. A special publication of the American Anthropological Association, number 6, Washington, 1976. 160 pp.

  7. Developing a model: an illustration.

    Science.gov (United States)

    Havenga, Yolanda; Poggenpoel, Marie; Myburgh, Chris

    2014-04-01

    Model development may seem a daunting task for the novice. The purpose of this article is to illustrate the steps of model development applied to a real-life phenomenon using an inductive theory-generating research approach. The value of the illustration is that nurse researchers can follow the application of the process as a point of departure for their own work. A logical stepwise discussion is followed for empirical theory development. The logical thought process from identifying the phenomenon to describing the model as a visual metaphor of the phenomenon is illustrated.

  8. 二部图的K1,4-因子分解%K1,4-factorization of bipartite graphs

    Institute of Scientific and Technical Information of China (English)

    王建

    2001-01-01

    Km,n的K1,k-因子分解问题已被多位研究者所研究,当k=2时Km,n具有K1,2-因子分解的存在性问题已被Ushio完全解决.当k=3时Wang研究了Km,n的K1,3-因子分解问题,并给出了Km,n具有K1,3-因子分解的一个充分条件.本文研究Km,n的K1,4-因子分解问题,并给出Km,n具有K1,4-因子分解的一个充分条件.%The K1,k-factorization of complete bipartite graph Km,n has been studied by severalresearchers. When k = 2 , the spectum problem for K1,2-factorization of Km,n has been com-pletely solved by Ushio. When k=3, Wang investigated K1,3-factorization of Km, n and gavea sufficient condition for such a factorization to exist. In this paper, we investigate K1,4-fac-torization of Km, n, and give a sufficient condition for such a factorization to exist.

  9. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2010-09-01

    upland Southeast Asia. (Guido Sprenger Guido Sprenger, Die Männer, die den Geldbaum fällten; Konzepte von Austausch und Gesellschaft bei den Rmeet von Takheung, Laos. (Oliver Tappe Review Essay Two books on East Timor. Carolyn Hughes, Dependent communities; Aid and politics in Cambodia and East Timor. David Mearns (ed., Democratic governance in Timor-Leste; Reconciling the local and the national. (Helene van Klinken Review Essay Two books on Islamic terror Zachary Abuza, Political Islam and violence in Indonesia. Noorhaidi Hasan, Laskar jihad; Islam, militancy, and the quest for identity in post-New Order Indonesia. (Gerry van Klinken Korte Signaleringen Janneke van Dijk, Jaap de Jonge en Nico de Klerk, J.C. Lamster, een vroege filmer in Nederlands-Indië. Griselda Molemans en Armando Ello, Zwarte huid, oranje hart; Afrikaanse KNIL-nazaten in de diaspora. Reisgids Indonesië; Oorlogsplekken 1942-1949. Hilde Janssen, Schaamte en onschuld; Het verdrongen oorlogsverleden van troostmeisjes in Indonesië. Jan Banning, Comfort women/Troostmeisjes. (Harry Poeze

  10. Book Review:

    Science.gov (United States)

    Carlip, S.

    2006-10-01

    The early 1980s, when I first learned theory, were desperate times for graduate students. We searched frantically for coherent introductions, passing tattered copies of review articles around like samizdat, struggling over obscure references to ancient models of strong interactions, and flocking to lectures—not least those by Joe Polchinski—that promised to really explain what was going on. If only this book had been around, it would have saved much grief. Volume I, The Bosonic String, offers a clear and well organized introduction to bosonic string theory. Topics range from the 'classical' (spectra, vertex operators, consistency conditions, etc.) to the 'modern' (D-branes first appear in an exercise at the end of chapter 1, noncommutative geometry shows up in chapter 8). Polchinski does not hesitate to discuss sophisticated matters—path integral measures, BRST symmetries, etc.—but his approach is pedagogical, and his writing is lucid, if sometimes a bit terse. Chapters end with problems that are sometimes difficult but never impossible. A very useful annotated bibliography directs readers to resources for further study, and a nearly 30-page glossary provides short but clear definitions of key terms. There is much here that will appeal to relativists. Polchinski uses the covariant Polyakov path integral approach to quantization from early on; he clearly distinguishes Weyl invariance from conformal invariance; he is appropriately careful about using complex coordinates on topologically nontrivial manifolds; he keeps the string world sheet metric explicit at the start instead of immediately hiding it by a gauge choice. Volume II includes an elegant introduction to anticommuting coordinates and superconformal transformations. A few conventions may cause confusion—%, Polchinski's stress energy tensor, for instance, differs from the standard general relativistic definition by a factor of -2π, and while this is briefly mentioned in the text, it could easily be

  11. Earth Day Illustrated Haiku Contest

    Science.gov (United States)

    2007-02-01

    As part of their 2007 Chemists Celebrate Earth Day Celebration, the American Chemical Society is sponsoring an illustrated haiku contest for students in grades K 12 around the theme, Recycling—Chemistry Can!

  12. Book Review:

    Science.gov (United States)

    Borcherds, P. H.

    2004-09-01

    There is a new tradition in England called Apple Day which is held on some day in October. The actual day varies from place to place. For instance, in 2003, 23 October was Apple Day at Woolsthorpe Manor, the house where Isaac Newton was born and where, during the Plague, he is said to have developed the theory of gravity. (For information on future Apple Days see, for example, http://www.nationaltrust.org.uk/main/thingstodo.) Last year in our garden we picked an apple which weighed one pound, thirteen and a half ounces (1 lb 13 1/2 oz or 29 1/2 oz). The following day we went to an Apple Day event where there were many exotic apples on display, varieties which are not sold in shops. One of the varieties there was called 'Twenty Ounce'. By now you may be wondering what all this has to do with the book being reviewed. We shall return to this later. This entertaining book is ostensibly about units, in particular about Imperial and metric units, but there are numerous informative digressions. The author reminds us that almost every country 'with the exception of the United States, North and South Yemen, Burma and Brunei' has gone metric. He points out that the United States (US) became officially metric in 1893. However, as early as 1866, the US legal definition of the metre was 39.370000 inches. He tells us that after World War II the (US) inch was rounded down (from 25.400051) to 25.4 mm. There is no mention that the Imperial (British) inch was simultaneously rounded up from 25.399956 mm to 25.4 mm. The author frequently digresses, covering such matters as the trisection of angles and Eratosthenes' graphic solution for duplicating the cube. There is an informative discussion on the length of the day: appropriately 25 December, which lasts for 24 h and 30 s, is the longest day. He shows how with cycles and epicycles one can construct an ellipse. Ptolemy did not realize the importance of the focus of the ellipse. The author discusses various topics in the development of

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Noorduyn

    1982-10-01

    Full Text Available - C. van Dijk, M.C. Ricklefs, A history of modern Indonesia. C. 1300 to the present, London and Basingstoke, The MacMillan Press Ltd., 1981. xii + 335 pp. MacMillan Asian Histories Series. - L.A. Hoedemaker, S.C. Graaf van Randwijck, Handelen en denken in dienst der zending (Oestgeest 1897-1942, 2 delen, Den Haag Boekencentrum, 1981. - G.J. Knaap, Hubert Jacobs SJ, Documenta Malucensia II (1577-1606, annotated by Hubert Jacobs SJ, Monumenta Missionum Societatis Iesu volumen XXXIX, Missiones Orientalis, Rome, Jesuit Historical Institute; 1980, XXXI + 65* + 794 blz. - David S. Moyer, H. Sutherland, The making of a bureaucratic elite; The colonial transformation of the Javanese Priyayi, Asian studies association of Australia, Southeast Asia publication series no. 2, Heinemann educational books (Asia, Singapore, Kuala Lumpur, Hong Kong, 1979, xx + 182 pp. - S.A. Niessen, Garrett Solyom, The world of the Javanese Keris, 1978, East-West Centre, Honolulu, Hawaii., Bronwen Solyom (eds. - S.A. Niessen, Anne Leonard, Patterns of Paradise; The styles and significance of bark cloth around the world, 1980, Field museum of natural history., John Terrell (eds. - S.A. Niessen, Kirk Endicott, Batek Negrito Religion, 1979, Oxford Clarendon Press. - J. Noorduyn, Olivier Carré, L’Islam et l’état dans le monde d’aujourd’hui, Paris, Presses Universitaires de France, 1982. 270 p. - H.A. Poeze, Joop Morriën, Indonesië los van Holland. De CPN en de PKI in hun strijd tegen het Nederlands kolonialisme, Pegasus Amsterdam, 1982, 272 pp.

  14. Book Reviews

    Directory of Open Access Journals (Sweden)

    Yu. V. Maretin

    1975-01-01

    Full Text Available - J. Prins, Buiten de grenzen, sociologische opstellen aangeboden aan Prof. Dr. W.F. Wertheim, benevens een “bibliografie van de geschriften van W.F. Wertheim”. Boom, Meppel 1971. 365 blz. - H.C.G. Schoenaker, Ethnologische Zeitschrift Zuerich I, 1972. Festschrift Alfred Steinmann. Verlag Herbert Lang & Cie A.G., Bern. 397 pp. - J.C. Neuteboom, Harald Eidheim, Aspects of the Lappish minority situation. Universitetsforlaget, Oslo 1971. 86 pags. Fig. - H.J.M. Claessen, Paul Ottino, Rangiroa; parenté étendue, résidence et terres dans un atoll ploynésien. Editions Cujas. Paris 1972. 530 p. Bibl., appendices, 37 fig. en kaarten, registers. - David S. Moyer, Adelin Linton, Ralph Linton. Leaders of Modern Anthropological Series, American University Publishers Group. London 1971, pp. 196., C. Wagley (eds. - R.A.M. van Zantwijk, Carlo J.E. Gay, Chalcacingo. Drawings by Frances Pratt. Akademische Druck- und Verlagsanstalt. Graz 1971. 119 blz., geïll., XXIV fotopag. - P. van Emst, Yu. V. Maretin, Countries and peoples of the East. Vol. XIII, Countries and peoples of the Pacific Basin. Book 2. Nauka Publishing House. Central Department of Oriental Literature. Moscow 1972. (Strany i narody vostoka. Pod obscej redakciej D.A. Ol’derogge. Vypusk XIII. Strany i narody bassejna Tichogo Okeana. Kniga 2. - H. van Mierlo, Atlantische Commissie, De school en het buitenlands beleid IX. De internationale politieke vormingstaak van de school. Atlantische Commissie, Den Haag 1970, 56 blz. - Geert A. Banck, Philip Staniford, Pioneers in the tropics. The political organization of Japanese in an immigrant community in Brazil. London School of Economics Monographs on Social Anthropology no. 45. London; The Athlone Press. 1973. xvi + 201 pag.

  15. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-07-01

    W. Collinwood ,Modern Bahamian society. Parkersburg IA: Caribbean Books, 1989. 278 pp., Steve Dodge (eds -Peter Hulme, Pierrette Frickey, Critical perspectives on Jean Rhys. Washington DC: Three Continents Press, 1990. 235 pp. -Alvina Ruprecht, Lloyd W. Brown, El Dorado and Paradise: Canada and the Caribbean in Austin Clarke's fiction. Parkersburg IA: Caribbean Books, 1989. xv + 207 pp. -Ineke Phaf, Michiel van Kempen, De Surinaamse literatuur 1970-1985: een documentatie. Paramaribo: Uitgeverij de Volksboekwinkel, 1987. 406 pp. -Genevieve Escure, Barbara Lalla ,Language in exile: three hundred years of Jamaican Creole. Tuscaloosa AL: University of Alabama Press, 1990. xvii + 253 pp., Jean D'Costa (eds -Charles V. Carnegie, G. Llewellyn Watson, Jamaican sayings: with notes on folklore, aesthetics, and social control.Tallahassee FL: Florida A & M University Press, 1991. xvi + 292 pp. -Donald R. Hill, Kaiso, calypso music. David Rudder in conversation with John La Rose. London: New Beacon Books, 1990. 33 pp. -Mark Sebba, John Victor Singler, Pidgin and creole tense-mood-aspect systems. Amsterdam and Philadelphia: John Benjamins, 1990. xvi + 240 pp. -Dale Tomich, Pedro San Miguel, El mundo que creó el azúcar: las haciendas en Vega Baja, 1800-873. Río Piedras, Puerto Rico: Ediciones Huracán, 1989. 224 pp. -César J. Ayala, Juan José Baldrich, Sembraron la no siembra: los cosecheros de tabaco puertorriqueños frente a las corporaciones tabacaleras, 1920-1934. Río Piedras, Puerto Rico: Ediciones Huracán, 1988. -Robert Forster, Jean-Michel Deveau, La traite rochelaise. Paris: Kathala, 1990. 334 pp. -Ernst van den Boogaart, Johannes Menne Postma, The Dutch in the Atlantic slave trade, 1600-1815. Cambridge: Cambridge University Press, 1990. xiv + 428 pp. -W.E. Renkema, T. van der Lee, Plantages op Curacao en hun eigenaren (1708-1845: namen en data voornamelijk ontleend aan transportakten. Leiden, the Netherlands: Grafaria, 1989. xii + 87 pp. -Mavis C. Campbell, Wim

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    Full Text Available -Selwyn R. Cudjoe, John Thieme, The web of tradition: uses of allusion in V.S. Naipaul's fiction, -A. James Arnold, Josaphat B. Kubayanda, The poet's Africa: Africanness in the poetry of Nicolás Guillèn and Aimé Césaire. Westport CT: Greenwood, 1990. xiv + 176 pp. -Peter Mason, Robin F.A. Fabel, Shipwreck and adventures of Monsieur Pierre Viaud, translated by Robin F.A. Fabel. Pensacola: University of West Florida Press, 1990. viii + 141 pp. -Alma H. Young, Robert B. Potter, Urbanization, planning and development in the Caribbean, London: Mansell Publishing, 1989. vi + 327 pp. -Hymie Rubinstein, Raymond T. Smith, Kinship and class in the West Indies: a genealogical study of Jamaica and Guyana, Cambridge: Cambridge University Press, 1988. xiv + 205 pp. -Shepard Krech III, Richard Price, Alabi's world, Baltimore and London: Johns Hopkins University Press, 1990. xx + 445 pp. -Graham Hodges, Sandra T. Barnes, Africa's Ogun: Old world and new, Bloomington & Indianapolis: Indiana University Press, 1989. xi + 274 pp. -Pamela Wright, Philippe I. Bourgois, Ethnicity at work: divided labor on a Central American banana plantation, Baltimore MD: John Hopkins University Press, 1989. xviii + 311 pp. -Idsa E. Alegría-Ortega, Andrés Serbin, El Caribe zona de paz? geopolítica, integración, y seguridad, Caracas: Editorial Nueva Sociedad, 1989. 188 pp. (Paper n.p. [Editor's note. This book is also available in English: Caribbean geopolitics: towards security through peace? Boulder CO: Lynne Rienner, 1990. -Gary R. Mormino, C. Neale Ronning, José Martí and the émigré colony in Key West: leadership and state formation, New York; Praeger, 1990. 175 pp. -Gary R. Mormino, Gerald E. Poyo, 'With all, and for the good of all': the emergence of popular nationalism in the Cuban communities of the United States, 1848-1898, Durham NC: Duke University Press, 1989. xvii + 182 pp. -Fernando Picó, Raul Gomez Treto, The church and socialism in Cuba, translated from

  17. The Economics of Books

    OpenAIRE

    Canoy, M.F.M.; Ours, J. C. van; van der Ploeg, F.

    2005-01-01

    The tensions between books and book markets as expressions of culture and books as products in profit-making businesses are analysed and insights from the theory of industrial organisation are given. Governments intervene in the market for books through laws concerning prices of books, grants for authors and publishers, a lower value-added tax, public libraries and education in order to stimulate the diversity of books on offer, increase the density of retail outlets and to promote reading. A...

  18. Traditional to Digital Books

    Institute of Scientific and Technical Information of China (English)

    JING XIAOLEI

    2010-01-01

    @@ A book fair wouldn't be a book fair without books.And while the number of book fairs in China has increased in recent years,the Guangzhou Book Fair has been helping to redefine the very nature of books by promoting digital works and reading technology.This year,the fair again set up an exclusive digital reading experience exhibition hall to showcase the host province's latest achievements in the field.

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Lynn Pan

    2000-04-01

    Full Text Available - Matthew Amster, Jérôme Rousseau, Kayan religion; Ritual life and religious reform in Central Borneo. Leiden: KITLV Press, 1998, 352 pp. [VKI 180.] - Atsushi Ota, Johan Talens, Een feodale samenleving in koloniaal vaarwater; Staatsvorming, koloniale expansie en economische onderontwikkeling in Banten, West-Java, 1600-1750. Hilversum: Verloren, 1999, 253 pp. - Wanda Avé, Johannes Salilah, Traditional medicine among the Ngaju Dayak in Central Kalimantan; The 1935 writings of a former Ngaju Dayak Priest, edited and translated by A.H. Klokke. Phillips, Maine: Borneo Research Council, 1998, xxi + 314 pp. [Borneo Research Council Monograph 3.] - Peter Boomgaard, Sandra Pannell, Old world places, new world problems; Exploring issues of resource management in eastern Indonesia. Canberra: Centre for Resource and Environmental Studies, Australian National University, 1998, xiv + 387 pp., Franz von Benda-Beckmann (eds. - H.J.M. Claessen, Geoffrey M. White, Chiefs today; Traditional Pacific leadership and the postcolonial state. Stanford, California: Stanford University Press, 1997, xiv + 343 pp., Lamont Lindstrom (eds. - H.J.M. Claessen, Judith Huntsman, Tokelau; A historical ethnography. Auckland: Auckland University Press, 1996, xii + 355 pp., Antony Hooper (eds. - Hans Gooszen, Gavin W. Jones, Indonesia assessment; Population and human resources. Canberra: Research School of Pacific and Asian Studies, Australian National University, 1997, 73 pp., Terence Hull (eds. - Rens Heringa, John Guy, Woven cargoes; Indian textiles in the East. London: Thames and Hudson, 1998, 192 pp., with 241 illustrations (145 in colour. - Rens Heringa, Ruth Barnes, Indian block-printed textiles in Egypt; The Newberry collection in the Ashmolean Museum, Oxford. Oxford: Clarendon Press, 1997. Volume 1 (text: xiv + 138 pp., with 32 b/w illustrations and 43 colour plates; Volume 2 (catalogue: 379 pp., with 1226 b/w illustrations. - H.M.J. Maier, David T. Hill, Beyond the

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Harry A. Poeze

    1988-04-01

    Full Text Available - Leonard Y. Andaya, J. Noorduyn, Bima en Sumbawa; Bijdragen tot de geschiedenis van de Sultanaten Bima en Sumbawa door A. Ligtvoet en G.P. Rouffaer, Dordrecht-Holland/Providence-U.S.A.: Foris publications, ix, 187 pp, maps, indexes. - Ben Arps, Philip Yampolsky, Lokananta; A discography of the national recording company of Indonesia 1957-1985, Madison, Wisconsin: Center for Southeast Asian studies, University of Wisconsin, Bibliographical series No. 10, 1987. XIII + 433 pp. - Victoria M. Clara van Groenendael, Ward Keeler, Javanese shadow plays, Javanese selves, New Jersey: Princeton University Press, 1987. xvii + 282 pages. Illustrations, photographs, bibliography, glossary, index. - Jean Gelman Taylor, Leonard Blussé, Strange company. Chinese settlers. Mestizo women and the Dutch in VOC Batavia. Verhandelingen van het Koninklijk Instituut voor Taal-, Land- en Volkenkunde, Dordrecht: Foris publications, 1986. - V.J.H. Houben, R.B. van de Weijer, Tussen traditie en wetenschap; Geschiedbeoefening in niet-westerse culturen, Nijmegen 1987., P.G.B. Thissen, R. Schönberger (eds. - V.J.H. Houben, J. van Goor, Indië/Indonesië; Van kolonie tot natie, HES, Utrecht 1987. - F.G.P. Jaquet, Th. van den End, Gereformeerde zending op Sumba (1859-1972, een bronenpublicatie, bewerkt door Th. van den End. Alphen aan den Rijn: Aska, 1987. XIV, 743 pp. Uitgave van de Raad voor de Zending der Nederlands Hervormde Kerk, de Zending der Gereformeerde Kerken in Nederland en de Gereformeerde Zendingsbond in de Nederlandse Hervormde Kerk. - R.E. Jordaan, Roland Werner, Bomoh/Dukun; The practices and philosophies of the traditional Malay healer, Berne; Institute of Ethnology (Studia ethnologica Bernensia 3, 1986. 106 pp., illustrations and photographs. - P.E. de Josselin de Jong, Werner Kraus, Zwischen reform und rebellion: Über die Entwicklung des Islams in Minangkabau (Westsumatra zwischen den beiden Reformsbewegungen der Padri (1837 und der Modernisten (1908

  1. Radiology illustrated. Gynecologic imaging. 2. ed.

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung Hyup (ed.) [Seoul National Univ. Hospital (Korea, Republic of). Dept. of Radiology

    2012-07-01

    Up-to-date and image-oriented for use in clinical practice. Chapters are organized by disease entity for quick reference. Includes high-quality images and schematic drawings. Radiology Illustrated: Gynecologic Imaging is an up-to-date, image-oriented reference in the style of a teaching file that has been designed specifically to be of value in clinical practice. Individual chapters focus on the various imaging techniques, normal variants and congenital anomalies, and the full range of pathology. Each chapter starts with a concise overview, and abundant examples of the imaging findings are then presented. In this second edition, the range and quality of the illustrations have been enhanced, and image quality is excellent throughout. Many schematic drawings have been added to help readers memorize characteristic imaging findings through pattern recognition. The organization of chapters by disease entity will enable readers quickly to find the information they seek. Besides serving as an outstanding aid to differential diagnosis, this book will provide a user-friendly review tool for certification or recertification in radiology.

  2. Book Review:

    Science.gov (United States)

    Fulling, S. A.

    2006-05-01

    saying that gravity was not only an honourable member of the forces of nature, but ultimately the source of them all. It has become a cliche that the unification of relativity with quantum theory is the central problem of contemporary physics. In the 1950s, before strings, non-Abelian monopoles, or even quasars, Bryce DeWitt was applying the quantum-field-theoretical methods and conceptual framework of his mentor, Julian Schwinger, to gravity. His central insight was that the conceptual and technical problems of quantum gravity were closely analogous to those of gauge theories. He developed a unified, relentlessly abstract, and highly personal vision of the fundamentals of physical theory. It was, and is, expressed in idiosyncratic and condensed notation often different from the languages of mainstream field theorists, traditional relativists, and mathematicians alike. In short, he has never been easy reading. His ideas were systematically presented in famous lecture series at the Les Houches summer schools on Relativity, Groups and Topology in 1963 [1] and 1983 [2], the book Supermanifolds [3], and a number of (relatively) shorter expositions that have been widely read. By the middle 1970s the methods that he had developed mainly for gravity were widely recognized as very useful for Yang Mills gauge theories, and his work had become part of the mainstream. Now, another 20 years after the second Les Houches, we have this final testament of Bryce DeWitt's ideas. At over 1000 pages in two volumes in a fabric-covered slipcase, it is the sort of work usually described as 'magisterial' (meaning, perhaps, 'no one has yet succeeded in reading it all the way through'). Over the years, of course, DeWitt learned many new things and thought of ways to say the old things better. Accordingly, the new books consist of reworkings of the most important parts of the older writings together with some new material. Oxford University Press is to be thanked and congratulated for the care it

  3. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1968-07-01

    Full Text Available - C. von Fürer-Haimendorf, Bernard Pignède, Les Gurungs. Une population himalayenne du Népal. École pratique des hautes études-Sorbonne. Le monde d’outre-mer passé et présent. Études XXI. Mouton & Co. Paris - La Haye 1966. 414 pp., illustrated. - C. von Fürer-Haimendorf, Matthias Hermanns, Die religiös-magische Weltan-schauung der Primtivstamme Indiens. Band II. Die Bhilala, Korku, Gond, Baiga. Franz Steiner Verlag. Wiesbaden 1966. 571 pages, 70 illustrations, 1 map. - J. Gonda, Vidyanand “Videh”, The exposition of the Vedas, vol. I (translated from Hindi, Veda-Samsthana, Ajmer, India, 1964. 133 p. - J. Gonda, Vidyanand “Videh”, The Vedic prayers, translated from Hindi by B. Bhushan Hajela, Veda-Samsthana, Ajmer, India, 1964. 108 p. - Edmund R. Leach, M. Nash et al., Anthropological Studies in Theravada Buddhism. Yale University: South East Asia Studies. Cultural Report Series No. 13 (1966. xiv, 236 pp., with maps, charts, glossary. - Frank M. le Bar, L.M. Hanks, Ethnographic notes on Northern Thailand. Cornell University Southeast Asia Program. Data Paper No. 58. Ithaca, 1965. xi, 94 pp., maps, tables., J.R. Hanks, Lauriston Sharp (eds. - Lorenz G. Löffler, Lucien Bernot, Les paysans arakanais du Pakistan oriental; l’histoire, le monde végétal et l’organisation sociale des réfugiés Marma (Mog. Le Monde d’Outre-Mer Passé et Présent, lère série: Études XVI, Mouton & Co, Paris-La Haye 1967, 793 pp. (en deux volumes. - C.H.M. Nooy-Palm, Donn V. Hart, Southeast Asian birth customs, three studies in human reproduction. Behavior Science Monographs, Human Relations Area Files Press. New Haven, Connecticut 1965. 303 pp., Phya Anuman Rajadhon, Richard J. Coughlin (eds. - J.W. Minderhout, Charles F. Keyes, Isan: Regionalism in northeastern Thailand. Data Paper: nr. 65, Southeast Asia Program, Department of Asian Studies, Cornell University, Ithaca, New York, March 1967. 86 pp. - J.M. Pluvier, Truong Buu Lam, Patterns of

  4. Newnes radio and electronics engineer's pocket book

    CERN Document Server

    Moorshead, H W; Perry, J

    1978-01-01

    Newnes Radio and Electronics Engineer's Pocket Book, Fifteenth Edition provides reference of the information relevant in radio and electronics engineering. The book presents tables, illustrations, and diagrams of various data used in radio and electronics engineering. The coverage of the text includes abbreviations and symbols, electrical equations, and code conversions. The text will be useful to engineers, technicians, and other professionals who require a reference about the different aspects of radio and electronics.

  5. Cultivos de células CHO-K1

    Directory of Open Access Journals (Sweden)

    M.C. Nóvoa-Valiñas

    2005-01-01

    Full Text Available El uso de determinados metales pesados y pesticidas es la estrategia más empleada para el control de plagas. Estas sustancias, una vez aplicadas a los cultivos, pueden pasan al medio ambiente, permaneciendo en él como xenobióticos que van a afectar, en mayor o menor medida, a los seres vivos. En el presente estudio se ha evaluado la toxicidad basal de un metal, cobre, y un pesticida organoclorado, lindano, así como mezclas de ambos a distintas concentraciones. Para llevar a cabo este trabajo se ha utilizado la línea celular CHO-K1 (células epiteliales de ovario de hamster, usándose como criterio de citotoxicidad la muerte celular, determinada mediante la técnica del rojo neutro. Las concentraciones iniciales fueron: 0,03; 0,06 y 0,9 mM de cobre y 0,01; 0,03 y 0,1 mM de lindano. Y en las mezclas, las concentraciones estuvieron comprendidas entre 0,01-0,9 de cobre y 0,001-0,1de lindano. Como resultados, la citotoxicidad del cobre y lindano fue dosis-dependiente. En las exposiciones a mezclas se observa que a concentraciones fijas de lindano, la viabilidad desciende al aumentar la concentración de cobre, mientras que, dentro de un cierto rango, a concentraciones fijas de cobre, la viabilidad celular se incrementa al aumentar la concentración de lindano

  6. 计算n∑k=1 f(k)的一个初等方法

    Institute of Scientific and Technical Information of China (English)

    杨欣芳

    1994-01-01

    本文利用二项式定理推出前n个自然数的各次方和公式,进而将n∑k=1 f(k)=n∑k=1 (ackm+a1km-1+...+am-1k+am)写成n∑k=1 km+a1n∑k=1 km-1+...+am-1n∑k=1 K+amn∑k=1 1从而进行有关的计算。

  7. Measurement of Branching Fractions of B0 Decays to K1(1270)+ pi- and K1(1400)+ pi-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, Bernard; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, Antimo; Pappagallo, M.; /Bari U. /INFN, Bari; Eigen, G.; Stugu, Bjarne; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, Robert N.; Jacobsen, R.G.; /LBL, Berkeley /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /Ferrara U. /INFN, Ferrara /Frascati /Genoa U. /INFN, Genoa /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /Consorzio Milano Ricerche /INFN, Milan /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /Napoli Seconda U. /INFN, Naples /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /Padua U. /INFN, Padua /Paris U., VI-VII /Pennsylvania U. /Perugia U. /INFN, Perugia /INFN, Pisa /Princeton U. /Banca di Roma /Frascati /Rostock U. /Rutherford /DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /Turin U. /INFN, Turin /Trieste U. /INFN, Trieste /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2008-08-04

    We present a measurement of the branching fraction of neutral B meson decaying to final states containing a K1 meson, i.e. K{sub 1}(1270) and K{sub 1}(1400), and a charged pion. The data, collected with the BABAR detector at the Stanford Linear Accelerator Center, represent 454 million B{bar B} pairs produced in e{sup +}e{sup -} annihilation. We measure the branching fraction {Beta}(B{sup 0} {yields} K{sub 1}{sup +}{pi}{sup -}) = (31.0 {+-} 2.7 {+-} 6.9) x 10{sup -6}, where the first error quoted is statistical and the second is systematic. In the framework of the K-matrix formalism used to describe these decays, we also set limits on the ratio of the production constants for the K{sub 1}(1270){sup +} and K{sub 1}(1400){sup +} mesons in B{sup 0} decays.

  8. The role of illustrations in children's inferential comprehension.

    Science.gov (United States)

    Pike, Meredith M; Barnes, Marcia A; Barron, Roderick W

    2010-03-01

    Illustrations are a salient source of information in children's books, yet their effect on children's reading comprehension has been studied only through literal factual recall. The purpose of the current study was to determine the effect of illustrations on bridging inferences, an important aspect of meaning making in comprehension models. Identical short stories were presented under different illustration conditions with pictures that represented different parts of the story. Participants were 73 7- to 11-year-olds. Illustrations both facilitated and interfered with inferencing depending on the type of information depicted; however, this effect was reduced as grade increased. Additional findings were that the overall ability to make inferences increased with age and working memory was a significant predictor of this skill. Results are discussed in relation to cognitive and developmental models of comprehension.

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-10-01

    : KITLV Press, 2002, viii + 246 pp. [Proceedings 5.], Nico Kaptein (eds -Anton Ploeg, William C. Clarke, Remembering Papua New Guinea; An eccentric ethnography. Canberra: Pandanus Books, Research School of Pacific and Asian Studies, Australian National University, 2003, 178 pp. -Nathan Porath, Gerco Kroes, Same hair, different hearts; Semai identity in a Malay context; An analysis of ideas and practices concerning health and illness. Leiden: Research School of Asian, African and Amerindian Studies (CNWS, Universiteit Leiden, 2002, 188 pp. -Guido Sprenger, Grant Evans, Laos; Culture and society. Chiang Mai: Silkworm Books, 1999, xi + 313 pp. -Gerard Termorshuizen, Dik van der Meulen, Multatuli; Leven en werk van Eduard Douwes Dekker. Nijmegen: SUN, 2002, 912 pp. -Paige West, Karl Benediktsson, Harvesting development; The construction of fresh food markets in Papua New Guinea. Copenhagen: Nordic Institute of Asian Studies/Ann Arbor: University of Michigan Press, 2002, xii + 308 pp. -Edwin Wieringa, Amirul Hadi, Islam and state in Sumatra; A study of seventeenth-century Aceh. Leiden: Brill, 2004, xiii + 273 pp. [Islamic History and Civilization, 48.] -Robin Wilson, Pamela J. Stewart ,Remaking the world; Myth, mining and ritual change among the Duna of Papua New Guinea. Washington: Smithsonian Institution Press, 2002, xvi + 219 pp. [Smithsonian Series in Ethnographic Enquiry.], Andrew Strathern (eds

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2002-01-01

    Full Text Available -Stephen J. Appold, Heidi Dahles ,Tourism and small entrepreneurs; Development, national policy, and entrepreneurial culture: Indonesian cases. Elmsford, New York: Cognizant Communication Corporation, 1999, vi + 165 pp., Karin Bras (eds -Jean-Pascal Bassino, Peter Boothroyd ,Socioeconomic renovation in Vietnam; The origin, evolution and impact of Doi Moi. Singapore: Institute of Southeast Asian Studies, 2001, xv + 175 pp., Pham Xuan Nam (eds -Peter Boomgaard, Patrick Vinton Kirch, The wet and the dry; Irrigation and agricultural intensification in Polynesia. Chicago: The University of Chicago Press, 1994, xxii + 385 pp. -A.Th. Boone, Chr.G.F. de Jong, De Gereformeerde Zending in Midden-Java 1931-1975; Een bronnenpublicatie. Zoetermeer: Boekencentrum, 1997, xxiv + 890 pp. [Uitgaven van de Werkgroep voor de Geschiedenis van de Nederlandse Zending en Overzeese Kerken, Grote Reeks 6.] -Okke Braadbaart, Colin Barlow, Institutions and economic change in Southeast Asia; The context of development from the 1960s to the 1990s. Cheltenham: Edward Elgar, xi + 204 pp. -Freek Colombijn, Abidin Kusno, Behind the postcolonial; Architecture, urban space, and political cultures in Indonesia. London: Routledge, 2000, xiv + 250 pp. -Raymond Corbey, Michael O'Hanlon ,Hunting the gatherers; Ethnographic collectors, agents and agency in Melanesia, 1870s -1930s. Oxford: Bergahn Books, 2000, xviii + 286 pp. [Methodology and History in Anthropology 6.], Robert L. Welsch (eds -Olga Deshpande, Hans Penth, A brief histroy of Lan Na; Civilizations of North Thailand. Chiang Mai: Silkworm Books, 2000, v + 74 pp. -Aone van Engelenhoven, I Ketut Artawa, Ergativity and Balinese syntax. Jakarta: Badan Penyelenggaran Seri NUSA, Universitas Katolik Indonesia Atma Jaya, 1998, v + 169 pp (in 3 volumes. [NUSA Linguistic Studies of Indonesian and Other Languages in Indonesia 42, 43, 44.] -Rens Heringa, Jill Forshee, Between the folds; Stories of cloth, lives, and travels from Sumba

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Ratna Saptari

    1994-07-01

    , Harold Brookfield, South-East Asia’s environmental future; The search for sustainability. Tokyo: United Nations University Press, Kuala Lumpur: Oxford University Press, 1993, xxxii + 422 pp., maps, tables, figures, index., Yvonne Byron (eds. - Antje van der Hoek, Keebet von Benda-Beckmann, De emancipatie van Molukse vrouwen in Nederland. Utrecht: Van Arkel,1992, Francy Leatemia-Toma-tala (eds. - Michael Hitchcock, Brita L. Miklouho-Maklai, Exposing Society’s Wounds; Some aspects of Indonesian Art since 1966. Adelaide: Flinders University Asian studies Monograph No.5, illustrations, 1991, iii + 125 pp - Nico Kaptein, Fred R. von der Mehden, Two Worlds of Islam; Interaction between Southeast Asia and the Middle East.Gainesville etc: University Press of Florida 1993, xiii + 128 pp - Nico Kaptein, Karel Steenbrink, Dutch Colonialism and Indonesian Islam; Contacts and Conflicts 1596-1950. Amsterdam-Atlanta, GA: Rodopi, 1993. - Harry A. Poeze, Rudolf Mrázek, Sjahrir; Politics and exile in Indonesia. Ithaca, N.Y.: Cornell University, Southeast Asia Program, 1994. - W.G.J. Remmelink, Takao Fusayama, A Japanese memoir of Sumatra 1945-1946; Love and hatred in the liberation war. Ithaca: Cornell University (Cornell Modern Indonesia Project Monograph series 71, 1993, 151 pp., maps, illustrations. - Ratna Saptari, Diana Wolf, Factory Daughters; Gender, Household Dynamics, and Rural Industrialization in Java. Berkeley: University of California Press, 1992. - Ignatius Supriyanto, Ward Keeler, Javanese Shadow Puppets. Singapore (etc.: Oxford University Press, 1992, vii + 72 pp.,bibl., ills. (Images of Asia. - Brian Z. Tamanaha,S.J.D., Juliana Flinn, Review of diplomas and thatch houses; Asserting tradition in a changing Micronesia. Ann Arbor: University of Michigan Press, 1992. - Gerard Termorshuizen, Dorothée Buur, Indische jeugdliteratuur; Geannoteerde bibliografie van jeugdboeken over Nederlands-Indië en Indonesië, 1825-1991. Leiden, KITLV Uitgeverij, 1992, 470 pp

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Soemarsaid Moertono

    1969-07-01

    Full Text Available - D. van der Horst, Albert Herrmann, An historical atlas of China. New edition by Norton Ginsburg. Djambatan N.V., Amsterdam 1966. 88 pp. - A.F.P. Hulsewé, F.S. Drake, Symposium of historical, archaeological and linguistic studies on Southern China, South-East Asia and the Hongkong region. Proceedings of a meeting held in September 1961 as part of the Golden Jubilee Congress of the University of Hongkong. Hongkong, Hongkong University Press, 1967. X + 370 pp. - D.R. Jonker, Liu Shih-Shun, One hundred and one Chinese poems. With English translations and preface. UNESCO Collection of Representative Works, Chinese Series; Hong Kong University Press, 1967. XXXIX + 173 pp. - M.A.P. Meilink-Roelofsz, A. Das Gupta, Malabar in Asian trade 1740-1800. Cambridge South Asian Studies. Cambridge U.P. 1967. XII, 204 blz. Met krt. - C.R. Hooijer, Per Sorensen, Ban-Kao, Neolithic settlements with cemeteries in the Kanchanaburi Province. 140 pp., 140 plates, 4 maps, figs. The Thai-Danish Prehistoric Expedition 1960-62, Archaeological Excavations in Thailand, Vol. II. Munksgaard, Copenhagen, 1967. - C.R. Hooijer, H.R. van Heekeren, Sai-Yok, Stone-age settlements in the Kanchanaburi Province. 129 pp., 33 plates, 47 figs. The Thai-Danish Prehistoric Expedition 1960-1962, Archaeological Excavations in Thailand, Vol. I. Munksgaard, Copenhagen, 1967., Eigil Knuth (eds. - Th. G. Th. Pigeaud, C. Hooykaas, Bagus Umbara, Prince of Koripan. The story of a prince of Bali and a princess of Java, illustrated on palm leaves by a Balines artist. With Balinese text and English translation by Dr C. Hooykaas, Reader in Old Javanese, University of London. Published by the Trustees of the British Museum, London, 1968. 55 pp., 9 illustrations, 31 x 25 cm. - H.J. de Graaf, Soemarsaid Moertono, State and statecraft in old Java: A study of the late Mataram period 16th to 19th century. Monograph series Modern Indonesia Project. Southeast Asia Program Department of Asian Studies. Cornell

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    Andrew Sharp

    1961-10-01

    Full Text Available - P. Voorhoeve, Tudjimah, Asrar al-insan fi maýrifa al-ruh waýl-Rahman. Tesis Djakarta, 1961. 477 blz. - F.D.K. Bosch, Alastair Lamb, Chandi Bukit Batu Pahat. Three Additional Notes. 14 pp., 2 figs., 21 pls; Monographs....(etc. No. 5, 1961. - F.D.K. Bosch, Alistair Lamb, Chandi Bukit Batu Pahat; a Report on the Excavation of an Ancient Temple in Kedah. 108 pp., 40 figs., 179 pls; Monographs on Southeast Asian Subjects No. 1, Eastern Universities Press Ltd., Singapore, 1960. - T.J. Brasser, Frederick J. Dockstader, Indian art in America - The arts and crafts of the North American Indian. New York Graphic Society, Greenwich, Mass., U.S.A. 1961. 224 pages, 70 color plates, 180 black and white illustrations. - J. Prins, Cora Vreede-De Steurs, Lýýmancipation de la femme indonýsienne. Mouton & Co, Den Haag en Parijs. 174 blz., 21 platen, 1 kaart. - Clifford Geertz, Bali, Studies in Life, Thought and Ritual; Selected Studies on Indonesia, Vol. 5. W. van Hoeve, The Hague & Bandung 1960. 368 pp. text. - Tjan Giok Bwee, D.E. Wilmott, The Chinese of Semarang: a changing minority community in Indonesia. Ithaca, New York, Cornell University Press, 1960, 366 pp. - P. Gregorius, J. de Leeuwe, Groepshuwelijk en enkelvoudig huwelijk, Uitgeverij L. Stafleu & Zoon, Leiden 1960, 136 blz. - P. van Emst, Andrew Sharp, The discovery of the Pacific Islands. Clarendon Press: Oxford University Press. Oxford 1960. 259 pp. - T. Volker, John Bastin, The changing balance of the early Southeast Asian pepper trade (Papers on Southeast Asian subjects No 1. Department of History University of Malaya in Kuala Lumpur, 1960. 60 pp. text, maps, bibliog. - W.F. Wertheim, Leslie H. Palmier, Social status and power in Java. London School of Economics Monographs on Social Anthropology, no. 20. London, 1960. 165 blz.

  14. Book Reviews

    Directory of Open Access Journals (Sweden)

    R.A. Römer

    1963-10-01

    Full Text Available - A.J.C. Lach de Bére, Fernand van Langenhove, Consciences Tribales et Nationales en Afrique Noire. Institut Royal des Relations Internationales, Bruxelles. Martinus Nijhoff, ‘s-Gravenhage, 1960; 444 blz. - J.H. Scherer, A.H.J. Prins, The Swahili-speaking peoples of Zanzibar and the E. African Coast (Arabs, Shirazi and Swahili. Ethnographic Survey of Africa: East Central Africa, part XII. Uitgave van het International African Institute, London, 1961. 143 pp., m. kaart. - P. Driessens, Carol Brubaker, Geesten van het woud. Servire Luxe Pockets nr. 66. Servire, Den Haag 1963. 175 pp., 24 foto’s. - Joh. J. Hanrath, Indonesian Economics. The concept of dualism in theory and policy. Den Haag (W. van Hoeve 1961. 443 pp. - W. Ph. Coolhaas, H.R.C. Wright, East-Indian economic problems of the age of Cornwallis and Raffles. Luzac, London, 1961; 271 pp. - H.J. de Graaf, M.A.P. Meilink-Roelofsz, Asian trade and European influence in the Indonesian Archipelago between 1500 and about 1630. Academisch Proefschrift Amsterdam (S.U.. M. Nijhoff, ‘s-Gravenhage 1962. 471 pp. - Logemann, Herbert Feith, The decline of constitutional democracy in Indonesia. Cornell University Press, Ithaca, New York, 1962. XX en 608 blz. - F.D.K. Bosch, G. Coedés, Les peuples de la péninsule indochinoise. 228 pp., 16 pl., 1 carte; Ed. Dunod, Paris, 1962. - L. Sluimers, Sirdar Ikbal Ali Shah, Viet-nam. London, Octagon Press, 1960. XV, 232 blz., krt. - L. Sluimers, J.G. Keyes, A bibliography of North Vietnamese Publications in the Cornell University Library. Ithaca, Cornell University, 1962. Data paper: Number 47. Southeast Asia Program. Department of Asian Studies. Cornell University. X, 116 blz., X. - A.F.P. Hulsewé, G.P. Oery, The Man-Shu (Book of the Southern Barbarians, translated by Gordon H. Luce, edited by G.P. Oery; Data Paper Nr. 44, Southeast Asia Program, Dept. of Far Eastern Studies, Cornell Univ., Ithaca, N.Y.; 1961. (X + 116 pp., 1 map. - C.H.M. Palm, Felix M

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-01-01

    Jeroen Kemperman. Leiden: KITLV Press, 2002, 570 pp. [Verhandelingen 206.] -Gerry van Klinken, Grayson Lloyd ,Indonesia today; Challenges of history. Singapore: Institute of Southeast Asian studies, 2001, 359 pp., Shannon Smith (eds -Johanna van Reenen, Frédéric Durand, Timor Lorosa'e, pays au carrefour de l'Asie et du Pacifique; Un atlas géo-historique. Marne-la-Vallée: Presses Universitaires de Marne-la-Vallée, 2002, 208 pp. -William R. Roff, Mona Abaza, Debates on Islam and knowledge in Malaysia and Egypt; Shifting worlds. London: RoutledgeCurzon, 2002, xix + 304 pp. -Mariëtte van Selm, Chr. van Fraassen ,G.E. Rumphius, De Ambonse eilanden onder de VOC, zoals opgetekend in 'De Ambonse landbeschrijving'. Utrecht: Landelijk Steunpunt Educatie Molukkers, 2002, 254 pp., H. Straver (eds -K. Thirumaran, Prema-Chandra Athukorala, Crisis and recovery in Malaysia; The role of capital controls. Cheltenham: Elgar, 2001, xii + 159 pp. -K. Thirumaran, John Hilley, Malaysia; Mahathirism, hegemony and the new opposition. London: Zed books, 2001, xiii + 305 pp. -Reina van der Wiel, Damien Kingsbury ,Foreign devils and other journalists. Clayton VIC: Monash Asia Institute, 2000, vi + 277 pp. [Monash papers on Southeast Asia 52.], Eric Loo, Patricia Payne (eds -Jennifer Fraser, Philip Yampolsky, Music of Indonesia. Washington DC: Smithsonian Folkways recordings, 1991-2000, 20 compact discs plus a CD of selections from the series, Discover Indonesia. All with accompanying booklets. -Robert Wessing, Nicola Tannenbaum ,Founders' cults in Southeast Asia; Ancestors, polity, and identity. New Haven CT: Yale University Southeast Asian studies, 2003, xi + 373 pp. [Yale Southeast Asia studies Monograph 52.], Cornelia Ann Kammerer (eds -Robert Wessing, Henri Chambert-Loir ,The potent dead; Ancestors, saints and heroes in contemporary Indonesia. Crows Nest, New South Wales: Allen and Unwin, Honolulu: University of Hawai'i Press, 2002, xxvi + 243 pp. [Southeast Asia publications series

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2005-01-01

    Full Text Available -Monika Arnez, Niels Mulder, Southeast Asian images; Towards civil society? Chiang Mai: Silkworm Books, 2003, ix + 253 pp. -Adriaan Bedner, Connie Carter, Eyes on the prize; Law and economic development in Singapore. The Hague: Kluwer Law International, xviii + 307 pp. [The London-Leiden series on law, administration and development 7.] -Amrit Gomperts, J.R. van Diessen ,Grote atlas van Nederlands Oost-Indië/Comprehensive atlas of the Netherlands East Indies. Zierikzee: Asia Maior, Utrecht: Koninklijk Nederlands Aardrijkskundig Genootschap (KNAG, 2004, 480 pp. (editors, with the collaboration of R.C.M. Braam, W. Leijnse, P.A. Levi, J.J. Reijnders, R.P.G.A. Voskuil and M.P.B. Ziellemans, F.J. Ormeling (eds -Stuart R. Harrop, Adriaan Bedner ,Towards integrated environmental law in Indonesia? Leiden: Research school CNWS, School of Asian, African and Amerindian studies, 2003, 161 pp. [CNWS publications 127.], Nicole Niessen (eds -David Henley, Paul H. Kratoska ,Locating Southeast Asia: Geographies of knowledge and politics of space. Singapore: Singapore University Press, 2005, xi + 326 pp., Remco Raben, Henk Schulte Nordholt (eds -Gerry van Klinken, Anthony J. Langlois, The politics of justice and human rights; Southeast Asia and universalist theory. Cambridge: Cambridge University Press, 2001, xi + 214 pp. [Cambridge Asia-Pacific studies.] -Koh Keng We, Jurrien van Goor, Prelude to colonialism; The Dutch in Asia. Hilversum: Verloren, 2004, 127 pp. -Lim Beng Soon, Thomas H. Slone, Prokem; An analysis of a Jakartan slang. Oakland: Masalai Press, 2003, 95 pp. -Lim Beng Soon, Neil Khor Jin Keong ,The Penang Po Leung Kuk; Chinese women, prostitution and a welfare organisation. Kuala Lumpur; The Malaysian branch of the Royal Asiatic society (MBRAS, 2004, VII + 181 pp., Khoo Keat Siew (eds -Dick van der Meij, J. Thomas Lindblad ,Macht en majesteit; Opstellen voor Cees Fasseur bij zijn afscheid als hoogleraar in de geschiedenis van Indonesië aan de

  17. Illustration of the heart and blood vessels in medieval times.

    Science.gov (United States)

    Khalili, Majid; Shoja, Mohammadali M; Tubbs, R Shane; Loukas, Marios; Alakbarli, Farid; Newman, Andrew J

    2010-08-06

    Throughout history, illustrations had played a key role in the promotion and evolution of medicine by providing a medium for transmission of scientific observations. Due to religious prohibitions, color drawings of the human body did not appear in medieval Persia and during the Islamic Golden Age. This tradition, however, has been overlooked with the publication of the first color atlas and text of human anatomy, Tashrihi Mansuri (Mansur's Anatomy), by Mansur ibn Ilyas in the fourteenth century AD. Written in Persian and containing several vivid illustrations of the human body, this book gained widespread attention by both scholars and lay persons. In this article, a brief history of Mansur's Anatomy and an English translation of selected sections from this book regarding the heart and blood vessels are presented.

  18. Book Reviews

    Directory of Open Access Journals (Sweden)

    Harry A. Poeze

    1985-10-01

    Full Text Available - J. van Baal, B. van Norren, Socio-culturele structuur en innovatie: een structuur-vergelijkend onderzoek naar adoptie van family-planning in de periode 1969-1973 door Sundanese echtparen in twee rurale gemeenschappen op West-Java. Dissertatie Landbouwhogeschool Wageningen, 1985. 533 pp. - Pierre Brocheux, Andrew Turton, History and peasant consciousness in South East Asia, Senri Ethnological studies no. 13, National Museum of Ethnology, Osaka. 1984, 420 pp., Shigeharu Tanabe (eds. - I.H. Enklaar, J. Verkuyl, Gedenken en verwachten, mémoires, Kampen: J.H. Kok, 1983, 348 pp. - J. van Goor, D.J. Roorda, Overzicht van de Nieuwe Geschiedenis; De algemene geschiedenis van het einde der middeleeuwen tot 1870 (Groningen 1983; dez. Nieuwe Geschiedenis in teksten; Werkboek (Groningen 1984. - R. Hagesteijn, H.D. Kubitscheck, Südost Asien: Völker und Kulturen, Berlin: Akademie-Verlag, 1984. - C.H. van Nieuwenhuijsen-Riedeman, Florence Weiss, Kinder schildern ihren Alltag. Die stellung des kindes om ökonomischen System einer Dorfgemeinschaft in Papua New Guinea (Palimbei, Iatmul, Mittelsepik. [Children narrate their daily life. The child’s role in the economic system of a village community in Papua New Guinea (Palimbei, Iatmul, Middle Sepik ],Basler Beiträge zur Ethnologie band 21, Basel: Ethnologisches Seminar der Universität und Museum für Völkerkunde, 1981. - Harry A. Poeze, Joop Morriën, `Aroen’; Jan Stam, rebel in Indonesië en Nederland, Amsterdam: Pegasus, 1984, 159 pp. - P.H. Pott, Jeanne de Loos-Haaxman, De Franse Schilder Ernest Hardouin in Batavia, Leiden: Brill, 1982, 51 pp., ills. - Harry A. Poeze, Uit het archief van Arthur Lehning, Amsterdam: Van Gennep 1984. - W.G.J. Remmelink, P.B.R. Carey, Babad Dipanagara; An account of the outbreak of the Java War (1825-1830, The Malaysian branch of the Royal Asiatic Society - Monograph No. 9, Kuala Lumpur, 1981, LXXIII + 343 pp., 2 maps, 6 illustrations.

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    E.Ch.L. van der Vliet

    1982-01-01

    Full Text Available - Rita Bolland, Alfred Bühler, The patola of Gujarat. Double ikat in India. Krebs AG Basel, 1979. Vol. 1, 360 p. tekst, ill. Vol. 2, afb. in kleur en zwart/wit, krt. tab. noten, verkl. woorden. litl., Eberhard Fischer (eds. - Raymond Buve, Hugo G. Nutini, Ritual kinship. The structure and historical development of the Compadrazgo system in rural Tlaxcala, Vol. I. Princeton University Press, N.J., 1980, XVI plus 494 pp., maps, tables, glossary and index., Betty Bell (eds. - Benno Galjart, G.A. Banck, Jagen met een kat... Schaarse middelen en sociale relaties in de Braziliaanse staat Espirito Santo, CEDLA Incidentele publicaties no. 8, CEDLA, Amsterdam 1977. - R.A.L.H. Gunawardana, J. van Goor, Jan Kompanie as schoolmaster: Dutch education in Ceylon, 1690-1795, Historische Studies, Instituut voor Geschiedenis der Rijksuniversiteit te Utrecht, XXIV, Wolters-Noordhoff Groningen, 1978, 205 pp., 3 maps. - Ria Kloppenborg, R.A.L.H. Gunawardana, Robe and plough. Monasticism and economic interest in early medieval Sri Lanka. Association for Asian Studies, Monographs and Papers No. XXXV, University of Arixona Press, Tucson, Arizona, 1979; 377 pages, including bibliography and index. - Els Postel-Coster, Jan van Bremen, Romantropologie - Essays over antropologie en literatuur, Antropologisch-Sociologisch Centrum Universiteit van Amsterdam, 1979., Sjaak van der Geest, Jojada Verrips (eds. - Arie de Ruijter, T. Lemaire, Over de waarde van kulturen. Een inleiding in de kultuurfilosofie. Ambo, Baarn 1976, herdruk 1980. 509 blz. - P. van de Velde, W. Arens, The man-eating myth. Oxford University Press, New York, 1979. XIV + 206 pp., 12 illustrations. - E.Ch.L. van der Vliet, Klaus E. Müller, Geschichte der antiken ethnographie und ethnologischen theoriebildung von den anfängen bis auf die byzantinischen historiographen, Teil II (Studien zur Kulturkunde 52, Wiesbaden: Franza Steiner Verlag, 1980. 563 pp. 11 figs. - J.J. de Wolf, P.T.W. Baxter, Age

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Wim van der Meer

    1983-01-01

    Full Text Available - M.A. van Bakel, A. Ysebaert-Deen, Schippers onderweg: Sociale relaties van een ambulante groep, Amsterdam 1981, A.S.C. - Gerard J. van den Broek, Georges Condominas, Nous avons mangé la forêt, Paris: Flammarion, 1982. - H.J.M. Claessen, Adam Kuper, Wives for cattle. Bridewealth and marriage in Southern Africa, 1982, London. Routledge and Kegan Paul. 202 pp. Notes, index, bibliography, tables and figures. - H.J. Duller, Jeroen H. Dekker, Curacao Zonder / Met Shell. Een bijdrage tot bestudering van demografische, economische en sociale processen in de periode 1900-1929, De Walburg Pers, Zutphen, 1982. - M. Hekker, J. van Baal, Man’s quest for partnership. The anthropological foundations of ethics and religion. Van Gorcum, Assen, 1981. 337 pp. - Fokko P.C. Kool, Dick A. Papousek, The peasant - potters of Los Pueblos - Stimulus situation and adaptive processes in the Mazahua region in central Mexico, van Gorcum, Assen 1981. 181 pages, 5 maps, 11 illustrations. - Adrianus Koster, L.D. Meijers, Chassidisme in Israël: De Reb Arrelech van Jeruzalem, Assen, Van Gorcum (Serie Terreinverkenningen in de Culturele Antropologie 17, 1979, 129 pp. - Peter J.M. Nas, I. Box, Van theorie tot toepassing in de ontwikkelingssociologie. Sociologen en antropologen over onttwikkelingsproblemen. Boekaflevering 56e jaargang Mens en Maatschappij, Van Loghum Slaterus b.v., Deventer, 1981, 139 p., D.A. Papousek (eds. - S.A. Niessen, Toos van Dijk, Ship cloths of the Lampung, South Sumatra; A research of their design, meaning and use in their cultural context, Amsterdam: Galerie Mabuhay. 79 pp., 17 plates., Nico de Jonge (eds. - Cees L. Post, Jacques Le Goff, Le Charivari, Paris, The Hague, New York; Mouton, 1981. 444 pp., maps, ills., annexes., Jean-Claude Schmitt (eds. - N.E. Sjoman, Wim van der Meer, Hindustani Music in the 20th Century, Martinus Nijhoff Publishers, The Hague/Boston/London, 1980, 252 pp., 8 ills. - Pieter van de Velde, Fritjof Tichelman, The social

  1. Productions of $K^*_0(1430)$ and $K_{1}$ in B decays

    CERN Document Server

    Chen, C H; Hsiao, Y K; Wei, Z T; Chen, Chuan-Hung; Geng, Chao-Qiang; Hsiao, Yu-Kuo; Wei, Zheng-Tao

    2005-01-01

    We study the productions of p-wave mesons $K^*_{0}(1430)$, $K_{1}(1270)$ and $K_{1}(1400)$ in B decays. By the generalized factorization approach, we find that the branching ratios of $B\\to K^*_{0}(1430) \\phi$ are similar to those of $B\\to K \\phi$ while the branching ratios of $B\\to K_{1}(1270) \\phi$ and $B\\to K_{1}(1400) \\phi$ are %could be $O(10^{-5})$ and $O(10^{-6})$, respectively. In terms of the observation of $B\\to K_{1}(1270) \\gamma$ by BELLE, we can remove the sign ambiguity in the mixing angle for physical states $K_1(1270)$ and $K_{1}(1400)$. In addition, we analyze annihilation contributions in the decays $B\\to K_1 \\phi$ and we conclude that they could be neglected.

  2. The Shrinking Scholarly Book.

    Science.gov (United States)

    Heller, Scott

    1999-01-01

    Economic pressures in the publishing industry are causing faculty to write shorter books. The authors want their books to be readable, and publishers want to reduce costs and make the books affordable for a wider audience, including students. Brief but broad surveys, short introductory primers, quick biographies, and books with very basic themes…

  3. Writing a book review.

    Science.gov (United States)

    Bryson, David; Hudson, Robert

    2017-04-01

    Book reviews are a good way to get started with writing for a journal and this Learning and CPD activity takes you through the process of understanding the aims of book review, undertaking practice pieces through to reviewing a book and advice on the dos and don'ts of book reviewing.

  4. Book Reviews

    Directory of Open Access Journals (Sweden)

    Jan Nederveen Pieterse

    1991-04-01

    Full Text Available - Walter E.A. van Beek, Ph. Quarles van Ufford, Religion and development; Towards an integrated approach, Amsterdam: Free University Press, 1988., M. Schoffeleers (eds. - J.H. de Beer, H.F. Tillema, A journey among the people of Central Borneo in word and picture, edited and with an introduction by Victor T. King, Singapore: Oxford University Press, 1989. 268 pp. - Chris de Beet, Richard Price, Alabi’s world. Baltimore and London: The John Hopkins University Press, 1990. xx + 444 pp. - G. Bos, Neil L. Whitehead, Lords of the tiger spirit; A history of the Caribs in colonial Venezuela and Guyana 1498-1820, Koninklijk Instituut voor Taal-, Land- en Volkenkunde, Leiden. Caribbean series 10, Dordrecht/Providence: Foris publications, 1988, 250 pp., maps, ills., index, bibl. - James R. Brandon, Richard Schechner, By means of performance: Intercultural studies of theatre and ritual. Cambridge and New York: Cambridge University Press, 1990. 190 + xv pp + ills. Paperback, Willa Appel (eds. - J.N. Breetvelt, Matti Kamppinen, Cognitive systems and cultural models of illness, Helsinki: Academia Scientiarum Fennica, FF Comunications No. 244, 1989. 152 pp. - Martin van Bruinessen, Mark R. Woodward, Islam in Java: Normative piety and mysticism in the Sultanate of Yogykarta. Tucson: The University of Arizona Press, 1989, 311 pp, index. - J.G. de Casparis, Pauline Lunsingh Scheurleer, Ancient Indonesian Bronzes; A catalogue of the exhibition in the Rijksmuseum Amsterdam with a general introduction. Leiden: Brill, 1988. IX + 179 pp., richly illustrated., Marijke J. Klokke (eds. - Hugo Fernandes Mendes, Luc Alofs, Ken ta Arubiano? Sociale intergartie en natievorming op Aruba, Leiden: Caraïbische Afdeling, Koninklijk Instituut voor Taal-, Land- en Volkenkunde, 1990. ix + 232 pp., Leontine Merkies (eds. - Rene van der Haar, I. Eibl-Eibesfeldt, Kommunikation bei den Eipo; Eine humanethologische bestandsaufnahme, Berlin: Dietrich Reimer Verlag, 1989., W. Schiefenh

  5. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-07-01

    Full Text Available -Gesa Mackenthun, Stephen Greenblatt, Marvelous Possessions: The wonder of the New World. Chicago: University of Chicago Press, 1991. ix + 202 pp. -Peter Redfield, Peter Hulme ,Wild majesty: Encounters with Caribs from Columbus to the present day. An Anthology. Oxford: Oxford University Press, 1992. x + 369 pp., Neil L. Whitehead (eds -Michel R. Doortmont, Philip D. Curtin, The rise and fall of the plantation complex: Essays in Atlantic history. New York: Cambridge University Press, 1990. xi + 222 pp. -Roderick A. McDonald, Hilary McD.Beckles, A history of Barbados: From Amerindian settlement to nation-state. Cambridge: Cambridge University Press, 1990. xv + 224 pp. -Gertrude J. Fraser, Hilary McD.Beckles, Natural rebels; A social history of enslaved black women in Barbados. New Brunswick NJ and London: Rutgers University Press and Zed Books, 1990 and 1989. ix + 197 pp. -Bridget Brereton, Thomas C. Holt, The problem of freedom: Race, labor, and politics in Jamaica and Britain, 1832-1938. Baltimore: John Hopkins University Press, 1991. xxxi + 517 pp. -Peter C. Emmer, A. Meredith John, The plantation slaves of Trinidad, 1783-1816: A mathematical and demographic inquiry. Cambridge: Cambridge University Press, 1988. xvi + 259 pp. -Richard Price, Robert Cohen, Jews in another environment: Surinam in the second half of the eighteenth century. Leiden: E.J. Brill, 1991. xv + 350 pp. -Russell R. Menard, Nigel Tattersfield, The forgotten trade: comprising the log of the Daniel and Henry of 1700 and accounts of the slave trade from the minor ports of England, 1698-1725. London: Jonathan Cape, 1991. ixx + 460 pp. -John D. Garrigus, James E. McClellan III, Colonialism and science: Saint Domingue in the old regime. Baltimore: John Hopkins University Press, 1992. xviii + 393 pp. -Lowell Gudmundson, Richard H. Collin, Theodore Roosevelt's Caribbean: The Panama canal, the Monroe doctrine, and the Latin American context. Baton Rouge: Louisiana State University

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2003-01-01

    Full Text Available -Timothy Barnard, J.M. Gullick, A history of Selangor (1766-1939. Kuala Lumpur: Malaysian branch of the Royal Asiatic Society, 1989, vi + 220 pp. [MBRAS Monograph 28.] -Okke Braadbaart, Michael L. Ross, Timber booms and institutional breakdown in Southeast Asia. Cambridge: Cambridge University Press, 2001, xvi + 237 pp. -H.J.M. Claessen, Patrick Vinton Kirch ,Hawaiki, ancestral Polynesia; An essay in historical anthropology. Cambridge: Cambridge University Press, 2001, xvii + 375 pp., Roger C. Green (eds -Harold Crouch, R.E. Elson, Suharto; A political biography. Cambridge: Cambridge University Press, 2001, xix + 389 pp. -Kees van Dijk, H.W. Arndt ,Southeast Asia's economic crisis; Origins, lessons, and the way forward. Singapore: Institute of Southeast Asian studies, 1999, ix + 182 pp., Hal Hill (eds -Kees van Dijk, Sebastiaan Pompe, De Indonesische algemene verkiezingen 1999. Leiden: KITLV Uitgeverij, 1999, 290 pp. -David van Duuren, Albert G. van Zonneveld, Traditional weapons of the Indonesian archipelago. Leiden: Zwartenkot art books, 2001, 160 pp. -Peter van Eeuwijk, Christian Ph. Josef Lehner, Die Heiler von Samoa. O Le Fofo; Monographie über die Heiler und die Naturheilmethoden in West-Samoa. Frankfurt am Main: Lang, 1999, 234 pp. [Mensch und Gesellschaft 4.] -Hans Hägerdal, Frans Hüsken ,Reading Asia; New research of Asian studies. Richmond: Curzon, 2001, xvi + 338 pp., Dick van der Meij (eds -Terence E. Hays, Jelle Miedema ,Perspectives on the Bird's head of Irian Jaya, Indonesia; Proceedings of the conference, Leiden, 13-17 October 1997. Amsterdam: Rodopi, 1998, xiii + 982 pp. (editors with the assistance of Connie Baak, Cecilia Odé, Rien A.C. Dam (eds -Menno Hekker, Peter Metcalf, They lie, we lie; Getting on with anthropology. London: Routledge, 2002, ix + 155 pp. -David Henley, Foong Kin, Social and behavioural aspects of malaria control; A study among the Murut of Sabah. Phillips, Maine: Borneo research council , 2000, xx

  7. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-01-01

    Full Text Available -Louis Allaire, Samuel M. Wilson, Hispaniola: Caribbean chiefdoms in the age of Columbus. Tuscaloosa: University of Alabama Press, 1990. xi + 170 pp. -Douglas Melvin Haynes, Philip D. Curtin, Death by migration: Europe's encounter with the tropical world in the nineteenth century. Cambridge: Cambridge University Press, 1989. xviii + 251 pp. -Dale Tomich, J.H. Galloway, The sugar cane industry: An historical geography from its origins to 1914. Cambridge: Cambridge University Press, 1989. xii + 266 pp. -Myriam Cottias, Dale Tomich, Slavery in the circuit of sugar: Martinique and the world economy, 1830 -1848. Baltimore: John Hopkins University Press, 1990. xiv + 352 pp. -Robert Forster, Pierre Dessalles, La vie d'un colon à la Martinique au XIXe siècle. Pré-senté par Henri de Frémont. Courbevoie: s.n., 1984-1988, four volumes, 1310 pp. -Hilary Beckles, Douglas V. Armstrong, The old village and the great house: An archaeological and historical examination of Drax Hall Plantation, St Ann's Bay, Jamaica. Chicago: University of Illinois Press, 1990. xiii + 393 pp. -John Stewart, John A. Lent, Caribbean popular culture. Bowling Green OH: Bowling Green State University Popular Press, 1990. 157 pp. -W. Marvin Will, Susanne Jonas ,Democracy in Latin America: Visions and realities. New York: Bergin & Garvey Publishers, 1990. viii + 224 pp., Nancy Stein (eds -Forrest D. Colburn, Kathy McAfee, Storm signals: Structural adjustment and development alternatives in the Caribbean. London: Zed books, 1991. xii + 259 pp. -Derwin S. Munroe, Peggy Antrobus ,In the shadows of the sun: Caribbean development alternatives and U.S. policy. Carmen Diana Deere (coordinator, Peter Phillips, Marcia Rivera & Helen Safa. Boulder CO: Westview Press, 1990. xvii + 246 pp., Lynne Bolles, Edwin Melendez (eds -William Roseberry, Louis A. Pérez, Jr., Lords of the mountain: Social banditry and peasant protest in Cuba, 1878-1918. Pittsburgh: University of Pittsburgh Press, 1989

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-07-01

    Full Text Available -Peter Hulme, Stephen Greenblatt, New World Encounters. Berkeley: University of California Press, 1993. xviii + 344 pp. -Nigel Rigby, Alan Riach ,The radical imagination: Lectures and talks by Wilson Harris. Liège: Department of English, University of Liège, xx + 126 pp., Mark Williams (eds -Jonathan White, Rei Terada, Derek Walcott's poetry: American Mimicry. Boston: North-eastern University Press, 1992. ix + 260 pp. -Ray A. Kea, John Thornton, Africa and Africans in the making of the Atlantic world, 1400-1680. Cambridge: Cambridge University Press, 1992. xxxviii + 309 pp. -B.W. Higman, Barbara L. Solow, Slavery and the rise of the Atlantic system. Cambridge: Cambridge University Press, 1991. viii + 355 pp. -Sidney W. Mintz, Michael Mullin, Africa in America: Slave acculturation and resistance in the American South and the British Caribbean, 1736-1831. Urbana: University of Illinois Press. 412 pp. -Karen Fog Olwig, Corinna Raddatz, Afrika in Amerika. Hamburg: Hamburgisches Museum für Völkerkunde, 1992. 264 pp. -Lee Haring, William Bascom, African folktales in the new world. Bloomington: Indiana University Press, 1992. xxv + 243 pp. -Frank Jan van Dijk, Dale A. Bisnauth, History of religions in the Caribbean. Kingston: Kingston Publishers, 1989. 225 pp. -Gloria Wekker, Philomena Essed, Everyday racism: Reports from women of two cultures. Alameda CA: Hunter House, 1990. xiii + 288 pp.''Understanding everyday racism: An interdisciplinary theory. Newbury Park CA: Sage, 1991. x + 322 pp. -Deborah S. Rubin, Vron Ware, Beyond the Pale: White women, racism, and history. London: Verso, 1992. xviii + 263 pp. -Michael Hanchard, Peter Wade, Blackness and race mixture: The dynamics of racial identity in Colombia. Baltimore: John Hopkins University Press, 1993. xv + 415 pp. -Rosalie Schwartz, Louis A. Pérez, Jr., Slaves, sugar, & colonial society: Travel accounts of Cuba, 1801-1899. Wilmington DE: SR Books, 1992. xxvi + 259 pp. -Susan Eckstein, Sandor

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1996-07-01

    . xiv + 217 pp., Lou Anne Barclay (eds -Catherine Levesque, Allison Blakely, Blacks in the Dutch world: The evolution of racial imagery in a modern society. Bloomington: Indiana University Press, 1993. xix + 327 pp. -Dennis J. Gayle, Frank Fonda Taylor, 'To hell with paradise': A history of the Jamaican tourist industry. Pittsburgh: University of Pittsburgh Press, 1993. ix + 239 pp. -John P. Homiak, Frank Jan van Dijk, Jahmaica: Rastafari and Jamaican society, 1930-1990. Utrecht: ISOR, 1993. 483 pp. -Peter Mason, Arthur MacGregor, Sir Hans Sloane: Collector, scientist, antiquary, founding Father of the British Museum. London: British Museum Press, 1994. -Philip Morgan, James Walvin, The life and times of Henry Clarke of Jamaica, 1828-1907. London: Frank Cass, 1994. xvi + 155 pp. -Werner Zips, E. Kofi Agorsah, Maroon heritage: Archaeological, ethnographic and historical perspectives. Kingston: Canoe Press, 1994. xx + 210 pp. -Michael Hoenisch, Werner Zips, Schwarze Rebellen: Afrikanisch-karibischer Freiheitskampf in Jamaica. Vienna Promedia, 1993. 301 pp. -Elizabeth McAlister, Paul Farmer, The uses of Haiti. Monroe ME: Common Courage Press, 1994. 432 pp. -Robert Lawless, James Ridgeway, The Haiti files: Decoding the crisis. Washington DC: Essential Books, 1994. 243 pp. -Bernadette Cailler, Michael Dash, Edouard Glissant. Cambridge: Cambridge University Press, 1995. xii + 202 pp. -Peter Hulme, Veronica Marie Gregg, Jean Rhys's historical imagination: Reading and writing the Creole. Chapel Hill: University of North Carolina Press, 1995. xi + 228 pp. -Silvia Kouwenberg, Francis Byrne ,Focus and grammatical relations in Creole languages. Amsterdam/Philadelphia: John Benjamins, 1993. xvi + 329 pp., Donald Winford (eds -John H. McWhorter, Ingo Plag, Sentential complementation in Sranan: On the formation of an English-based Creole language. Tübingen: Max Niemeyer, 1993. ix + 174 pp. -Percy C. Hintzen, Madan M. Gopal, Politics, race, and youth in Guyana. San Francisco: Mellen

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    Janet Rodenburg

    1992-04-01

    Full Text Available - Leonard Y. Andaya, H.A. Poeze, Excursies in Celebes; Een bundel bijdragen bij het afscheid van J. Noorduyn als directeur-secretaris van het Koninklijk Instituut voor Taal-, Land- en Volkenkunde. Leiden: KITLV Uitgeverij, 1991, 348 pp., P. Schoorl (eds. - Anne Booth, Adrian Clemens, Changing economy in Indonesia Volume 12b; Regional patterns in foreign trade 1911-40. Amsterdam: Royal Tropical Institute, 1992., J.Thomas Lindblad, Jeroen Touwen (eds. - A.P. Borsboom, James F. Weiner, The empty place; Poetry space, and being among the Foi of Papua New Guinea. Bloomington: Indiana University Press, 1991. - Martin van Bruinessen, Ozay Mehmet, Islamic identity and development; Studies of the Islamic periphery. London and New York: Routledge, 1990 (cheap paperback edition: Kula Lumpur: Forum, 1990, 259 pp. - H.J.M. Claessen, Timothy Earle, Chiefdoms: power, economy, and ideology. A school of American research book. Cambridge: Cambridge University Press, 1991. 341 pp., bibliography, maps, figs. - H.J.M. Claessen, Henk Schulte Nordholt, State, village, and ritual in Bali; A historical perspective. (Comparitive Asian studies 7. Amsterdam: VU University press for the centre for Asian studies Amsterdam, 1991. 50 pp. - B. Dahm, Ruby R. Paredes, Philippine colonial democracy. (Monograph series 32/Yale University Southeast Asia studies. New Haven: Yale Center for international and Asia studies, 1988, 166 pp. - Eve Danziger, Bambi B. Schieffelin, The give and take of everyday life; Language socialization of Kaluli children. (Studies in the social and cultural foundations of language 9. Cambridge: Cambridge University Press, 1991. - Roy Ellen, David Hicks, Kinship and religion in Eastern Indonesia. (Gothenburg studies in social anthropology 12. Gothenburg: Acta Universitatis Gothoburgensis, 1990, viii 132 pp., maps, figs, tbls. - Paul van der Grijp, Pierre Lemonnier, Guerres et festins; Paix, échanges et competition dans les highlands de Nouvelle

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-07-01

    Full Text Available -Bill Maurer, Mimi Sheller, Consuming the Caribbean: From Arawaks to Zombies. New York: Routledge, 2003. ix + 252 pp. -Norman E. Whitten, Jr., Richard Price ,The root of roots: Or, how Afro-American anthropology got its start. Chicago: Prickly Paradigm Press/University of Chicago Press, 2003. 91 pp., Sally Price (eds -Holly Snyder, Paolo Bernardini ,The Jews and the expansion of Europe to the West, 1450-1800. New York: Berghahn Books, 2001. xv + 567 pp., Norman Fiering (eds -Bridget Brereton, Seymour Drescher, The mighty experiment: Free labor versus slavery in British emancipation. New York: Oxford University Press, 2002. 307 pp. -Jean Besson, Kathleen E.A. Monteith ,Jamaica in slavery and freedom: History, heritage and culture. Kingston; University of the West Indies Press, 2002. xx + 391 pp., Glen Richards (eds -Michaeline A. Crichlow, Jean Besson, Martha Brae's two histories: European expansion and Caribbean culture-building in Jamaica. Chapel Hill: University of North Carolina Press, 2002. xxxi + 393 pp. -Christopher Schmidt-Nowara, Joseph C. Dorsey, Slave traffic in the age of abolition: Puerto Rico, West Africa, and the Non-Hispanic Caribbean, 1815-1859. Gainesville: University Press of Florida, 2003. xvii + 311 pp. -Arnold R. Highfield, Erik Gobel, A guide to sources for the history of the Danish West Indies (U.S. Virgin Islands, 1671-1917. Denmark: University Press of Southern Denmark, 2002. 350 pp. -Sue Peabody, David Patrick Geggus, Haitian revolutionary studies. Bloomington: Indiana University Press, 2002. xii + 334 pp. -Gerdès Fleurant, Elizabeth McAlister, Rara! Vodou, power, and performance in Haiti and its Diaspora. Berkeley: University of California Press, 2002. xviii + 259 pp. and CD demo. -Michiel Baud, Ernesto Sagás ,The Dominican people: A documentary history. Princeton NJ: Marcus Wiener, 2003. xiii + 278 pp., Orlando Inoa (eds -Samuel Martínez, Richard Lee Turits, Foundations of despotism: Peasants, the Trujillo regime

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Joseph Aquilina

    1976-01-01

    .J. Zoetmulder, Himansu Bhusan Sarkar, Corpus of the inscriptions of Java (Corpus Inscriptionum Javanicorum (up to 928 A.D., K.L. Mukhopadhyay, Calcutta, 1972. Vol. I 314 pp., Vol. II 359 pp. - J.G. Oosten, Wilhelmina van Wetering, Hekserij bij de Djuka. Een sociologische benadering. Academisch proefschrift, gestencilde uitgave, 1973. - Willem F.L. Buschkens, Richard Price, Maroon societies, rebel slave communities in the Americas. Anchor Books, Anchor Press/Doubleday Garden City, New York 1973. 429 pag., 7 ill.

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    R. de Ridder

    1986-01-01

    (50 pp. - R. de Ridder, Dennis Tedlock, The spoken word and the work of interpretation, Philadelphia: University of Pennsylvania Press, 1983. ix + 365 pp., 8 ill. - R. de Ridder, Dennis Tedlock, Popol Vuh, The definitive edition of the Mayan Book of the Dawn of Life and the Glories of Gods and Kings, New York: Simon and Schuster, 1985. 380 pp., 32 ill. - G. van Roon, Dietmar Rothermund, Die Peripherie in der Weltwirtschaftskrise: Afrika, Asien und Lateinamerika 1929-1939, Paderborn: Ferdinand Schýningh, 1983, 295 pp. - Thilo C. Schadeberg, Gýnter Dabitz, Geschichte der erforschung der Nuba-Berge, Arbeiten aus dem Seminar fýr Výlkerkunde der Johann Wolfgang Goethe-Universitýt Frankfurt am Main, Band 17, Wiesbaden: Franz Steiner Verlag, 1985. 280 pp., maps, tables, illus. - L. van Vroonhoven, Ger van Roon, Derde Wereld in depressie, Leiden: Nijhoff, 1985, 139 p. - Wim van Zanten, Nigel Phillips, Sijobang, sung narrative poetry of West Sumatra, Cambridge Studies in Oral and Literate Culture, no. 1, Cambridge: Cambridge University Press, 1981. xi + 255 pp., photos, texts and translations, short glossary of Minangkabau words, Bibliography, index.

  14. Books Are Good Friends

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Books are our friends because they are bridges to knowledge.Knowledge is valuable because it enriches our life and brings us happiness.Almost all great men in the history of mankind loved books.We have every reason to believe it is the knowledge in books that led them to success.There is no genius without books.Because books give them knowledge and knowledge gives them

  15. New illustrated stars and planets

    CERN Document Server

    Cooper, Chris; Nicolson, Iain; Stott, Carole

    2002-01-01

    Stars & Plantes, written by experts and popular science writers, is a comprehensive overview of our Universe - what is it, where it came from and how we discovered it. This intriguing, information-rich new reference book contains over 300 stunning images from the Hubble Telescope and leading observatories from around the world as well as diagrams to explain the finer points of theory. With extensive sections on everything from the Solar System to how stars form Stars & Planets will appeal to beginners and the serious stargazer alike.

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    A. N. J. den Hollander

    1972-01-01

    Gill-Queen’s University Press, Montreal & London 1970. 499 p., 84 ills., 4 maps. - Arne Biörnstad, Odd Nordland, Brewing and beer traditions in Norway. Universitetsforlaget, Oslo-Bergen-Tromsö 1969. 320 p., 114 ills. - A.H.J. Prins, R. G. P. Hill, The Lapps to-day in Finland, Norway and Sweden, vol. II; Oslo (Universitetsforlag 1969, 357 pag., K. Nickul (eds. - C. Baks, Dorothy Willner, Nation-building and community in Israel. Princeton University Press, Princeton, New Jersey, 1969. 478 pp. - Rudolf van Zantwijk, Hugo G. Nutini, San Bernardino Contla, Marriage and Family structure in a Tlaxcalan Municipio. University of Pittsburgh Press, Pittsburgh 1968. VIII + 420 blz. - Rudolf van Zantwijk, Shuichi Nagata, Modern transformations of Moenkopi Pueblo. Illinois Studies in Anthropology, nr. 6. University of Illinois Press, Urbana, Chicago, London 1970. XVII + 336 blz., 25 ills. - Th. J. C. Brasser, Robin Fox, The Keresan Bridge; a problem in Pueblo ethnology. London School of Economics Monographs on Social Anthropology, No. 35. The Athlone Press, London, 1967. xii & 216 pp. - A. N. J. den Hollander, Ulf Hannerz, Soulside; Inquiries into ghetto culture and community. New York & London, Columbia University Press, 1969, 236 blz. - H.J.M. Claessen, J.W. Schulte Nordholt, In de schaduw van een groot licht. De negerrevolutie in Amerika. Het zuiden 1954-1966. Van Loghum en Slaterus, Deventer 1971. 332 pp., ill., literatuuropgave, register. - Stephen Wild, Hugh Tracey, Chopi musicians. Oxford University Press for International African Institute. London, 1970. 193 pp., 15 plates, 7 diagrams, 2 maps. - A.A. Trouwborst, Meyer Fortes, Time and social structure and other essays. London school of economics monographs on social anthropology no. 40. University of London: The Athlone Press, New York: Humanities Press Inc. 1970, IX, 287 p., illustr. - A. Maesen, Michael Swithenbank, Ashanti Fetish Houses. Ghana Universities Press, Oxford University Press, Accra 1969. 68 pp., 69 fig., I K., bibl. - C

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1997-01-01

    . Kingston: The Press - University of the West Indies, 1996. xxiii + 147 pp. -Donald R. Hill, Peter Manuel ,Caribbean currents: Caribbean music from Rumba to Reggae. Philadelphia: Temple University Press, 1995. xi + 272 pp., Kenneth Bilby, Michael Largey (eds -Daniel J. Crowley, Judith Bettelheim, Cuban festivals: An illustrated anthology. New York: Garland Publishing, 1993. x + 261 pp. -Judith Bettelheim, Ramón Marín, Las fiestas populares de Ponce. San Juan: Editorial de la Universidad de Puerto Rico, 1994. 277 pp. -Marijke Koning, Eric O. Ayisi, St. Eustatius: The treasure island of the Caribbean. Trenton NJ: Africa World Press, 1992. xviii + 224 pp. -Peter L. Patrick, Marcyliena Morgan, Language & the social construction of identity in Creole situations. Los Angeles: Center for Afro-American studies, UCLA, 1994. vii + 158 pp. -John McWhorter, Tonjes Veenstra, Serial verbs in Saramaccan: Predication and Creole genesis. The Hague: Holland Academic Graphic, 1996. x + 217 pp. -John McWhorter, Jacques Arends, The early stages of creolization. Amsterdam/Philadelphia: John Benjamins, 1995. xv + 297 pp.

  18. Book Reviews

    Directory of Open Access Journals (Sweden)

    David Pace

    1987-01-01

    , Bernhard Gardi, Zaïre masken figuren, Museum für Völkerkunde und Schweizerisches Museum für Volkskunde, Basel, 1986. - J. Miedema, Bruce M. Knauft, Good company and violence: Sorcery and social action in a lowland New Guinea Society, Berkeley, Los Angeles/London: University of California Press, 1985, X + 474 pp. - David S. Moyer, David H. Turner, Life before genesis, a conclusion: An understanding of the significance of Australian aboriginal culture, Toronto Studies in religion volume 1, Peter Lang, New York, 1983, vii + 181 pp. - B. van Norren, Peter Kloos, Onderzoekers onderzocht; Ethische dilemma’s in antropologisch veldwerk, DSWO Press, Leiden, 1984. - Jérôme Rousseau, Victor T. King, The Maloh of West Kalimantan. An ethnographic study of social inequality and social change among an Indonesian Borneo people, Dordrecht-Holland/Cinnaminson-U.S.A.: Foris Publications, Verhandelingen van het Koninklijk Instituut voor Taal-, Land- en Volkenkunde no. 108, 1985. viii + 252 pp., maps, diagrams, plates, glossary. - Jérôme Rousseau, Alain Testart, Le communisme primitif, I. Economie et idéologie, Paris: Editions de la Maison des Sciences de l’Homme, 1985, 549 pp. - Arie de Ruijter, David Pace, Claude Lévi-Strauss. The bearer of ashes, London: Routledge and Kegan Paul (Ark Paperbacks, 1986. - B.J. Terwiel, Roland Mischung, Religion und Wirklichkeitsvorstellungen in einem Karen-Dorf Nordwest-Thailands, Weisbaden: Franza Steiner Verlag, 1984. - B.J. Terwiel, Niels Mulder, Everyday life in Thailand; An interpretation, Second, Revised edition, Bangkok: Duang Kamol, 1985. 227 pages, paperback. - R.S. Wassing, Sidney M. Mead, Art and artists of Oceania, The Dunmore Press, Palmerston North, New Zealand, 1983. 308 pp., drawings, black and white illustrations., Bernie Kernot (eds. - Harriet T. Zurndorfer, Maarten van der Wee, Aziatische Produktiewijze en Mughal India, Ph.D thesis, Katholieke Universiteit, Nijmegen, 1985. xv + 399 pp. - M.A. van Bakel, J. Terrell, Prehistory

  19. Book Reviews

    Directory of Open Access Journals (Sweden)

    Peter Metcalf

    1990-10-01

    Netherlands East Indies: Scenarios, plans, policy 1892-1920], Amsterdam: Van Soeren, 1988, 482 pp. - Rudy de Jongh, Sjoerd Rienk Jaarsma, Waarneming en interpretatie. Vergaring en gebruik van ethnografische informatie in Nederlands Nieuw-Guinea (1950-1962. Utrecht: Interdisiplinair Sociaal Wetenschappelijk Onderzoekinstituut Rijksuniversiteit, 1990. 247 pp. English summary. - Ward Keeler, J.Joseph Errington, Structure and style in Javanese: A semiotic view of linguistic etiquette, Philadelphia: University of Pennsylvania Press, 1988, 290 pp. - Ank Klomp, Raymond T. Smith, Kinship and class in the West Indies; A genealogical study of Jamaica and Guyana, Cambridge etc.: Cambridge Studies in Social Anthropology, Cambridge University Press, 1988. - G.J. Knaap, A.H.P. Clemens, Het belang van de Buitengewesten; Economische expansie en koloniale staatsvorming in de Buitengewesten van Nederlands-Indië 1870-1942, NEHA-series III, deel 7, Amsterdam: NEHA, viii + 306 pp. 1989., J.Th. Lindblad (eds. - Jaap de Moor, E.S. van Eyck van Heslinga, Van compagnie naar koopvaardij; De scheepvaartverbinding van de Bataafse Republiek met de koloniën in Azië 1795-1806, Amsterdam: De Bataafsche Leeuw, 1988. [Hollandse Historische Reeks, no. IX.] 320 pp., kaart, ills., tabellen, bibliografie, index. - Otto van den Muijzenberg, Jean-Claude Lejosne, Le journal de voyage de G. van Wuysthoff et de ses assistants au Laos (1641-1642, Metz: Editions du Centre de Documentation du Cercle de Culture et de Recherches Laotiennes, 1987. 370 pp., 3 indices, bibliography, maps, illustrations. - Gert J. Oostindie, M.J. van den Blink, Olie op de golven; De betrekkingen tussen Nederland/Curaçao en Venezuela gedurende de eerste helft van de twintigste eeuw, Amsterdam: De Bataafsche Leeuw, 1988, 128 pp. - Rien Ploeg, Robert M. Hill II, Continuities in highland Maya social organisation, Philadelphia: University of Pennsylvania Press, xxii + 176 pp., 1987., John Monaghan (eds. - Harry A. Poeze, Takashi Shiraishi, An

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    M. Schoffeleers

    1989-10-01

    Full Text Available - Victoria J. Baker, Anthony Jackson, Anthropology at home, ASA monographs 25, London: Tavistock Publications, 1987, 221 pages. - Thomas Bargatzky, Martin A. van Bakel, Private politics; A multi-disciplinary approach to ‘Big-Man’ systems, Studies in Human Society, Vol. I, Leiden: E.J. Brill, 1986. x, 220 pp., illustrations, maps, index., Renée R. Hagesteijn, Pieter van de Velde (eds. - W.E.A. van Beek, Victor W. Turner, The anthropology of experience, (with an epilogue by Clifford Geertz. Urbana and Chicago: University of Illinois Press, 1986., Edward M. Bruner (eds. - W. van den Broeke, H. Meyer, De Deli Spoorweg Maatschappij; Driekwart eeuw koloniaal spoor, Zutphen: Walburg Pers, met medewerking van F.A.J. Heckler. 1987; 152 blz. - R. Buijtenhuijs, S. Bernus et al., Le fils et le neveu: Jeux et enjeux de la parenté tourarègue, Cambridge University Press, Cambridge/Editions de la Maison des Sciences de l’Homme, Paris, 1986, XI, 343 pp. - R. Buijtenhuijs, Dominique Casajus, La tente dans la solitude: La société et les morts chez les Touaregs Kel Ferwan, Cambridge University Press, Cambridge/Editions de la Maison des Sciences de l’Homme, Paris, 1987, 390 pp. - H.J.M. Claessen, Christine Ward Gailey, Kinship to kingship; Gender hierarchy and state formation in the Tongan Islands. Austin: University of Texas Press (Texas Press Sourcebooks in Anthropology, No. 14., 1987. 326 pp., figs., index, bibl. - Alfred E. Daniëls, Richard B. Davis, Muang metaphysics, Bangkok: Pandora Press,1984. - Alfred E. Daniëls, Gehan Wijeyewardene, Place and emotion in northern Thai ritual behaviour, Bangkok: Pandora Press, 1986. - P.M.H. Groen, Jacques van Doorn, The process of decolonization 1945-1975; The military experience in comparitive perspective, CASP publications no. 17, Erasmus Universiteit Rotterdam, 1987, 46 pp., Willem J. Hendrix (eds. - Rosemarijn Hoefte, Luis H. Daal, Antilliaans verhaal. Zutphen: De Walburg Pers, 1988, Ted

  1. ILLUSTRATOR 3D旋转

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    在我们的Illustrator 3D系列第二部分.德里克·利亚将为我们介绍这一软件的Revolve(旋转成型)效果.并讲述如何在3D空间中旋转平面物体以得到精彩效果的。

  2. Fisher's "Scale-Book": An Early Attempt at Educational Measurement.

    Science.gov (United States)

    Cadenhead, Kenneth; Robinson, Richard

    1987-01-01

    The authors report on the discovery of a nineteenth century document that illustrates an early example of educational measurement, namely the "Scale-Book" developed by George Fisher (1862). The text of Fisher's document is appended. (TJH)

  3. Development of a Certified Reference Material for Lyophilized Vitamin K 1%维生素 K1冻干标准物质的研制

    Institute of Scientific and Technical Information of China (English)

    张晓光; 黄挺; 张伟; 黄亮; 全灿; 李红梅; 杨屹

    2015-01-01

    采用二甲基亚砜(DMSO)作为冻干标准物质的溶剂,以重量法准确配制维生素 K1/ DMSO 溶液,再进行分装、冷冻干燥,经定性分析、定值分析、均匀性检验、稳定性考察和不确定度评定,研制了维生素 K1冻干标准物质。以维生素 K1纯度标准物质溶液为校准品,对得到的冻干物质进行了高效液相色谱法定值分析,冻干标准物质的准确定值结果为0.96 mg/ mL,相对扩展不确定度为7%。建立的维生素 K1冻干标准物质研制方法,对于临床检验中维生素 K1的准确测定和相关疾病的正确诊断治疗以及维生素 K1长期保存具有重要意义。%Dimethyl sulfone( DMSO)is firstly applied as the solvent for a lyophilized certified reference material (CRM). Vitamin K1 / DMSO solution is prepared by gravimetry,and is sub-divided and lyophilized,the lyophilized vitamin K1 CRM is developed through qualitative analysis,quantitative analysis,homogeneity study,stability study and uncertainty evaluation. Certified value of lyophilization vitamin K1 is analyzed by high performance liquid chromatography method, using the vitamin K1 purity CRM as a calibrant. The certified value is 0. 96 mg/ mL,with the relative expanded uncertainty of 7% . The method of CRM lyophilized vitamin K1 makes great significance for the accurate determination the disease in clinical examination and the long-term preservation of vitamin K1 .

  4. P70S6K 1 regulation of angiogenesis through VEGF and HIF-1{alpha} expression

    Energy Technology Data Exchange (ETDEWEB)

    Bian, Chuan-Xiu; Shi, Zhumei [Department of Pathology, Cancer Center, Nanjing Medical University, Nanjing 210029 (China); Meng, Qiao; Jiang, Yue; Liu, Ling-Zhi [Department of Pathology, Anatomy and Cell Biology, Thomas Jefferson University, Philadelphia, PA 19107 (United States); Jiang, Bing-Hua, E-mail: binghjiang@yahoo.com [Department of Pathology, Cancer Center, Nanjing Medical University, Nanjing 210029 (China); Department of Pathology, Anatomy and Cell Biology, Thomas Jefferson University, Philadelphia, PA 19107 (United States)

    2010-07-30

    Research highlights: {yields} P70S6K1 regulates VEGF expression; {yields} P70S6K1 induces transcriptional activation through HIF-1{alpha} binding site; {yields} P70S6K1 regulates HIF-1{alpha}, but not HIF-1{beta} protein expression; {yields} P70S6K1 mediates tumor growth and angiogenesis through HIF-1{alpha} and VEGF expression. -- Abstract: The 70 kDa ribosomal S6 kinase 1 (p70S6K1), a downstream target of phosphoinositide 3-kinase (PI3K) and ERK mitogen-activated protein kinase (MAPK), is an important regulator of cell cycle progression, and cell proliferation. Recent studies indicated an important role of p70S6K1 in PTEN-negative and AKT-overexpressing tumors. However, the mechanism of p70S6K1 in tumor angiogenesis remains to be elucidated. In this study, we specifically inhibited p70S6K1 activity in ovarian cancer cells using vector-based small interfering RNA (siRNA) against p70S6K1. We found that knockdown of p70S6K1 significantly decreased VEGF protein expression and VEGF transcriptional activation through the HIF-1{alpha} binding site at its enhancer region. The expression of p70S6K1 siRNA specifically inhibited HIF-1{alpha}, but not HIF-1{beta} protein expression. We also found that p70S6K1 down-regulation inhibited ovarian tumor growth and angiogenesis, and decreased cell proliferation and levels of VEGF and HIF-1{alpha} expression in tumor tissues. Our results suggest that p70S6K1 is required for tumor growth and angiogenesis through HIF-1{alpha} and VEGF expression, providing a molecular mechanism of human ovarian cancer mediated by p70S6K1 signaling.

  5. Hyperactive S6K1 mediates oxidative stress and endothelial dysfunction in aging: inhibition by resveratrol.

    Science.gov (United States)

    Rajapakse, Angana G; Yepuri, Gautham; Carvas, João M; Stein, Sokrates; Matter, Christian M; Scerri, Isabelle; Ruffieux, Jean; Montani, Jean-Pierre; Ming, Xiu-Fen; Yang, Zhihong

    2011-04-22

    Mammalian target of rapamycin (mTOR)/S6K1 signalling emerges as a critical regulator of aging. Yet, a role of mTOR/S6K1 in aging-associated vascular endothelial dysfunction remains unknown. In this study, we investigated the role of S6K1 in aging-associated endothelial dysfunction and effects of the polyphenol resveratrol on S6K1 in aging endothelial cells. We show here that senescent endothelial cells displayed higher S6K1 activity, increased superoxide production and decreased bioactive nitric oxide (NO) levels than young endothelial cells, which is contributed by eNOS uncoupling. Silencing S6K1 in senescent cells reduced superoxide generation and enhanced NO production. Conversely, over-expression of a constitutively active S6K1 mutant in young endothelial cells mimicked endothelial dysfunction of the senescent cells through eNOS uncoupling and induced premature cellular senescence. Like the mTOR/S6K1 inhibitor rapamycin, resveratrol inhibited S6K1 signalling, resulting in decreased superoxide generation and enhanced NO levels in the senescent cells. Consistent with the data from cultured cells, an enhanced S6K1 activity, increased superoxide generation, and decreased bioactive NO levels associated with eNOS uncoupling were also detected in aortas of old WKY rats (aged 20-24 months) as compared to the young animals (1-3 months). Treatment of aortas of old rats with resveratrol or rapamycin inhibited S6K1 activity, oxidative stress, and improved endothelial NO production. Our data demonstrate a causal role of the hyperactive S6K1 in eNOS uncoupling leading to endothelial dysfunction and vascular aging. Resveratrol improves endothelial function in aging, at least in part, through inhibition of S6K1. Targeting S6K1 may thus represent a novel therapeutic approach for aging-associated vascular disease.

  6. Foods The Indians Gave Us. Coloring Book.

    Science.gov (United States)

    Hail, Raven

    This children's coloring book devotes a page to each of twenty of the most familiar American Indian plant foods: avocado, green beans, black walnuts, cocoa, corn, peanuts, pecans, chile peppers, pineapples, popcorn, potatoes, pumpkins, squash, strawberries, sugar maple, sunflowers, sweet potatoes, tapioca, tomatoes, and vanilla. Illustrating each…

  7. Libro de Lectura Suplemento (Reading Book Supplement).

    Science.gov (United States)

    Saavedra, Frances

    This is the fourth in a series of four reading books written in Spanish and designed for use in elementary bilingual education programs. The reader contains five stories. Four of them concern the adventures of various animals; the last concerns a wedding. Each story is followed by a list of new vocabulary and the reader is illustrated with…

  8. Book review: Mineral resource estimation

    Science.gov (United States)

    Mihalasky, Mark J.

    2016-01-01

    Mineral Resource Estimation is about estimating mineral resources at the scale of an ore deposit and is not to be mistaken with mineral resource assessment, which is undertaken at a significantly broader scale, even if similar data and geospatial/geostatistical methods are used. The book describes geological, statistical, and geostatistical tools and methodologies used in resource estimation and modeling, and presents case studies for illustration. The target audience is the expert, which includes professional mining geologists and engineers, as well as graduate-level and advanced undergraduate students.

  9. Images of Poverty in Picture Books with International Settings.

    Science.gov (United States)

    Lamme, Linda Leonard

    2000-01-01

    Explores how authors and illustrators of 21 children's picture books with international settings portray children of poverty. Discusses causes and representations of poverty in the books: fathers who leave home to find work; child laborers; modes of transportation; housing; children who lack material goods; and the barter system. Finds…

  10. Creating Science Picture Books for an Authentic Audience

    Science.gov (United States)

    DeFauw, Danielle L.; Saad, Klodia

    2014-01-01

    This article presents an authentic writing opportunity to help ninth-grade students use the writing process in a science classroom to write and illustrate picture books for fourth-grade students to demonstrate and share their understanding of a biology unit on cells. By creating a picture book, students experience the writing process, understand…

  11. Radical Visions: Five Picture Books by Peter Sis.

    Science.gov (United States)

    Latham, Don

    2000-01-01

    Examines five picture books by author/illustrator Peter Sis, and how they deal explicitly with people who through extraordinary journeys develop extraordinary ways of seeing the world. Discusses use of paratextual elements, multiple formats, multiple layers of narrative, and a merging of texts and pictures. Suggests ways these books might be used…

  12. Ramsey Number of K2,s+1 vs. K1,n%关于K2,s+1 VS,K1,n的Ramsey数

    Institute of Scientific and Technical Information of China (English)

    秦大伟; 沈大鹏

    2007-01-01

    It is shown that the Ramsey number r(K2,s+1, K1,n) ≤ n + √sn+ (s + 3)/2 + o(1) for large n, and r(K2,s+1, K1,n)∈{(q-1)2/s+1,-(q-1)2/s+2},wheren: (q-1)2/s-q+2 and q is a prime power such that s|(q - 1).

  13. Psychological empowerment: issues and illustrations.

    Science.gov (United States)

    Zimmerman, M A

    1995-10-01

    Discussed several issues related to psychological empowerment. The thesis of this paper is that the development of a universal and global measure of psychological empowerment may not be a feasible or appropriate goal. I begin by distinguishing between empowerment processes and outcomes. Underlying assumptions are discussed including the notion that empowerment differs across people, contexts, and times. A nomological network that includes intrapersonal, interactional, and behavioral components is also presented. Two examples of psychological empowerment for voluntary service organization members and members of a mutual help organization are described to help illustrate differences in the specific variables that may be used to measure psychological empowerment in different populations and settings.

  14. BookFinder.com

    CERN Document Server

    BookFinder.com is produced by the bibliophiles at 13th Generation Media of Berkeley, California. Our goal is to provide fellow readers unbiased realtime information about books available online. Rather than selling books ourselves (does the world rea Amazon.com wannabe?), we've teamed up with over 15,000 of the finest booksellers online to bring you the largest book catalog available anywhere, either online or offline.

  15. The Economics of Illustration: The Revue illustrée in the 1890s

    Directory of Open Access Journals (Sweden)

    Evanghelia Stead

    2016-12-01

    Full Text Available The Parisian Revue Illustrée (1885–1912, a middle-class periodical of broad circulation and sophisticated iconography, lets us examine the expansion of fin-de-siècle culture beyond the so-called ‘petites revues’, particularly in the years 1894–1903. Through this fashionable all-publics fortnightly, typically fin-de-siècle tales and songs on transient motives, replete with Art Nouveau images and ornamentation, reach bourgeois households. The article shows the niche category the magazine occupied through its copious and exciting iconography. Using unpublished correspondence and print material culture, it throws light on the ways its editors turned the more refined parts of the magazine into deluxe photo-mechanically produced books. The study focuses on two men, René Baschet, the Revue’s editor from 1889 to 1904, and Jérôme Doucet, his assistant editor from July 1897 to 1902, and two fin-de-siècle writers, Catulle Mendès and Jean Lorrain, as well as up-coming artists André Cahard, Henry Bellery-Desfontaines, Manuel Orazi, and Carloz Schwabe. The case shows that sophisticated illustration was a financial spur that came cheap while it supported the so-called ‘decadent’ writings. Further, with refined taste, numerous connexions to artists, and work for a Dutch publisher, Jérôme Doucet emerges as a key figure behind the scenes.

  16. Companionship of Books

    Institute of Scientific and Technical Information of China (English)

    薛美娟

    2012-01-01

    A man may usually be known by the books he reads as well as by the company he keeps; for there is a companionship of books as well as of men~ and one should always live in the best company, whether it be of books or of men.

  17. Thinking outside the Book

    Science.gov (United States)

    Eaton, Dolores E.

    2012-01-01

    A title, a cover, and pages with "substance" bound together--this is what the author's eighth-grade students decided were the essential elements of a book. There could be more, but no less. In art, one does judge a book by its cover. In this article, the author describes how her students created their books. (Contains 1 online resource.)

  18. The K-1 reusable aerospace vehicle: managing to achieve low cost.

    Science.gov (United States)

    Mueller (HM), George E.; Lepore, Debra Facktor

    2000-03-01

    Kistler Aerospace Corporation is developing the world's first privately funded, fully reusable aerospace vehicle, the K-1. This vehicle represents a new implementation of proven technologies, designed by an elite, experienced team of engineers and managers and implemented by the best manufacturing capability in the United States. Kistler Aerospace expects to begin commercial operations of the K-1 in 2000. Market researchers predict that during the next decade telecommunications satellite ventures will require launch services for over 1,400 payloads to LEO. This prediction greatly exceeds the current available industry capacity. The K-1 was designed primarily to meet this anticipated growth in demand. Significant progress has been made in constructing the K-1 vehicle fleet. The fully reusable K-1 vehicle is designed to lower the cost of access to space, increase launch reliability, and reduce lead-time-to-launch requirements. The K-1 will offer significant cost benefits and aircraft type reliability based on a proven flight record.

  19. Size multipartite Ramsey numbers for small paths versus books

    Directory of Open Access Journals (Sweden)

    Chula J. Jayawardene

    2016-10-01

    Full Text Available Given $j \\ge 2$,  for  graphs $G$ and $H$, the size Ramsey multipartite number $m_j(G, H$ is defined as the smallest natural number $t$ such that any blue red coloring of the edges of the  graph $K_{j \\times t}$, necessarily containes a red $G$ or a blue $H$ as subgraphs. Let the book with $n$ pages is defined as the graph $K_1 + K_{1,n}$ and denoted by $B_n$. In this paper, we  obtain the exact values of the size Ramsey numbers $m_j(P_3, H$ for $j \\ge 3$ where  $H$ is a book $B_n$. We also derive some upper and lower bounds for the size Ramsey numbers $m_j(P_4, H$ where  $H$ is a book $B_n$.

  20. [Research on progress and prospect of kinase S6K1].

    Science.gov (United States)

    Zhang, Hui; Liang, Junyu; Zhang, Ji

    2014-08-01

    Obesity is a prevalent metabolic disorder, which seriously affects human health and has become the world's public health problem. Kinase S6K1, an important downstream effector of mammalian target of rapamycin (mTOR), influences specific pathological responses, including obesity, type 2 diabetes and cancer. Presently, S6K1 has become an attractive therapeutic target in the treatment of these disorders. Here, the functions of kinase S6K1, its molecular regulation mechanisms, related pathogenesis of disease and relevant small molecular inhibitors are reviewed. Finally, the prospect of research toward S6K1 is expected as well.

  1. Book Review: Mastering Windows Network Forensics and Investigation, 2/e

    Directory of Open Access Journals (Sweden)

    John C. Ebert

    2012-12-01

    Full Text Available Anson, S., Bunting, S., Johnson, R., & Pearson, S. (2012. Mastering Windows Network Forensics and Investigation, 2nd ed. Indianapolis: John Wiley & Sons. 674 pages, ISBN: 978-1-118-16382-5, $59.99 USA/$71.99 CAN.Reviewed by John C. Ebert, Metropolitan State University (eberjo@metrostate.eduThe book is available as a paperback and e-book. The e-book versions allow you to preview several chapters at any of a number of online vendors. The e-book prices vary from the same as the soft cover version ($59.99 to about $38.99. Some of the vendor's e-books retain the color illustrations found in the print version, but others produce them in grey scale, so you might want to look out for that. The book is divided into four parts (17 chapters plus two appendices.I am compelled to give the book illustrations a highly unfavorable assessment regarding their readability qualities. Their content is otherwise fine and meaningful. Time and again the illustrations are so miniscule that even those of us with the best of vision will be seriously challenged. I hold out the recommendation to review your e-book options over the hardcopy edition. At least in an e-book you have the hope of doing a page-zoom. Review your e-book providers carefully; some I reviewed had "fuzzy graphics." Notwithstanding the problem illustrations, I still recommend this book for its in-the-trenches information and the desktop reference it will become.(see PDF for full review

  2. Love British Books 2012

    OpenAIRE

    Middleton, Paul; Puzzovio, Carolyn

    2012-01-01

    The book is a catalogue of an exhibition of British books to be held in Armenia in June 2012 at the 'Armenian Society for Cultural Relations with Foreign Countries'. This is an event arranged with the Armenian Ministry of Culture as part of the UNESCO: 'Yerevan, International Book Capital 2012' & the Armenian 2012 celebrations to mark the 500th anniversary of the first printed book in the Armenian language. The catalogue describes all the books in the exhibition, with a photograph of each and...

  3. A Phenomenological Research Design Illustrated

    Directory of Open Access Journals (Sweden)

    Thomas Groenewald

    2004-03-01

    Full Text Available This article distills the core principles of a phenomenological research design and, by means of a specific study, illustrates the phenomenological methodology. After a brief overview of the developments of phenomenology, the research paradigm of the specific study follows. Thereafter the location of the data, the data-gathering the data-storage methods are explained. Unstructured in-depth phenomenological interviews supplemented by memoing, essays by participants, a focus group discussion and field notes were used. The data explicitation, by means of a simplified version of Hycner's (1999 process, is further explained. The article finally contains commentary about the validity and truthfulness measures, as well as a synopsis of the findings of the study.

  4. Illustrating the practice of statistics

    Energy Technology Data Exchange (ETDEWEB)

    Hamada, Christina A [Los Alamos National Laboratory; Hamada, Michael S [Los Alamos National Laboratory

    2009-01-01

    The practice of statistics involves analyzing data and planning data collection schemes to answer scientific questions. Issues often arise with the data that must be dealt with and can lead to new procedures. In analyzing data, these issues can sometimes be addressed through the statistical models that are developed. Simulation can also be helpful in evaluating a new procedure. Moreover, simulation coupled with optimization can be used to plan a data collection scheme. The practice of statistics as just described is much more than just using a statistical package. In analyzing the data, it involves understanding the scientific problem and incorporating the scientist's knowledge. In modeling the data, it involves understanding how the data were collected and accounting for limitations of the data where possible. Moreover, the modeling is likely to be iterative by considering a series of models and evaluating the fit of these models. Designing a data collection scheme involves understanding the scientist's goal and staying within hislher budget in terms of time and the available resources. Consequently, a practicing statistician is faced with such tasks and requires skills and tools to do them quickly. We have written this article for students to provide a glimpse of the practice of statistics. To illustrate the practice of statistics, we consider a problem motivated by some precipitation data that our relative, Masaru Hamada, collected some years ago. We describe his rain gauge observational study in Section 2. We describe modeling and an initial analysis of the precipitation data in Section 3. In Section 4, we consider alternative analyses that address potential issues with the precipitation data. In Section 5, we consider the impact of incorporating additional infonnation. We design a data collection scheme to illustrate the use of simulation and optimization in Section 6. We conclude this article in Section 7 with a discussion.

  5. BOOK REVIEW: Two Books about FRBR, Compared

    Directory of Open Access Journals (Sweden)

    Christine Schwartz

    2008-09-01

    Full Text Available This article reviews 2 books on FRBR published in the past year. Although both books aim to be introductions to FRBR, their approaches are very different. One is sort of a FRBR study guide with commentary, the other a collection of essays. Robert Maxwell's book, FRBR: A Guide for the Perplexed, takes the study guide approach. Arlene Taylor edited Understanding FRBR: What It Is and How It Will Affect Our Retrieval Tools, a book of essays about FRBR and FRAD, written by cataloging experts, aimed at a broader audience, not just the cataloging specialist. The first seven chapters lay out the basics: introductions to FRBR and FRAD, FRBR research, FRBR and the history of cataloging, FRBR and RDA. These chapters provide an excellent introduction for those new to FRBR. The last seven chapters each look at different types of resources in relation to FRBR.

  6. Role of GluK1 kainate receptors in seizures, epileptic discharges, and epileptogenesis.

    Science.gov (United States)

    Fritsch, Brita; Reis, Janine; Gasior, Maciej; Kaminski, Rafal M; Rogawski, Michael A

    2014-04-23

    Kainate receptors containing the GluK1 subunit have an impact on excitatory and inhibitory neurotransmission in brain regions, such as the amygdala and hippocampus, which are relevant to seizures and epilepsy. Here we used 2-amino-3-(3-hydroxy-5-tert-butylisoxazol-4-yl) propanoic acid (ATPA), a potent and selective agonist of kainate receptors that include the GluK1 subunit, in conjunction with mice deficient in GluK1 and GluK2 kainate receptor subunits to assess the role of GluK1 kainate receptors in provoking seizures and in kindling epileptogenesis. We found that systemic ATPA, acting specifically via GluK1 kainate receptors, causes locomotor arrest and forelimb extension (a unique behavioral characteristic of GluK1 activation) and induces myoclonic behavioral seizures and electrographic seizure discharges in the BLA and hippocampus. In contrast, the proconvulsant activity of systemic AMPA, kainate, and pentylenetetrazol is not mediated by GluK1 kainate receptors, and deletion of these receptors does not elevate the threshold for seizures in the 6 Hz model. ATPA also specifically activates epileptiform discharges in BLA slices in vitro via GluK1 kainate receptors. Olfactory bulb kindling developed similarly in wild-type, GluK1, and GluK2 knock-out mice, demonstrating that GluK1 kainate receptors are not required for epileptogenesis or seizure expression in this model. We conclude that selective activation of kainate receptors containing the GluK1 subunit can trigger seizures, but these receptors are not necessary for seizure generation in models commonly used to identify therapeutic agents for the treatment of epilepsy.

  7. Plasmid Transfer of Plasminogen K1-5 Reduces Subcutaneous Hepatoma Growth by Affecting Inflammatory Factors

    Directory of Open Access Journals (Sweden)

    Lea A. Koch

    2014-01-01

    Full Text Available There is evidence that plasminogen K1-5 (PlgK1-5 directly affects tumour cells and inflammation. Therefore, we analysed if PlgK1-5 has immediate effects on hepatoma cells and inflammatory factors in vitro and in vivo. In vitro, effects of plasmid encoding PlgK1-5 (pK1-5 on Hepa129, Hepa1-6, and HuH7 cell viability, apoptosis, and proliferation as well as VEGF and TNF-alpha expression and STAT3-phosphorylation were investigated. In vivo, tumour growth, proliferation, vessel density, and effects on vascular endothelial growth factor (VEGF and tumour necrosis factor alpha (TNF-alpha expression were examined following treatment with pK1-5. In vivo, pK1-5 halved cell viability; cell death was increased by up to 15% compared to the corresponding controls. Proliferation was not affected. VEGF, TNF-alpha, and STAT3-phosphorylation were affected following treatment with pK1-5. In vivo, ten days after treatment initiation, pK1-5 reduced subcutaneous tumour growth by 32% and mitosis by up to 77% compared to the controls. Vessel density was reduced by 50%. TNF-alpha levels in tumour and liver tissue were increased, whereas VEGF levels in tumours and livers were reduced after pK1-5 treatment. Taken together, plasmid gene transfer of PlgK1-5 inhibits hepatoma (cell growth not only by reducing vessel density but also by inducing apoptosis, inhibiting proliferation, and triggering inflammation.

  8. MEMES AS A FORM OF ILLUSTRATION IN SCIENCE AND EDUCATION

    Directory of Open Access Journals (Sweden)

    Tsatsenko L. V.

    2015-12-01

    Full Text Available In our study we attempt to analyze a new form of illustration − the meme that is widely used in science and educational process. To achieve this goal we had to assemble a collection of images to catalog and description in order to understand the new role of the illustrative image. Meme is defined as a unit of cultural information. According to the definition of Wikipedia, a meme can consider any idea, character, manner or way of doing things, consciously or unconsciously transmitted from person to person through speech, video, writing, rituals, drawings, gestures, etc. The term meme and the concept of the meme was proposed by evolutionary biologist Richard Dawkins in 1976 in his book "the Selfish gene". The article shows illustrative examples of memes based on the artwork and paintings of the great masters of painting, considered the use of created images. It shows the history of illustrative memes and transformation of images in the modern world of science and education. Using memes in scientific work, as a form of illustration, it can be noted that visualization of the object of research allows you to develop visual thinking, which has identified a number of functions: cognitive, communicative, methodological. Cognitive function is manifested in the ability to cognize an object through an image, communicative – explain the problem or task through the image; methodological – to build research with consideration of the peculiarities of the structure and morphology of the object

  9. Gender and Racial Bias in Juvenile Computer Books.

    Science.gov (United States)

    Bishop, Kay; Bishop, Jennifer

    2000-01-01

    This action research study looks at a sample of 30 juvenile computer books from the past 30 years and analyzes the illustrations for evidence of gender and racial bias as well as career depiction. Examines the gender of authors and illustrators and discusses library media implications. (Author/LRW)

  10. Book Design, Part III: Illuminated Letters and Borders.

    Science.gov (United States)

    Harms, Jeanne McLain; Lettow, Lucille

    1997-01-01

    This third in a series of articles on book design discusses and illustrates elements found within the body of the work: (1) illuminated letters, which serve as decoration, reflect cultural elements, enhance the meaning of text and illustrations, or establish motif, setting, or theme; and (2) borders, which serve as frames for text and…

  11. A (k+1)-Slope Theorem for the k-Dimensional Infinite Group Relaxation

    CERN Document Server

    Basu, Amitabh; Köppe, Matthias; Molinaro, Marco

    2011-01-01

    We prove that any minimal valid function for the k-dimensional infinite group relaxation that is piecewise linear with at most k+1 slopes and does not factor through a linear map with non-trivial kernel is extreme. This generalizes a theorem of Gomory and Johnson for k=1, and Cornuejols and Molinaro for k=2.

  12. Do Worlds Have Corners? When Children's Picture Books Invite Philosophical Questions

    Science.gov (United States)

    Maagero, Eva; Ostbye, Guri Lorentzen

    2012-01-01

    In this article, we want to present and analyse the picture book "The World has no Corners" (2006/1999) by the Norwegian author and illustrator Svein Nyhus. The book represents a new trend in Norwegian picture books for children by inviting the readers into a world of thinking and wondering about existential topics such as life and death, growing…

  13. Solid Rocket Booster-Illustration

    Science.gov (United States)

    1977-01-01

    This illustration is a cutaway of the solid rocket booster (SRB) sections with callouts. The Shuttle's two SRB's are the largest solids ever built and the first designed for refurbishment and reuse. Standing nearly 150-feet high, the twin boosters provide the majority of thrust for the first two minutes of flight, about 5.8 million pounds, augmenting the Shuttle's main propulsion system during liftoff. The major design drivers for the solid rocket motors (SRM's) were high thrust and reuse. The desired thrust was achieved by using state-of-the-art solid propellant and by using a long cylindrical motor with a specific core design that allows the propellant to burn in a carefully controlled marner. At burnout, the boosters separate from the external tank and drop by parachute to the ocean for recovery and subsequent refurbishment. The boosters are designed to survive water impact at almost 60 miles per hour, maintain flotation with minimal damage, and preclude corrosion of the hardware exposed to the harsh seawater environment. Under the project management of the Marshall Space Flight Center, the SRB's are assembled and refurbished by the United Space Boosters. The SRM's are provided by the Morton Thiokol Corporation.

  14. 完全二部图的K1,pk-因子分解%K1,pk-FACTORIZATION OF COMPLETE BIPARTITE GRAPHS

    Institute of Scientific and Technical Information of China (English)

    杜北樑

    2001-01-01

    In this paper, it is shown that a sufficient condition for the existence of a K1,pk-factorization of Km,n, whenever p is a prime number and k is a positive integer, is (1) m≤pkn,(2) n≤pkm,(3)pkn-m≡pkm- n≡0(mod(p2k - 1)) and (4)(pkn-m)(pkm- n)≡0(mod(pk - 1)pk×(p2k-1)(m+n)).

  15. Inositol Hexakisphosphate Kinase 1 (IP6K1) Regulates Inositol Synthesis in Mammalian Cells.

    Science.gov (United States)

    Yu, Wenxi; Ye, Cunqi; Greenberg, Miriam L

    2016-05-13

    myo-Inositol, the precursor of all inositol compounds, has pivotal roles in cell metabolism and signaling pathways. Although physiological studies indicate a strong correlation between abnormal intracellular inositol levels and neurological disorders, very little is known about the regulation of inositol synthesis in mammalian cells. In this study, we report that IP6K1, an inositol hexakisphosphate kinase that catalyzes the synthesis of inositol pyrophosphate, regulates inositol synthesis in mammalian cells. Ip6k1 ablation led to profound changes in DNA methylation and expression of Isyna1 (designated mIno1), which encodes the rate-limiting enzyme inositol-3-phosphate synthase. Interestingly, IP6K1 preferentially bound to the phospholipid phosphatidic acid, and this binding was required for IP6K1 nuclear localization and the regulation of mIno1 transcription. This is the first demonstration of IP6K1 as a novel negative regulator of inositol synthesis in mammalian cells.

  16. Experience the beauty of fashion illustration

    Institute of Scientific and Technical Information of China (English)

    李琳

    2013-01-01

    In recent years, fashion illustration is one of the new form of painting, fashion illustration compared to the previous illustration, it tends to be more professional and meticulous. Fashion illustration is often used in commercial ad-vertising, fashion magazines, packaging design, etc. Fashion illustrator for its strong contrast vivid colors and strong deco-rative effect, become the carrier of designers chasing with feelings of fashion .

  17. Illustrated Guide to Astronomical Wonders From Novice to Master Observer

    CERN Document Server

    Thompson, Robert

    2011-01-01

    With the advent of inexpensive, high-power telescopes priced at under 250, amateur astronomy is now within the reach of anyone, and this is the ideal book to get you started. The Illustrated Guide to Astronomical Wonders offers you a guide to the equipment you need, and shows you how and where to find hundreds of spectacular objects in the deep sky -- double and multiple stars as well as spectacular star clusters, nebulae, and galaxies. You get a solid grounding in the fundamental concepts and terminology of astronomy, and specific advice about choosing, buying, using, and maintaining the eq

  18. Involvement of S6K1 in mitochondria function and structure in HeLa cells.

    Science.gov (United States)

    Park, Jisoo; Tran, Quangdon; Mun, Kisun; Masuda, Kouhei; Kwon, So Hee; Kim, Seon-Hwan; Kim, Dong-Hoon; Thomas, George; Park, Jongsun

    2016-12-01

    The major biological function of mitochondria is to generate cellular energy through oxidative phosphorylation. Apart from cellular respiration, mitochondria also play a key role in signaling processes, including aging and cancer metabolism. It has been shown that S6K1-knockout mice are resistant to obesity due to enhanced beta-oxidation, with an increased number of large mitochondria. Therefore, in this report, the possible involvement of S6K1 in regulating mitochondria dynamics and function has been investigated in stable lenti-shS6K1-HeLa cells. Interestingly, S6K1-stably depleted HeLa cells showed phenotypical changes in mitochondria morphology. This observation was further confirmed by detailed image analysis of mitochondria shape. Corresponding molecular changes were also observed in these cells, such as the induction of mitochondrial fission proteins (Drp1 and Fis1). Oxygen consumption is elevated in S6K1-depeleted HeLa cells and FL5.12 cells. In addition, S6K1 depletion leads to enhancement of ATP production in cytoplasm and mitochondria. However, the relative ratio of mitochondrial ATP to cytoplasmic ATP is actually decreased in lenti-shS6K1-HeLa cells compared to control cells. Lastly, induction of mitophagy was found in lenti-shS6K1-HeLa cells with corresponding changes of mitochondria shape on electron microscope analysis. Taken together, our results indicate that S6K1 is involved in the regulation of mitochondria morphology and function in HeLa cells. This study will provide novel insights into S6K1 function in mitochondria-mediated cellular signaling. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. English Book Club

    CERN Multimedia

    English Book Club

    2012-01-01

    The CERN English Book Club will hold its 2012 AGM at 17h30 on Monday 5th March in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before February 27th. The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  20. English Book Club

    CERN Multimedia

    CERN English Book Club

    2010-01-01

    AGM  --  AGM  -- 2010 --  AGM  --  AGM The CERN ENGLISH BOOK CLUB will hold its 2010 AGM at 18h00 on Monday November 22nd in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before November 12th. AGM  --  AGM  -- 2010 --  AGM  --  AGM The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.  

  1. Hubble Space Telescope-Illustration

    Science.gov (United States)

    1989-01-01

    This illustration depicts a side view of the Hubble Space Telescope (HST). The HST is the product of a partnership between NASA, European Space Agency Contractors, and the international community of astronomers. It is named after Edwin P. Hubble, an American Astronomer who discovered the expanding nature of the universe and was the first to realize the true nature of galaxies. The purpose of the HST, the most complex and sensitive optical telescope ever made, is to study the cosmos from a low-Earth orbit. By placing the telescope in space, astronomers are able to collect data that is free of the Earth's atmosphere. The HST detects objects 25 times fainter than the dimmest objects seen from Earth and provides astronomers with an observable universe 250 times larger than visible from ground-based telescopes, perhaps as far away as 14 billion light-years. The HST views galaxies, stars, planets, comets, possibly other solar systems, and even unusual phenomena such as quasars, with 10 times the clarity of ground-based telescopes. The major elements of the HST are the Optical Telescope Assembly (OTA), the Support System Module (SSM), and the Scientific Instruments (SI). The HST is approximately the size of a railroad car, with two cylinders joined together and wrapped in a silvery reflective heat shield blanket. Wing-like solar arrays extend horizontally from each side of these cylinders, and dish-shaped anternas extend above and below the body of the telescope. The HST was deployed from the Space Shuttle Discovery (STS-31 mission) into Earth orbit in April 1990. The Marshall Space Flight Center had responsibility for design, development, and construction of the HST. The Perkin-Elmer Corporation, in Danbury, Connecticut, developed the optical system and guidance sensors. The Lockheed Missile and Space Company of Sunnyvale, California produced the protective outer shroud and spacecraft systems, and assembled and tested the finished telescope.

  2. Space Shuttle Orbiter-Illustration

    Science.gov (United States)

    2001-01-01

    This illustration is an orbiter cutaway view with callouts. The orbiter is both the brains and heart of the Space Transportation System (STS). About the same size and weight as a DC-9 aircraft, the orbiter contains the pressurized crew compartment (which can normally carry up to seven crew members), the huge cargo bay, and the three main engines mounted on its aft end. There are three levels to the crew cabin. Uppermost is the flight deck where the commander and the pilot control the mission. The middeck is where the gallery, toilet, sleep stations, and storage and experiment lockers are found for the basic needs of weightless daily living. Also located in the middeck is the airlock hatch into the cargo bay and space beyond. It is through this hatch and airlock that astronauts go to don their spacesuits and marned maneuvering units in preparation for extravehicular activities, more popularly known as spacewalks. The Space Shuttle's cargo bay is adaptable to hundreds of tasks. Large enough to accommodate a tour bus (60 x 15 feet or 18.3 x 4.6 meters), the cargo bay carries satellites, spacecraft, and spacelab scientific laboratories to and from Earth orbit. It is also a work station for astronauts to repair satellites, a foundation from which to erect space structures, and a hold for retrieved satellites to be returned to Earth. Thermal tile insulation and blankets (also known as the thermal protection system or TPS) cover the underbelly, bottom of the wings, and other heat-bearing surfaces of the orbiter to protect it during its fiery reentry into the Earth's atmosphere. The Shuttle's 24,000 individual tiles are made primarily of pure-sand silicate fibers, mixed with a ceramic binder. The solid rocket boosters (SRB's) are designed as an in-house Marshall Space Flight Center project, with United Space Boosters as the assembly and refurbishment contractor. The solid rocket motor (SRM) is provided by the Morton Thiokol Corporation.

  3. Software engineer's pocket book

    CERN Document Server

    Tooley, Michael

    2013-01-01

    Software Engineer's Pocket Book provides a concise discussion on various aspects of software engineering. The book is comprised of six chapters that tackle various areas of concerns in software engineering. Chapter 1 discusses software development, and Chapter 2 covers programming languages. Chapter 3 deals with operating systems. The book also tackles discrete mathematics and numerical computation. Data structures and algorithms are also explained. The text will be of great use to individuals involved in the specification, design, development, implementation, testing, maintenance, and qualit

  4. Electrical engineer's reference book

    CERN Document Server

    Laughton, M A

    1985-01-01

    Electrical Engineer's Reference Book, Fourteenth Edition focuses on electrical engineering. The book first discusses units, mathematics, and physical quantities, including the international unit system, physical properties, and electricity. The text also looks at network and control systems analysis. The book examines materials used in electrical engineering. Topics include conducting materials, superconductors, silicon, insulating materials, electrical steels, and soft irons and relay steels. The text underscores electrical metrology and instrumentation, steam-generating plants, turbines

  5. Probiotic Mixture Golden Bifido Prevents Neonatal Escherichia coli K1 Translocation via Enhancing Intestinal Defense

    Directory of Open Access Journals (Sweden)

    Qing Zeng

    2017-09-01

    Full Text Available Escherichia coli (E. coli K1 sepsis and meningitis is a severe infection characterized by high mortality in neonates. Successful colonization and translocation across the intestinal mucosa have been regarded as the critical steps for E. coli K1 sepsis and meningitis. We recently reported that the probiotic mixture, Golden Bifido (containing live Lactobacillus bulgaricus, Bifidobacterium, and Streptococcus thermophilus, LBS has a preventive role against neonatal E. coli K1 bacteremia and meningitis. However, the interaction between the neonatal gut barrier, probiotics and E. coli K1 is still not elucidated. The present study aims to investigate how LBS exerts its protective effects on neonatal gut barrier during E. coli K1 infection. The beneficial effects of LBS were explored in vitro and in vivo using human colon carcinoma cell lines HT-29 and rat model of neonatal E. coli K1 infection, respectively. Our results showed that stimulation with E. coli K1 was able to cause intestinal barrier dysfunction, which were reflected by E. coli K1-induced intestinal damage and apoptosis of intestinal epithelial cells, reduction of mucin, immunoglobulin A (IgA and tight junction proteins expression, as well as increase in intestinal permeability, all these changes facilitate E. coli K1 intestinal translocation. However, these changes were alleviated when HT-29 cells were treated with LBS before E. coli K1 infection. Furthermore, we found that LBS-treated neonatal rats (without E. coli K1 infection have showed higher production of mucin, ZO-1, IgA, Ki67 in intestinal mucosa as well as lower intestinal permeability than that of non-treated rats, indicating that LBS could accelerate the development of neonatal intestinal defense. Taken together, our results suggest that enhancement of the neonatal intestinal defense to fight against E. coli K1 translocation could be the potential mechanism to elucidate how LBS confers a protective effect against neonatal E

  6. All at the same time now: Brazilian cultural influences on illustrations created by Roger Mello

    Directory of Open Access Journals (Sweden)

    Maria Isabel Frantz Ramos

    2013-12-01

    Full Text Available This paper analyses a series of illustrations created by Roger Mello, a Brazilian illustrator of children’s and youth books, aiming to denote the nexus between them and popular, indigenous and Afro-Brazilian cultures. The analysis was developed by combining information from two sources. The first source were categories formulated by studies in the field of contemporaneous picture book. The second were visual references present in publications and collections specialized in tangible and intangible Brazilian heritage, such as visual arts, festivities, practices, and folk customs.

  7. Integrable deformations of the $G_{k_1} \\times G_{k_2}/G_{k_1+k_2}$ coset CFTs arXiv

    CERN Document Server

    Sfetsos, Konstantinos

    We study the effective action for the integrable $\\lambda$-deformation of the $G_{k_1} \\times G_{k_2}/G_{k_1+k_2}$ coset CFTs. For unequal levels theses models do not fall into the general discussion of $\\lambda$-deformations of CFTs corresponding to symmetric spaces and have many attractive features. We show that the perturbation is driven by parafermion bilinears and we revisit the derivation of their algebra. We uncover a non-trivial symmetry of these models parametric space, which has not encountered before in the literature. Using field theoretical methods and the effective action we compute the exact in the deformation parameter $\\beta$-function and explicitly demonstrate the existence of a fixed point in the IR corresponding to the $G_{k_1-k_2} \\times G_{k_2}/G_{k_1}$ coset CFTs. The same result is verified using gravitational methods for $G=SU(2)$. We examine various limiting cases previously considered in the literature and found agreement.

  8. The Marian Illustrations of the Legend of Montserrat

    Directory of Open Access Journals (Sweden)

    Alarcón, Concepción

    2008-12-01

    Full Text Available The books telling the story of Montserrat used to contain illustrative engravings. Montserrat presents us with a special case, because this monastery holds an uninterrupted record of illustrated texts or of texts with engraved images from the miniatures of the Llibre Vermell and the first fruits of the printing press to the 19th century. Admittedly, in the 16th, 17th and 18th centuries the books exhibit the engravings on the cover or within the first sheets; it is only in the 19th century that illustrations appear inserted in the text so as to make the story more agreeable. The images intensify the value of texts, since illustrations can help us understand the written word and may suggest other readings of the corresponding passages, clearer and more precise. Illustrations in the books on the history of a monastery are but a part of a larger set of ideas, projects and self-service which the Church aims at the reader. Furthermore, the iconographic models of the Virgin Mary and the Mountain are of great interest for the history of engraving and of the Catalan and Spanish devotions.

    Los libros en que se contaba la historia de Montserrat contenían estampas que los ilustraban. Montserrat es un caso inusual, porque posee un registro ininterrumpido de textos ilustrados o acompañados con imágenes grabadas, desde el Llibre Vermell y los primeros momentos de la imprenta hasta el siglo XIX. Bien es cierto que en los libros de los siglos XVI, XVII y XVIII sólo se colocan los grabados en la portada o en las primeras hojas; Hasta el siglo XIX no encontramos un tipo de ilustración insertada en el interior del texto amenizando la historia. Las imágenes intensifican el valor de los textos, porque nos ayudan a comprenderlos y a la vez sugieren nuevas lecturas, más precisas y claras. Las ilustraciones de los libros de historia de un santuario forman parte de todo un enjambre de

  9. Ramsey numbers r(K1, 4, G) for all three-partite graphs G of order six%K1,4和六阶三部图的Ramsey数r(K1,4,G)

    Institute of Scientific and Technical Information of China (English)

    顾华; 宋洪雪; 刘向阳

    2004-01-01

    本文主要应用了组合分析的方法. 在对所有边任意地进行了红、蓝2种颜色着色的完全图KN中, 考察了完全图KN的顶点集中某点的邻域在红图或蓝图中所生成的子图的性质. 在Jayawardene和Rousseau (Ars Combinatoria, 2000, 163-173)的主要结果的启发下, 研究并确定了另一种常见的五阶图K1, 4对于所有无孤立点的六阶三部图G的Ramsey数r(K1, 4, G).%In this paper, we use a combinatorial analysis method. In the complete graph KN with edges colored arbitrarily by red or blue, we consider the proposition of the subgraph of the red graph or blue graph induced by the neighborhood of some vertex in V(KN). Inspired by the main results of Jayawardene and Rousseau (Ars Combinatoria, 2000, 163-173), we determine the Ramsey numbers of r(K1, 4, G), where G is the three-partite graph of order six without isolate vertex.

  10. Old Books and E-Books

    OpenAIRE

    Darnton, Robert

    2007-01-01

    The crisis in academic publishing has reached a point where young scholars in many fields of the humanities may no longer be able to communicate their research in the time-honoured manner - that is, in the form of a traditional codex printed by a university press. Sooner or later, most monographs will probably have to be published on the Internet. What form will they take? A tentative answer to that question is provided by a sketch for an electronic book about publishing and the book trade in...

  11. Give a Book, Take a Book | Poster

    Science.gov (United States)

    Collection has begun for the 15th Annual Book & Media Swap sponsored by the Scientific Library. NCI at Frederick staff can use this opportunity to clear out personal book and DVD shelves of unwanted materials, donate them to the swap, and then receive “new” materials in return. The library staff will collect materials through Tuesday, Oct. 27. Kick-off day for the event is Wednesday, Oct. 28, 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549.

  12. S6K1 controls autophagosome maturation in autophagy induced by sulforaphane or serum deprivation.

    Science.gov (United States)

    Hać, Aleksandra; Domachowska, Anna; Narajczyk, Magdalena; Cyske, Karolina; Pawlik, Anna; Herman-Antosiewicz, Anna

    2015-10-01

    It is well established that mTORC1 suppresses autophagy by phosphorylation and inactivation of proteins involved in autophagosome formation. However, the role of its substrate, p70S6 kinase1 (S6K1), in autophagy is quite controversial. In some models S6K1 activity correlates with autophagy suppression, however, some other studies show that S6K1 promotes rather than inhibits this process. Here, we investigated the role of S6K1 in prostate cancer cells (PC-3) and non-cancerous, mouse embryonic fibroblasts (MEF), either treated with autophagy inducer sulforaphane, an isothiocyanate derived from cruciferous plants, or deprived of serum. Our results indicate that constitutively active S6K1 decreases the level of LC3 processing and foci formation by autophagosomal vacuoles in cells treated with sulforaphane. On the other hand, presence of S6K1 is necessary for autophagosome maturation under conditions of autophagy induced by either sulforaphane or serum deprivation. Diminished level of S6K1 or lack of S6 kinases results in both, accumulation of autophagosomes and drop in the autophagolysosome number, and thus disturbs autophagy flux under stress conditions. Moreover, lack of S6 kinases reduces cell survival under stress conditions. Copyright © 2015 Elsevier GmbH. All rights reserved.

  13. Conservation of plasmids among Escherichia coli K1 isolates of diverse origins.

    Science.gov (United States)

    Mercer, A A; Morelli, G; Heuzenroeder, M; Kamke, M; Achtman, M

    1984-12-01

    Escherichia coli K1 isolates of various O types were previously assigned to different clonal groups. Members of the two clones defined by membrane pattern 9 (MP9) and serotypes O18:K1 and O1:K1 had been found to be very similar to each other. The plasmid contents of these bacteria confirmed this conclusion. Both groups carried a self-transmissible plasmid of the FI incompatibility group that coded for colicin production and a major outer membrane protein called the plasmid-coded protein (PCP). The size of this plasmid varied from 76 to 96 megadaltons, but restriction endonuclease digestion and DNA heteroduplex analysis revealed that these plasmids were highly related. O18:K1 bacteria of MP6 had previously been determined to represent a subclone, related to but different from O18:K1 MP9 bacteria. These MP6 bacteria carried a different, smaller IncFI plasmid which did not code for colicin production or the PCP protein. This smaller plasmid was primarily related to the larger plasmid within the regions of DNA encoding incompatibility, replication, and conjugation. O1:K1 bacteria of MP5 contained other unrelated plasmids in agreement with the previous conclusion that they are unrelated to O1:K1 bacteria of MP9. The bacteria examined had been isolated from two continents over a time span of 38 years, and the results attest to conservative inheritance of plasmids within bacteria of common descent.

  14. Conservation of plasmids among Escherichia coli K1 isolates of diverse origins.

    Science.gov (United States)

    Mercer, A A; Morelli, G; Heuzenroeder, M; Kamke, M; Achtman, M

    1984-01-01

    Escherichia coli K1 isolates of various O types were previously assigned to different clonal groups. Members of the two clones defined by membrane pattern 9 (MP9) and serotypes O18:K1 and O1:K1 had been found to be very similar to each other. The plasmid contents of these bacteria confirmed this conclusion. Both groups carried a self-transmissible plasmid of the FI incompatibility group that coded for colicin production and a major outer membrane protein called the plasmid-coded protein (PCP). The size of this plasmid varied from 76 to 96 megadaltons, but restriction endonuclease digestion and DNA heteroduplex analysis revealed that these plasmids were highly related. O18:K1 bacteria of MP6 had previously been determined to represent a subclone, related to but different from O18:K1 MP9 bacteria. These MP6 bacteria carried a different, smaller IncFI plasmid which did not code for colicin production or the PCP protein. This smaller plasmid was primarily related to the larger plasmid within the regions of DNA encoding incompatibility, replication, and conjugation. O1:K1 bacteria of MP5 contained other unrelated plasmids in agreement with the previous conclusion that they are unrelated to O1:K1 bacteria of MP9. The bacteria examined had been isolated from two continents over a time span of 38 years, and the results attest to conservative inheritance of plasmids within bacteria of common descent. Images PMID:6094355

  15. 2011 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2012-10-01

    This Renewable Energy Data Book for 2011 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  16. 2012 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2013-10-01

    This Renewable Energy Data Book for 2012 provides facts and figures in a graphical format on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  17. 2013 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Esterly, S.

    2014-12-01

    This Renewable Energy Data Book for 2013 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  18. 2010 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2011-10-01

    This Renewable Energy Data Book for 2010 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  19. ATLAS Colouring Book

    CERN Multimedia

    Anthony, Katarina

    2016-01-01

    The ATLAS Experiment Colouring Book is a free-to-download educational book, ideal for kids aged 5-9. It aims to introduce children to the field of High-Energy Physics, as well as the work being carried out by the ATLAS Collaboration.

  20. More than Comic Books

    Science.gov (United States)

    Boerman-Cornell, Bill

    2013-01-01

    Graphic novels (book-length fiction or nonfiction narratives told using the conventions of a comic book) bring together text and image in a way that seems to capture students' imaginations. Right now, there is little more than anecdotal research about how graphic novels can be used within specific middle school and high school disciplines. As…

  1. More than Comic Books

    Science.gov (United States)

    Boerman-Cornell, Bill

    2013-01-01

    Graphic novels (book-length fiction or nonfiction narratives told using the conventions of a comic book) bring together text and image in a way that seems to capture students' imaginations. Right now, there is little more than anecdotal research about how graphic novels can be used within specific middle school and high school disciplines. As…

  2. Strawberry Square. Song Book.

    Science.gov (United States)

    Larson, Tom

    Designed to accompany a series of 33 television programs in music education for kindergarten and first grade children, this song book (containing sheet music) correlates with activities in the teacher's guide. Titles of songs included in the book are: Let a Song Tell a Story (short and long versions); If I Had a Hammer; A Happy Street; Let the…

  3. Data communications pocket book

    CERN Document Server

    Tooley, Michael

    2014-01-01

    Data Communications Pocket Book, Second Edition presents information relevant to data communication. The book provides tabulated reference materials with a brief description and diagrams. The coverage of the text includes abbreviations, terminal control codes, and conversion tables. The text will be of great use to individuals involved in the interconnection of computer systems.

  4. English Book Club

    CERN Multimedia

    English Book Club

    The minutes of the AGM held on Tuesday November 17th can now be found on the club web-site: http://club-englishbookclub.web.cern.ch. A new version of the club’s book data-base is also available on the web: http://club-englishbookclub.web.cern.ch/club-englishbookclub/Export/index.html The last book selection for 2009 is done and the order for the new books has been placed, with luck they will be on the shelves before the end of year break. The English Book Club has a growing collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  5. The Book Club Exploded

    Science.gov (United States)

    Hoffert, Barbara

    2006-01-01

    One leader, 12 readers, and a few well-thumbed copies of Jane Austen's "Pride and Prejudice." That is all a book club once required, but this is no longer the case. This article describes how the runaway popularity of book clubs has brought with it a whole new set of possibilities. Thematic discussion? A fiction/nonfiction mix? Videoconferencing?…

  6. Test Scoring [book review].

    Science.gov (United States)

    Meijer, Rob R.

    2003-01-01

    This book discusses how to obtain test scores and, in particular, how to obtain test scores from tests that consist of a combination of multiple choice and open-ended questions. The strength of the book is that scoring solutions are presented for a diversity of real world scoring problems. (SLD)

  7. Why Write Book Reviews?

    Science.gov (United States)

    Obeng-Odoom, Franklin

    2014-01-01

    The pressure to publish or perish or, more recently, to be visible or vanish, marginalises a culture of critical reading and reflection that has historically been the province of book reviews. Today, book reviews are roundly rejected by academic bureaucrats as unimportant, easy to write and hence, easy to get published, mere summaries, uncritical…

  8. Death, Children, and Books.

    Science.gov (United States)

    Carr, Robin L.

    The books listed in this annotated bibliography are intended to help children understand the reality of death and deal with the mystery and emotions that accompany it. Each entry indicates the genre and reading level of the book and provides a brief description of the attitude toward death that it conveys. The selections include fables, fantasy,…

  9. The Book of Joshua

    NARCIS (Netherlands)

    Noort, E

    2012-01-01

    "The Book of Joshua contains the papers of the Colloquium Biblicum Lovaniense 2010 on the Book of Joshua and the Land of Israel. Not for the sake of plurality as such, but as a signal of the state of the art in Joshua research in the post-Noth era this volume functions as a platform for different

  10. Books in the Family.

    Science.gov (United States)

    Swinger, Alice K.

    1989-01-01

    Opportunities for parents to encourage reading in the family are noted and ways to enhance the reading experience are discussed, including writing letters to book characters, singing combined with reading aloud, supplementing school subjects with enjoyable reading, sharing books at family gatherings, and using family experiences for book…

  11. Books in Our Future.

    Science.gov (United States)

    Boorstin, Daniel J.

    This study explores the changing role of the book in the future. The report draws on interviews with authors, publishers, booksellers, computer experts, librarians, scientists, educators, and scholars and on the experience of the Library of Congress staff. The first part, "The Culture of the Book: Today and Tomorrow," includes sections…

  12. The Book Club Exploded

    Science.gov (United States)

    Hoffert, Barbara

    2006-01-01

    One leader, 12 readers, and a few well-thumbed copies of Jane Austen's "Pride and Prejudice." That is all a book club once required, but this is no longer the case. This article describes how the runaway popularity of book clubs has brought with it a whole new set of possibilities. Thematic discussion? A fiction/nonfiction mix? Videoconferencing?…

  13. China Connections Reference Book.

    Science.gov (United States)

    Kalat, Marie B.; Hoermann, Elizabeth F.

    This reference book focuses on six aspects of the geography of the People's Republic of China. They are: territory, governing units, population and land use, waterways, land forms, and climates. Designed as a primary reference, the book explains how the Chinese people and their lifestyles are affected by China's geography. Special components…

  14. Energy-Based Tree Illustration System: ETIS

    National Research Council Canada - National Science Library

    NAKAJIMA, Katsuto; MAMA, Azusa; MORIMOTO, Yuki

    2016-01-01

    We propose a system named ETIS (Energy-based Tree Illustration System) for automatically generating tree illustrations characteristic of two-dimensional ones with features such as exaggerated branch curves, leaves, and flowers...

  15. One book too many

    Directory of Open Access Journals (Sweden)

    Andrej Blatnik

    2008-01-01

    Full Text Available The article is exploring the changes in the communication value of Slovenian book after the year 1991. The shifted (selfunderstanding of the publishing business going from activity of ‘special social importance’to explicitly profit-making activity has not only changed the ways of book production, but also the products themselves. This has influenced also those factors in the communication circuit of the book which still belong to the public sector. Following the example of two bestsellers published in 2008,the author points out the differences in public and market functioning of structurally same books and emphasizes the importance of a conscious choice which positions the adequate product into the communication circuit of the book.

  16. Data of evolutionary structure change: 1QX5K-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1QX5K-1CLMA 1QX5 1CLM K A LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN...seq1> LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGL...> A 1CLMA GDGHI-NYEEF

  17. Talking about Books: Karen Hesse.

    Science.gov (United States)

    Beck, Cathy; Gwyn, Linda; Koblitz, Dick; O'Connor, Anne; Pierce, Kathryn Mitchell; Wolf, Susan

    1999-01-01

    Presents an interview with Karen Hesse, author of 12 books of fiction for young, middle, and older readers, and winner of the 1998 Newbery Award. Offers an overview of Hesse's books, organized into picture books, transition chapter books, and novels. Presents a discussion of the themes found in her books, highlighting children's discussion…

  18. Prediction of 3-hydroxypyridin-4-one (HPO) log K1 values for Fe(III).

    Science.gov (United States)

    Chen, Yu-Lin; Barlow, Dave J; Kong, Xiao-Le; Ma, Yong-Min; Hider, Robert C

    2012-09-21

    As a means to aid in the design of 3-hydroxypyridin-4-ones (HPOs) intended for use as therapeutic Fe(3+) chelating agents, a novel methodology has been developed using quantum mechanical (QM) calculations for predicting the iron binding affinities of the compounds (more specifically, their log K(1) values). The reported/measured HPO log K(1) values were verified through their correlation with the corresponding sum of the compounds' ligating group pK(a) values. Using a training set of eleven HPOs with known log K(1) values, reliable predictions are shown to be obtained with QM calculations using the B3LYP/6-31+G(d)/CPCM model chemistry (with Bondi radii, and water as solvent). With this methodology, the observed log K(1) values for the training set compounds are closely matched by the predicted values, with the correlation between the observed and predicted values giving r(2) = 0.9. Predictions subsequently made by this method for a test set of 42 HPOs of known log K(1) values gave predicted values accurate to within ±0.32 log units. In order to further investigate the predictive power of the method, four novel HPOs were synthesised and their log K(1) values were determined experimentally. Comparison of these predicted log K(1) values against the measured values gave absolute deviations of 0.22 (13.87 vs. 14.09), 0.02 (14.31 vs. 14.29), 0.12 (14.62 vs. 14.50), and 0.13 (15.04 vs. 15.17). The prediction methodology reported here is the first to be provided for predicting the absolute log K(1) values of iron-chelating agents in the absence of pK(a) values.

  19. Lectin complement protein Collectin 11 (CL-K1 and susceptibility to urinary schistosomiasis.

    Directory of Open Access Journals (Sweden)

    Justin S Antony

    2015-03-01

    Full Text Available Urinary Schistosomiasis is a neglected tropical disease endemic in many sub Saharan -African countries. Collectin Kidney 1 (CL-K1, encoded by COLEC11 on chromosome 2p25.3, a member of the vertebrate C-type lectin super family, has recently been identified as pattern-recognition molecule (PRR of the lectin complement pathway. CL-K1 is preferentially expressed in the kidneys, but also in other organs and it is considered to play a role in host defense to some infectious agents. Schistosome teguments are fucosylated and CL-K1 has, through its collagen-like domain, a high binding affinity to fucose.We utilized a Nigerian study group consisting of 167 Schistosoma haematobium infected individuals and 186 matched healthy subjects, and investigated the contribution of CL-K1 deficiency and of COLEC11 polymorphisms to infection phenotype. Higher CL-K1 serum levels were associated with decreased risk of schistosome infection (P corr = 0.0004. CL-K1 serum levels were differentially distributed between the COLEC11 genotypes and haplotypes observed. The non-synonymous variant p.R216H was associated with the occurrence of schistosomiasis (OR = 0.44, 95%CI = 0.22-0.72, P corr = 0.0004. The reconstructed COLEC11*TCCA haplotypes were associated with higher CL-K1 serum levels (P = 0.002 and with decreased schistosomiasis (OR = 0.38, 95%CI = 0.23-0.63, P corr = 0.0001.In agreement with findings from our earlier published study, our findings support the observation that CL-K1 and their functional variants may be host factors associated with protection in schistosomiasis and may be a useful marker for further investigations.

  20. Sphingosine kinase-1 (SphK-1 regulates Mycobacterium smegmatis infection in macrophages.

    Directory of Open Access Journals (Sweden)

    Hridayesh Prakash

    Full Text Available Sphingosine kinase-1 is known to mediate Mycobacterium smegmatis induced inflammatory responses in macrophages, but its role in controlling infection has not been reported to date. We aimed to unravel the significance of SphK-1 in controlling M. smegmatis infection in RAW 264.7 macrophages. Our results demonstrated for the first time that selective inhibition of SphK-1 by either D, L threo dihydrosphingosine (DHS; a competitive inhibitor of Sphk-1 or Sphk-1 siRNA rendered RAW macrophages sensitive to M. smegmatis infection. This was due to the reduction in the expression of iNOs, p38, pp-38, late phagosomal marker, LAMP-2 and stabilization of the RelA (pp-65 subunit of NF-kappaB. This led to a reduction in the generation of NO and secretion of TNF-alpha in infected macrophages. Congruently, overexpression of SphK-1 conferred resistance in macrophages to infection which was due to enhancement in the generation of NO and expression of iNOs, pp38 and LAMP-2. In addition, our results also unraveled a novel regulation of p38MAPK by SphK-1 during M. smegmatis infection and generation of NO in macrophages. Enhanced NO generation and expression of iNOs in SphK-1++ infected macrophages demonstrated their M-1(bright phenotype of these macrophages. These findings thus suggested a novel antimycobacterial role of SphK-1 in macrophages.

  1. Interaction of Escherichia coli K1 and K5 with Acanthamoeba castellanii trophozoites and cysts.

    Science.gov (United States)

    Matin, Abdul; Jung, Suk-Yul

    2011-12-01

    The existence of symbiotic relationships between Acanthamoeba and a variety of bacteria is well-documented. However, the ability of Acanthamoeba interacting with host bacterial pathogens has gained particular attention. Here, to understand the interactions of Escherichia coli K1 and E. coli K5 strains with Acanthamoeba castellanii trophozoites and cysts, association assay, invasion assay, survival assay, and the measurement of bacterial numbers from cysts were performed, and nonpathogenic E. coli K12 was also applied. The association ratio of E. coli K1 with A. castellanii was 4.3 cfu per amoeba for 1 hr but E. coli K5 with A. castellanii was 1 cfu per amoeba for 1 hr. By invasion and survival assays, E. coli K5 was recovered less than E. coli K1 but still alive inside A. castellanii. E. coli K1 and K5 survived and multiplied intracellularly in A. castellanii. The survival assay was performed under a favourable condition for 22 hr and 43 hr with the encystment of A. castellanii. Under the favourable condition for the transformation of trophozoites into cysts, E. coli K5 multiplied significantly. Moreover, the pathogenic potential of E. coli K1 from A. castellanii cysts exhibited no changes as compared with E. coli K1 from A. castellanii trophozoites. E. coli K5 was multiplied in A. castellanii trophozoites and survived in A. castellanii cysts. Therefore, this study suggests that E. coli K5 can use A. castellanii as a reservoir host or a vector for the bacterial transmission.

  2. Characterization of $m$-Sequences of Lengths $2^{2k}-1$ and $2^k-1$ with Three-Valued Crosscorrelation

    OpenAIRE

    Helleseth, Tor; Kholosha, Alexander; Ness, Geir Jarle

    2007-01-01

    Considered is the distribution of the crosscorrelation between $m$-sequences of length $2^m-1$, where $m=2k$, and $m$-sequences of shorter length $2^k-1$. New pairs of $m$-sequences with three-valued crosscorrelation are found and the complete correlation distribution is determined. Finally, we conjecture that there are no more cases with a three-valued crosscorrelation apart from the ones proven here.

  3. KEY COMPARISON: Force key comparison CCM.F-K1.a and CCM.F-K1.b: 5 kN and 10 kN

    Science.gov (United States)

    Pusa, Aimo

    2009-01-01

    This report describes the key comparisons named CCM.F-K1.a and CCM.F-K1.b, for force with loads of 5 kN and 10 kN. The Draft A Report, reporting the measurement results of the key comparisons, has been accepted at the force expert group meeting in Pretoria on 23 March 2004. This became Part 1 of the preliminary Draft B Report. Then, there have been several discussions to find the best way for the determination of the reference value for force values 5 kN and 10 kN in the key comparisons CCM.F-K1.a and CCM.F-K1.b. Following the meeting held in Queretaro, Mexico, by CENAM, from 3 to 5 December 2007, the reference values have been calculated for each single transducer (see chapter 2), and as one reference value for 5 kN and a second reference value for 10 kN (see chapter 3). To get a better consistency a linear model for the drift of transducers has been applied. The results have been evaluated according to the paper from M G Cox, 'The evaluation of key comparison data' (2002 Metrologia 39 589-595). Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCM, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).

  4. Book Presentation | 27 February

    CERN Multimedia

    The CERN Library

    2013-01-01

    "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo" by Luciano Maiani and Romeo Bassoli, published by Mondadori. On Wednesday 27 February Luciano Maiani will present the book "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo". More information here. The presentation will take place in the Council Chamber at 16.00 and will be followed by a debate and book signing. The book will be on sale. You are cordially invited.

  5. Closing the Book

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ When Bertelsmann Direct Group,the music and book direct-marketing arm of German media conglomerate Bertelsmann AG,launched its business in China in 1995,it seemed like a winning idea.The company's book clubs,a catalog mail-order operation offering cut-price books in return for a monthly membership fee,had proven a hugely lucrative business in Europe;and China,with its huge,highly literate population,seemed an ideal market for expansion.

  6. Mi Segundo Libro de Maquinas Simples: Las Palancas. Escuela Intermedia Grados 7, 8 y 9 (My Second Book of Simple Machines: Levers. Intermediate School Grades 7, 8, and 9).

    Science.gov (United States)

    Alvarado, Patricio R.; Montalvo, Luis

    This is the second book in a five-book physical science series on simple machines. The books are designed for Spanish-speaking junior high school students. By suggesting experiments and posing questions concerning drawings in the book which illustrate the scientific principles, this book explains the workings of three types of levers. Resistance…

  7. Evoking Emotions and Unpacking Layered Histories through Young Children's Illustrations of Racial Bus Segregation

    Science.gov (United States)

    Kuby, Candace R.

    2013-01-01

    Drawing on theories of multi-modality and critical visual literacy, this article focuses on images that five-and six year-olds painted in a class-made book, Voice on the Bus, about racial segregation. The article discusses how children used illustrations to convey their understandings of Rosa Parks' bus arrest in Alabama. A post-structural view…

  8. [Jean Chièze (1898-1975), medical engraver and illustrator].

    Science.gov (United States)

    Bouday, Etienne

    2010-01-01

    As an imaginative and sensitive woodcutter Jean Chièze illustrated more than 130 books and realised many draws, paintings and lithographs and about 2000 engravings. He took part in some editions about Rabelais, Hippocrates, Galen and Ambroise Paré.

  9. The Harry "A" Chesler Collection of Illustration and Comic Art at Fairleigh Dickinson University: A Booklist.

    Science.gov (United States)

    Scott, Randall W., Ed.

    The more than 600 books and studies on illustration and comic art cited in this booklist cover a wide variety of topics, including comic strips, political satire, pop culture, and animated cartoons. Materials are international in scope, and each item is listed alphabetically by its main entry in the Chesler Collection shelflist. A contact is…

  10. The Harry "A" Chesler Collection of Illustration and Comic Art at Fairleigh Dickinson University: A Booklist.

    Science.gov (United States)

    Scott, Randall W., Ed.

    The more than 600 books and studies on illustration and comic art cited in this booklist cover a wide variety of topics, including comic strips, political satire, pop culture, and animated cartoons. Materials are international in scope, and each item is listed alphabetically by its main entry in the Chesler Collection shelflist. A contact is…

  11. Adapting to e-books

    CERN Document Server

    Miller, William

    2013-01-01

    Electronic books are now having a major impact on library collections. This book provides models for acquisitions policies and reports on several surveys of faculty and librarian attitudes toward e-books. It discusses issues in acquiring cataloguing and collection development regarding this important new library resource.Its subject matter deals with the different types of e-books, statistical data available for e-book usage, the development of e-book collections, learning environments, integrating e-books into local catalogues, acquisitions and usage monitoring of e-books.Thi

  12. Silent screen: book review.

    OpenAIRE

    Ó Drisceoil, Donal

    2007-01-01

    Book Review. Kevin Rockett, Irish film censorship: a cultural journey from silent cinema to internet pornography (Dublin, 2004) and Mary Corcoran and Mark O'Brien (eds), Political censorship and the democratic state: the Irish broadcasting ban (Dublin, 2005)

  13. Climate Record Books

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Climate Record Books contain daily, monthly, seasonal, and annual averages, extremes, or occurrences. Most data are sequential by period of record 1871-1910,...

  14. Best Books of 1971

    Science.gov (United States)

    Gerhardt, Lillian N.; And Others

    1971-01-01

    The forty-two titles selected by the editors of School Library Journal" are the best among over 2,100 new children's books reviewed since last January. Also included are 25 top notch Young Adult titles. (67 references) (MM)

  15. The book house

    DEFF Research Database (Denmark)

    Jensen, Niels Henrik; Agger, Steen

    1989-01-01

    The BOOK HOUSE (and its predecessor, the BOOK AUTOMAT) are computer systems aimed at supporting library users in finding fiction. They are examples of systems using a cognitive work analysis as the basis for design and evaluation - and build on studies of the information retrieval task using actual...... user-librarian negotiations. These studies led to the identification of a set of strategies for searching and retrieving literature as well as a mutri-kimensional framework for classifying fiction. Both of these have been necessary prerequisites for the design of the BOOK HOUSE, a flexible on-line data...... base retrieval system for novice users - both adults and children. The use of icons within a spatial metaphor to facilitate direct manipulation of the displayed objects on the screen forms the basis for the interface in guiding the users' navigation in the BOOK HOUSE. This report, one of three...

  16. Recensione / Recension / Book review

    Directory of Open Access Journals (Sweden)

    Bravo Fabio

    2010-03-01

    Full Text Available Book review of:Sette R., Cases on Technologies for Teaching Criminology and Victimology: Methodologies and practices, IGI Global – Information Science Reference, Hershey PA, 2010

  17. Smart Book Charts

    Science.gov (United States)

    Chinnapongse, Ronald L.

    2015-01-01

    Smart book charts for TPSM: Heatshield for Extreme Entry Environment Technology (HEEET), Conformal Ablative TPS (CA-TPS), 3D Woven Multifunctional Ablative TPS (3D MAT), and Adaptable, Deployable, Entry and Placement Technology (ADEPT).

  18. New Fashioned Book Burning.

    Science.gov (United States)

    Gardner, Robert

    1997-01-01

    Reports on results of a teacher's experiment in book burning as a lesson accompanying the teaching of Ray Bradbury's "Fahrenheit 451." Discusses student reactions and the purpose of or justification for the experimental lesson. (TB)

  19. Batik to Book

    Science.gov (United States)

    Tisinger, Betty

    1972-01-01

    Article describes how fifth- and sixth-graders first wrote Japanese Haiku poetry, then made books with batik covers. Materials needed and technique to follow are outlined, with photographs showing some details. (PD)

  20. New Economics Books

    OpenAIRE

    Economics Library, Journal of

    2016-01-01

    A wide ranged Editor Selection of economic books published within the last 3 months by the publishers (for now; Cambridge University Press, Edward Elgar, Elsevier, MIT Press, Palgrave MacMillan, Springer, Wiley, and World Scientific) which are reached out “the consensus of no copyright infringement exists” could be found under this title. Afterwards, JEL will continue to publish the economic books published within the last 3 months as listing them in its quarter edition. This is expected to e...

  1. Books 'n' stuff

    DEFF Research Database (Denmark)

    Christoffersen, Ellen

    2007-01-01

    The book "Kommunikations-Controlling" by Manfred Piwinger/Viktor Porák (eds.) is an interim report in which several authors analyse the state of the art in the discussion of communications controlling.......The book "Kommunikations-Controlling" by Manfred Piwinger/Viktor Porák (eds.) is an interim report in which several authors analyse the state of the art in the discussion of communications controlling....

  2. Electronics engineer's reference book

    CERN Document Server

    Turner, L W

    1976-01-01

    Electronics Engineer's Reference Book, 4th Edition is a reference book for electronic engineers that reviews the knowledge and techniques in electronics engineering and covers topics ranging from basics to materials and components, devices, circuits, measurements, and applications. This edition is comprised of 27 chapters; the first of which presents general information on electronics engineering, including terminology, mathematical equations, mathematical signs and symbols, and Greek alphabet and symbols. Attention then turns to the history of electronics; electromagnetic and nuclear radiatio

  3. S6K1 Is Required for Increasing Skeletal Muscle Force during Hypertrophy

    Directory of Open Access Journals (Sweden)

    Manuela Marabita

    2016-10-01

    Full Text Available Loss of skeletal muscle mass and force aggravates age-related sarcopenia and numerous pathologies, such as cancer and diabetes. The AKT-mTORC1 pathway plays a major role in stimulating adult muscle growth; however, the functional role of its downstream mediators in vivo is unknown. Here, we show that simultaneous inhibition of mTOR signaling to both S6K1 and 4E-BP1 is sufficient to reduce AKT-induced muscle growth and render it insensitive to the mTORC1-inhibitor rapamycin. Surprisingly, lack of mTOR signaling to 4E-BP1 only, or deletion of S6K1 alone, is not sufficient to reduce muscle hypertrophy or alter its sensitivity to rapamycin. However, we report that, while not required for muscle growth, S6K1 is essential for maintaining muscle structure and force production. Hypertrophy in the absence of S6K1 is characterized by compromised ribosome biogenesis and the formation of p62-positive protein aggregates. These findings identify S6K1 as a crucial player for maintaining muscle function during hypertrophy.

  4. Book Review: Stop, Write!

    Directory of Open Access Journals (Sweden)

    Hans Thulesius

    2013-06-01

    Full Text Available This book on writing grounded theory is intended for the empirical GT researcher who wants to pursue his/her research until publication. It is the first book devoted entirely to such a crucial issue as writing grounded theory. Thus, Stop, Write: Writing Grounded Theory, is a practical book that fills a gap in GT methodology. In the first chapter of the book, Dr. Glaser says, “Stop unending conceptualization, unending data coverage, and unending listening to others who would egg you on with additional data, ideas and/or requirements or simply wait too long”. The book teaches the reader how to actually write a grounded theory by “simply” writing up the sorted memos. This requires efficient sorting that is dealt with in chapter two on Sorting Memos, which includes precious repetition from Theoretical Sensitivity (1978. How writing can be done effectively is outlined in chapter three The Working Paper. Then follows chapter four on how to rework the first draft with the different tasks of editing for language and professionalism. Thereafter Dr. Glaser discusses Writing Problems in chapter five where he gives useful guidance on how to overcome writing blocks and problems with supervisors and dissertation committees. The book also deals with publishing and with collaboration as experienced between Barney Glaser and the cofounder of grounded theory, Anselm Strauss.

  5. UNIQUE ILLUSTRATIONS IN TIBETAN BUDDHIST SUTRAS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The illustrations for Tibetan sutras are coloured in two ways:in black and white or colours-the monotone illustrations accompanying Tibetan characters and usually engraved on woodblocks.The illustrations are often showed on the cover pages or two sides of the head pages of sutras; they are frequently displayed at two frames and in the middle of end pages.In this paper,I am going to introduce the

  6. Seeing into Books: Lessons from Rare Book School

    Science.gov (United States)

    Hendrickson, Lois G.

    2012-01-01

    Recently, the author spent a week at Rare Book School (RBS) immersed in a course entitled "Teaching the History of the Book;" an investigation into different ways of thinking about, designing, and conducting a course on the history of the book. The goal was to learn how to convert teaching and outreach experiences in rare book collections from a…

  7. Picture-books: first structured reading materials for children

    Directory of Open Access Journals (Sweden)

    Ivana Martinović

    2012-11-01

    Full Text Available Early literacy has recently become a current topic, and there’s a widespread belief that literacy startsdeveloping almost as soon as the child is born, if the child is surrounded with adequate materials and persons who will motivate the development of literacy. The first structured reading materials that a child interacts with are picture-books. It is usually the first contact a child has with literature and a written word in general, and it happens during childhood, the child's most sensitive period, which is why it is important to pay special attention to the quality of picture-books. Croatian picture-books published till the early 80ies of the past century have been investigated to a some extent. However, the picture-books found on the Croatian market and in the libraries in the past 30 years have been the subject of research only sporadically. There's little data on the quality and features of this multifunctional material that is of such great importance for children. The aim of the paper is to give an overview of the relevant data found in literature on the historical development of picture-book publishing, their features, functions they help develop, their age-appropriateness, and quality. The paper presents research results stemming from the analysis of the Croatian Children's Book Centre documentation on contemporary picture-book publishing and data on the language of picture-books that are the result of a picture-book corpus study made as part of the PhD research by the author. The data on contemporary authors and illustrators was obtained by analysing the documentation of the Croatian Library Association, Commission for library services for children and youth. The language of the picture-book corpus was analysed using a computer programme, i.e. the analysis was conducted of the lexical diversity of picture-books for three-year olds. The picture-books have not been investigated from the linguistic perspective before, which makes this

  8. Trade in French books in Zagreb: 1796-1823

    OpenAIRE

    Jasna Tingle

    2012-01-01

    The intention of this paper is to contribute to the picture of the book trade in Zagreb in the late 18th and early19th century. The objectives of the research were to find out which booksellers’ catalogues were available in Croatian capital Zagreb in that period and to illustrate the conclusions that can be drawn from the information gathered by focusing on a narrow topic: trade in French books in a particular period. A focus on French books was inspired by the importance of French culture in...

  9. Deforming the Lie Superalgebra $\\mathcal{K}(1)$-Modules Of Symbols

    CERN Document Server

    Faouzi, Ammar

    2008-01-01

    We study non-trivial deformations of the natural action of the Lie superalgebra $mathcalK(1)$ of contact vector fields on the (1,1)-dimensional superspace $mathbbR^{1|1}$ of th espace of symbols. We calculate obstructions for integrability of infinitesimal multi-parameter deformation and determine the complete commutative algebra corresponding to the miniversal deformation in the sense of A. Fialowski. Besides, we compute the first even differential cohomology space $mathrmH^1_{mathrm{diff}}(cK(1);widetilde{cD}_{lambda,mu})$ of the Lie superalgebra $mathcalK(1)$ of contact vector fields on the (1,1)-dimensional superspace $mathbbR^{1|1}$ with coefficients in the superspace $widetilde{mathcalD}_{lambda,mu}$ of linear differential operators from the superspace of weighted densities $\\fF_{\\lamda}$ to $\\fF_{\\mu}$. (To appear in Journal of Generalized Lie Theory and Applications)

  10. Determination of ultimate carbonaceous BOD and the specific rate constant (K1)

    Science.gov (United States)

    Stamer, J.K.; Bennett, J.P.; McKenzie, Stuart W.

    1982-01-01

    Ultimate carbonaceous biochemical oxygen demand (BODu) and the specific rate constant (K1) at which the demand is exerted are important parameters in designing biological wastewater treatment plants and in assessing the impact of wastewater on receiving streams. An analytical method is presented which uses time-series concentrations of BOD, defined as the calculated sum of dissolved oxygen (DO) losses at each time of measurement, for determining BODu and K1. Time-series DO measurements are obtained from a water sample that is incubated in darkness at 20 degrees Celsius in the presence of nitrapyrin, a chemical nitrification inhibitor. Time-series concentrations of BOD that approximate first order kinetics can be analyzed graphically or mathematically to compute BODu and K1.

  11. Doping dependence of correlation effects in K1 - x Fe2 - y Se2 superconductors: LDA' + DMFT investigation

    Science.gov (United States)

    Nekrasov, I. A.; Pavlov, N. S.; Sadovskii, M. V.

    2013-11-01

    We present a detailed LDA' + DMFT investigation of the doping dependence of correlation effects in the novel K1 - x Fe2 - y Se2 superconductor. Calculations are performed at four different hole doping levels, starting from a hypothetical stoichiometric composition with the total number of electrons equal to 29 per unit cell through 28 and 27.2 electrons toward the case of 26.52, which corresponds to the chemical composition K0.76Fe1.72Se2 studied in recent ARPES experiments. In the general case, the increase in hole doping leads to quasiparticle bands in a wide energy window ±2 eV around the Fermi level becoming more broadened by lifetime effects, while correlation-induced compression of Fe-3 d LDA' bandwidths stays almost the same, of the order of 1.3 for all hole concentrations. However, close to the Fermi level, the situation is more complicated. In the energy interval from -1.0 eV to 0.4 eV, the bare Fe-3 d LDA' bands are compressed by significantly larger renormalization factors up to 5 with increased hole doping, while the value of Coulomb interaction remains the same. This fact manifests the increase in correlation effects with hole doping in the K1 - x Fe2 - y Se2 system. Moreover, in contrast to typical pnictides, K1 - x Fe2 - y Se2 does not have well-defined quasiparticle bands on the Fermi levels, but has a "pseudogap"-like dark region instead. We also find that with the growth of hole doping, Fe-3 d orbitals of various symmetries are affected by correlations differently in different parts of the Brillouin zone. To illustrate this, we determine the quasiparticle mass renormalization factors and energy shifts that transform the bare Fe-3 d LDA' bands of various symmetries into LDA' + DMFT quasiparticle bands. These renormalization factors effectively mimic more complicated energy-dependent self-energy effects and can be used to analyze the available ARPES data.

  12. Autonomous safety and reliability features of the K-1 avionics system

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, G.E.; Kohrs, D.; Bailey, R.; Lai, G. [Kistler Aerospace Corp., Kirkland, WA (United States)

    2004-03-01

    Kistler Aerospace Corporation is developing the K-1, a fully reusable, two-stage-to-orbit launch vehicle. Both stages return to the launch site using parachutes and airbags. Initial flight operations will occur from Woomera, Australia. K-1 guidance is performed autonomously. Each stage of the K- 1 employs a triplex, fault tolerant avionics architecture, including three fault tolerant computers and three radiation hardened Embedded GPS/INS units with a hardware voter. The K-1 has an Integrated Vehicle Health Management (IVHM) system on each stage residing in the three vehicle computers based on similar systems in commercial aircraft. During first-stage ascent, the IVHM system performs an Instantaneous Impact Prediction (IIP) calculation 25 times per second, initiating an abort in the event the vehicle is outside a predetermined safety corridor for at least three consecutive calculations. In this event, commands are issued to terminate thrust, separate the stages, dump all propellant in the first-stage, and initiate a normal landing sequence. The second-stage flight computer calculates its ability to reach orbit along its state vector, initiating an abort sequence similar to the first stage if it cannot. On a nominal mission, following separation, the second-stage also performs calculations to assure its impact point is within a safety corridor. The K-1's guidance and control design is being tested through simulation with hardware-in-the-loop at Draper Laboratory. Kistler's verification strategy assures reliable and safe operation of the K-1. (author)

  13. Des-gamma-carboxyprothrombin (PIVKA II) and plasma vitamin K1 in newborns and their mothers.

    Science.gov (United States)

    von Kries, R; Shearer, M J; Widdershoven, J; Motohara, K; Umbach, G; Göbel, U

    1992-10-01

    Assessments of the vitamin K status in newborns and their mothers by means of des-gamma-carboxy-prothrombin (PIVKA II) measurement have given equivocal results. Part of the variability could be attributed to differences in sensitivity (i.e. the ability to detect small concentrations) and validity (i.e. ability to detect vitamin K deficiency) of the methods applied. None of these methods have yet been validated with respect to plasma vitamin K1. In 22 healthy mother/infant pairs PIVKA II was determined using three different assays including ratio Xa/ecarin (Xa/ec), crossed immunoelectrophoresis (CIE), and an ELISA with a monoclonal antibody (MAB). The results were compared with conventional clotting tests and plasma vitamin K1. The following results were obtained: Cord blood: Clotting tests within age-related normal ranges; PIVKA II detection rates: 0/22 (Xa/ec), 1/22 (CIE), 4/22 (MAB); plasma vitamin K1: undetectable in 20/22. Mothers: Clotting tests all within normal range; PIVKA II detection rates: 1/22 (Xa/ec), 0/22 (CIE), 5/22 (MAB); plasma vitamin K1 (pg/ml) for all mothers (median; range): 186; 55-833; for PIVKA II positive mothers: 213; 59-699. PIVKA II detectability in newborns and mothers was not correlated. The results show an increase in sensitivity for PIVKA II detection in the order of MAB > CIE > Xa/ec. Due to the very low plasma vitamin K1 at birth, no correlation was possible between cord PIVKA II detectability and plasma vitamin K1. However, in mothers at term PIVKA II MAB appears to be unrelated to the vitamin K status.

  14. Emma Willard Students Illustrate New Children's Book about Feisty Female Characters

    Science.gov (United States)

    Gross, Karen

    2016-01-01

    "Lady Lucy's Quest" (Shires Press) is a story about a feisty young girl in the Middle Ages who wants to become a Knight of the Round Table. The initial reaction of her family, the townspeople, and the knights is, stated simply, "no way." But Lucy perseveres and meets the three challenges of knighthood presented to her, albeit…

  15. Review of Beyond Illustration: 2D and 3D Digital Tools for Discovery in Archaeology [Book

    Directory of Open Access Journals (Sweden)

    Melissa Terras

    2010-06-01

    Full Text Available The creation of images has been an activity since the beginning of human society: our early ancestors painted or carved rocks with depictions of their lifestyles and beliefs. Rocks are not very portable, however, and humans like to share their visualisations and the knowledge contained within them. Much investment in technology has focused on the ability to create, replicate and disseminate visual information, from early print materials to attempts at chemical photography and recently, the development of ever more complex computational methods to represent visual information in a variety of ways. Visualisations are an important means of communication, a source of information and a focus of both social interaction and scholarly activity. Images and visualisations play an important role in cultural and social history, can contain valuable historical information and are used more and more in academic research that aims to study culture in its widest sense: focussing on artefacts and cultural produce.

  16. Emergence of Carbapenem-Resistant Serotype K1 Hypervirulent Klebsiella pneumoniae Strains in China.

    Science.gov (United States)

    Zhang, Rong; Lin, Dachuan; Chan, Edward Wai-Chi; Gu, Danxia; Chen, Gong-Xiang; Chen, Sheng

    2015-11-16

    We report the emergence of five carbapenem-resistant K1 hypervirulent Klebsiella pneumoniae (hvKP) strains which caused fatal infections in hospital patients in Zhejiang Province, China, upon entry through surgical wounds. Genotyping results revealed the existence of three genetically related strains which exhibited a new sequence type, ST1797, and revealed that all strains harbored the magA and wcaG virulence genes and a plasmid-borne bla(KPC-2) gene. These findings indicate that K1 hvKP is simultaneously hypervirulent, multidrug resistant, and transmissible.

  17. Fairy Tale Illustrations and Real World Gender: Function, Conceptualization, and Publication

    Directory of Open Access Journals (Sweden)

    Ruth B. Bottigheimer

    2010-12-01

    Full Text Available Fairy tales that have been illustrated with a single image apiece are themselves generally a commercial enterprise, whose content and design must be conceived in a broadly acceptable mode in order to sell. Second, the selling process assumes a profit motive. Third, it can be shown that the single illustration mode results in projecting an individual illustratorʹs vision of a tale. Fourth, when large numbers of illustrations in single‐illustration mode exist in commercially produced books, the aggregate range of their content comprises the range of culturally‐acceptable images for a given story. (A methodology for analyzing fairy tales with multiple images will be introduced separately at the end of this article.

  18. Form factors in the massless coset models su(2)_k+1 \\otimes su(2)_k /su(2)_2k+1 - Part II

    CERN Document Server

    Grinza, P

    2004-01-01

    Massless flows from the coset model su(2)_k+1 \\otimes su(2)_k /su(2)_2k+1 to the minimal model M_k+2 are studied from the viewpoint of form factors. These flows include in particular the flow from the Tricritical Ising model to the Ising model. By analogy with the magnetization operator in the flow TIM -> IM, we construct all form factors of an operator that flows to \\Phi_1,2 in the IR. We make a numerical estimation of the difference of conformal weights between the UV and the IR thanks to the \\Delta-sum rule; the results are consistent with the conformal weight of the operator \\Phi_2,2 in the UV. By analogy with the energy operator in the flow TIM -> IM, we construct all form factors of an operator that flows to \\Phi_2,1. We propose to identify the operator in the UV with \\sigma_1\\Phi_1,2.

  19. 一类整群环的K1群的计算%Calculation of K1 group of some integral group rings

    Institute of Scientific and Technical Information of China (English)

    刘佳奇; 高玉彬

    2011-01-01

    The integral group ring (Z)G is an important ring structure.This paper focuses on the calculation of the K1 groups of integral group rings.The key point of the problem lies in the calculation of their corresponding SK1 group rings.The SK1 groups of the integral group rings of p groups are relatively easy to calculate, but the SK1 groups of the integral group rings of non-p groups are relatively diffcult to calculate.This article discusses the basic theory of the problem.Furthermore, this article also treats the groups whose orders are p1q1 and discusses the calculation of the SK1 group rings of their integral group rings.%着重讨论整群环的K1群的计算,问题的关键点在于其对应的SK1群的计算,其中,P群的整群环的SK1群的结果是已知的.讨论了计算SK1群的基本理论,并证明了一类特殊的非P群(P1q1阶群)的整群环的SK1群是平凡的.

  20. When Do Children Read Books?

    Science.gov (United States)

    van Ours, Jan C.

    2008-01-01

    This paper investigates the reading of fiction books by 15 year olds in 18 OECD countries. It appears that girls read fiction books more often than boys, whereas boys read comic books more often than girls. Parental education, family structure, and the number of books and televisions at home influence the intensity with which children read fiction…

  1. Illustrating the machinery of life: viruses.

    Science.gov (United States)

    Goodsell, David S

    2012-01-01

    Data from electron microscopy, X-ray crystallography, and biophysical analysis are used to create illustrations of viruses in their cellular context. This report describes the scientific data and artistic methods used to create three illustrations: a depiction of the poliovirus lifecycle, budding of influenza virus from a cell surface, and a mature HIV particle in blood serum. Copyright © 2012 Wiley Periodicals, Inc.

  2. ILLUSTRATIONS OF RADIOISOTOPES--DEFINITIONS AND APPLICATIONS.

    Science.gov (United States)

    Atomic Energy Commission, Oak Ridge, TN. Div. of Technical Information.

    THIS PUBLICATION IS COMPOSED OF OVER 150 PAGES OF BLACK AND WHITE ILLUSTRATIONS DEALING WITH RADIOISOTOPES AND THEIR USES. THESE ILLUSTRATIONS CONSIST OF CHARTS, GRAPHS, AND PICTORIAL REPRESENTATIONS WHICH COULD BE PREPARED AS HANDOUTS, TRANSPARENCIES FOR OVERHEAD PROJECTION, OR WHICH COULD BE USED IN A NUMBER OF OTHER WAYS FOR PRESENTING SUCH…

  3. "Illustrating the Machinery of Life": Viruses

    Science.gov (United States)

    Goodsell, David S.

    2012-01-01

    Data from electron microscopy, X-ray crystallography, and biophysical analysis are used to create illustrations of viruses in their cellular context. This report describes the scientific data and artistic methods used to create three illustrations: a depiction of the poliovirus lifecycle, budding of influenza virus from a cell surface, and a…

  4. "Illustrating the Machinery of Life": Viruses

    Science.gov (United States)

    Goodsell, David S.

    2012-01-01

    Data from electron microscopy, X-ray crystallography, and biophysical analysis are used to create illustrations of viruses in their cellular context. This report describes the scientific data and artistic methods used to create three illustrations: a depiction of the poliovirus lifecycle, budding of influenza virus from a cell surface, and a…

  5. 76 FR 7847 - Glenn A. Baxter, Application To Renew License for Amateur Radio Service Station K1MAN

    Science.gov (United States)

    2011-02-11

    ... COMMISSION Glenn A. Baxter, Application To Renew License for Amateur Radio Service Station K1MAN AGENCY... renew the license for Amateur Radio Service Station K1MAN filed by Glenn A. Baxter should be granted.... Baxter for renewal of his license for Amateur Radio Station K1MAN should be granted. As discussed below...

  6. 26 CFR 1.404(k)-1T - Questions and answers relating to the deductibility of certain dividend distributions. (Temporary)

    Science.gov (United States)

    2010-04-01

    ... deductibility of certain dividend distributions. (Temporary) 1.404(k)-1T Section 1.404(k)-1T Internal Revenue... Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.404(k)-1T Questions and answers relating to the deductibility of certain dividend distributions. (Temporary) Q-1: What does section 404(k) provide? A-1: Section...

  7. BIOCHEMISTRY APPROACH IN BOOKS APPROVED BY THE NATIONAL BOOK TEACHING PROGRAM 2015

    Directory of Open Access Journals (Sweden)

    C. E.S. Rocha

    2015-08-01

    Full Text Available INTRODUCTION: Collections of textbooks are distributed every three years to basic education schools and represent a source of knowledge to students and a reference to the pedagogical work of teachers. Biochemistry is an area that studies the chemical processes occurring in living organisms, with their concepts present in both chemistry textbooks as in biology. It is necessary that the present approach in these books are interesting to students, to recognize the importance of understanding these processes. OBJECTIVES: To analyze as it has been crafted in biochemistry textbooks high school approved by PNLD 2015. MATERIALS AND METHODS: We investigated how the biochemical area-related content are described in the book "Bio - Volume 1", authored by Sonia Lopes and Sergio Rosso, and in the book "Chemistry - Volume 3" by Martha Reis with regard to clarity of concepts, context, illustrations and interdisciplinarity. RESULTS: Both books have chapters devoted especially to describe on this area, with plenty of catchy titles, but one in the first year and the other in the final year of high school. In biology textbook chapter called "The chemistry of life" brings in its approach clear and succinct concepts, contextualizes the issues on current information of figures and tables, features lots of illustrations that range from photographs to represent chemical structures and is mainly interdisciplinary in test questions. In chemistry textbook chapter "Introduction to Biochemistry" shows clear and detailed concepts, contextualizes with curiosities and everyday issues of students, has auxiliary illustrations in understanding and is interdisciplinary. CONCLUSIONS: We realize that there is a gap between the disciplines to work biochemistry during high school, but the form of presentation used for books is clear and present use of languages in the daily lives of students, making learning interesting and attractive.

  8. ENGLISH BOOK CLUB

    CERN Multimedia

    English Book Club

    2009-01-01

    http://club-englishbookclub.web.cern.ch A note to our members Dear Members, Many thanks to all of you who have paid up now. However, there are still some late payers and Morna would appreciate knowing if they will pay for 2009/2010 or if they have left the club. At the AGM on 17 November it was decided that a 3 month delay for key reimbursement will be given to all present and past members, BUT after 31.3.2010 no reimbursement will be given out. We are in the process of making changes to the access to the club for paid-up, active members only. Some of you have told Morna you will pay on your next visit to CERN, that is ok but please try to do this by 15 December if possible. A new version of the club’s book data-base is available on the web: http://club-englishbookclub.web.cern.ch/club-englishbookclub/Export/index.html The English Book Club has a growing collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books...

  9. "To Improve upon Hints of Things": Illustrating Isaac Newton.

    Science.gov (United States)

    Schilt, Cornelis J

    2016-01-01

    When Isaac Newton died in 1727 he left a rich legacy in terms of draft manuscripts, encompassing a variety of topics: natural philosophy, mathematics, alchemy, theology, and chronology, as well as papers relating to his career at the Mint. One thing that immediately strikes us is the textuality of Newton's legacy: images are sparse. Regarding his scholarly endeavours we witness the same practice. Newton's extensive drafts on theology and chronology do not contain a single illustration or map. Today we have all of Newton's draft manuscripts as witnesses of his working methods, as well as access to a significant number of books from his own library. Drawing parallels between Newton's reading practices and his natural philosophical and scholarly work, this paper seeks to understand Newton's recondite writing and publishing politics.

  10. Contemporary Danish book art

    DEFF Research Database (Denmark)

    Larsen, Poul Steen

    the Metropolitan Museum of Art, Thomas J. Watson Library, Helge Ernst, illustrator, Poul Kristensen, printer, Ole Olsen, bookbinder, exhibition catalog......the Metropolitan Museum of Art, Thomas J. Watson Library, Helge Ernst, illustrator, Poul Kristensen, printer, Ole Olsen, bookbinder, exhibition catalog...

  11. K-1 Teachers' Visual Arts Beliefs and Their Role in the Early Childhood Classroom

    Science.gov (United States)

    Goodman-Schanz, Blythe Annette

    2012-01-01

    The purpose of this qualitative study was to explore and describe the visual arts beliefs and practices of eight K-1 teachers in four schools and in two different school districts in a southern state. Using a phenomenological framework (Creswell, 2007; Leedy & Ormrod, 2005), the research revealed the teachers' understandings of beliefs and how…

  12. 26 CFR 1.168(k)-1 - Additional first year depreciation deduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Additional first year depreciation deduction. 1... Corporations § 1.168(k)-1 Additional first year depreciation deduction. (a) Scope and definitions—(1) Scope. This section provides the rules for determining the 30-percent additional first year...

  13. Book reviews 2016

    Directory of Open Access Journals (Sweden)

    Hilling Axel

    2016-11-01

    Full Text Available This section contains reviews of two Swedish books on international taxation. First, the book Skatteavtal och generalklausuler, Ett komparativt perspektiv (Tax Agreements and General Anti-Avoidance Regulations, A Comparative Perspective is recommended for those who study and work with international tax law. The book analyses how tax treaties’ function to limit contracting states’ taxing powers relates to national GAARs. A comparative analysis is made between Sweden and Canada. In the second review, the doctoral dissertation EU-domstolens restirktionsprövning i mal om de grundläggande frihterna och direkta skatter (The EU Court of Justice’s examination of the restriction requirement in its direct tax case law is reviewed. The dissertation systemizes relevant CJEU’s case law and analyzes the Courts reasoning in deciding whether or not certain tax regulation is in conflict with EU fundamental freedoms.

  14. Interactive Sample Book (ISB)

    DEFF Research Database (Denmark)

    Heimdal, Elisabeth Jacobsen; Lenau, Torben Anker; Guglielmi, Michel

    2009-01-01

    involving designers and engineers. It is carried out by Elisabeth Heimdal as her Master thesis from Design & Innovation, The Technical University of Denmark. Collaboration partners are the design bureau Diffus, textile designer Priya Mani, master student in medialogy at AAU Marija Andonovska and DTU......, with the aim of exploring and communicating some of the possibilities within interactive textiles. The applications for interactive textiles range from medical applications to architecture, and from the fashion industry to costume design. In relation to the sample book, focus will be on texture, lightning...... and senses in relation to integrated decoration and function primarily to indoor applications. The result of the project will be a number of interactive textiles, to be gathered in an interactive sample book (ISB), in a similar way as the sample books of wallpapers one can take home from the shop and choose...

  15. Year book Australia 1986

    Energy Technology Data Exchange (ETDEWEB)

    Castles, I. (comp.)

    1986-01-01

    The Year Book is the principal reference work produced by the Central Office of the Australian Bureau of Statistics (ABS). It provides a comprehensive and detailed statistical review of all asepcts of the economy and social conditions of Australia. In addition, it contains descriptive matter dealing with Australia's history, geography, physiography, climate and meteorology, government, defence, international relations, culture and environment. The first Official Year Book was published early in 1908. This is the seventieth Year Book issued under the authority of the Commonwealth Government and follows a similar pattern to previous editions. However chapters have been revised and new material has been added. Most of the statistics contained in this volume relate to the years ended June or December 1984 to 1985. More detailed, and in most cases more recent, statistics are available in other ABS publications.

  16. Chapter 20: neurological illustration from photography to cinematography.

    Science.gov (United States)

    Aubert, Geneviève

    2010-01-01

    This chapter explores iconography in neurology from the birth of photography up to the early medical applications of cinematography before 1914. The important visual part of neurological diagnosis explains why these techniques were adopted very early by neurologists. Duchenne published the first medical book illustrated with photographs of patients. The first and most famous photographic laboratory was created in Charcot's department, at the Salpêtrière in Paris, under the direction of Albert Londe. Londe published the first book dedicated to medical photography. The physiologist Marey and the photographer Muybridge, in association with neurologists, played key roles in the development of chronophotography and cinematography. Germany was the first country to welcome cinematography in a neurology department. Independently, neurologists began to film patients in other countries in Europe and in America. In 1905, Arthur Van Gehuchten (1861-1914), Belgian anatomist and neurologist, began systematically to film neurologic patients, with the intention of building up a complete neurological iconographic collection. This collection has survived and has been restored in the laboratory of the Royal Belgian Film Archive where the films are now safely stored in their vaults.

  17. Check Out These Books

    Science.gov (United States)

    Collins, Michelle (Editor); Mulenburg, Gerald

    2002-01-01

    The book entitled "Fusion Leadership: Unlocking the Subtle Forces that Change People and Organizations Richard L. Daft and Robert H. Lengel (1998) Berett-Koehler Publishers, Inc." was Reviewed by Dr. Michelle Collins, NASA Headquarters. If you've already read books on leadership and organizational change by authors such as Moshe Rubinstein and Iris Firstenberg, Peter Senge, Tom Peters, and Steven Covey, and you were thinking of rereading them, you don't have to do that now. Just read this book instead. It's a fusion of many of their same concepts presented from a different view. The book does not explore any particular subject in depth. Rather the authors "skim" many subjects and concepts, interlacing them to develop the concept of "Fusion Leadership". The fundamental concept of treating people as people rather than machines is the main theme. "Fusion Leadership" is the process of fusing people together by nurturing six "subtle" forces: mindfulness, courage, vision, heart, communication, and integrity. To do so, hierarchy is diminished and responsibility both for oneself as well as for the team is emphasized. There are a number of organizations and managers that will find such a change threatening. The concepts behind such a management style are straightforward and the benefits are intuitive once you've reflected on them; however, the obvious benefits of the behavioral change proposed in Fusion Leadership can be completely lost in a fear-based system. The concept of caring about people in one's organization was the common thread in Chris Turner's book All Hat, No Cattle (see book review, ASK 5). Much is being written about the re-humanizing of the workplace, but the basis of it is so common sense that one wonders what's taking so long for the workplace to change? Whether you're in a position to change your organization or simply your project team, you'll find the concepts in fusion leadership equally applicable.

  18. CMS Comic Book

    CERN Multimedia

    Gill, Karl Aaron

    2006-01-01

    Titled "CMS Particle Hunter," this colorful comic book style brochure explains to young budding scientists and science enthusiasts in colorful animation how the CMS detector was made, its main parts, and what scientists hope to find using this complex tool. Book invites young students to get involved in particle physics themselves to join the adventure. Written by Dave Barney and Aline Guevera. Layout and drawings by Eric Paiharey and Frederic Vignaux. Available in English, French, German, Italian, Spanish and Portuguese. Year Produced: 2006. Update: September 2013.

  19. Newnes electrical pocket book

    CERN Document Server

    Reeves, E A

    2013-01-01

    Newnes Electrical Pocket Book, Twenty-first Edition, provides engineers with convenient access to various facts, tables, and formulae relating to the particular branch of engineering being dealt with. In the case of electrical engineering, it is essential that the engineer have a clear understanding of the methods by which the various formulae are derived to ensure that any particular formulae is applicable to the conditions being considered. The first section of the Pocket Book is devoted to the theoretical groundwork upon which all the practical applications are based. This covers symbols,

  20. Chemistry WebBook

    Science.gov (United States)

    SRD 69 NIST Chemistry WebBook (Web, free access)   The NIST Chemistry WebBook contains: Thermochemical data for over 7000 organic and small inorganic compounds; thermochemistry data for over 8000 reactions; IR spectra for over 16,000 compounds; mass spectra for over 33,000 compounds; UV/Vis spectra for over 1600 compounds; electronic and vibrational spectra for over 5000 compounds; constants of diatomic molecules(spectroscopic data) for over 600 compounds; ion energetics data for over 16,000 compounds; thermophysical property data for 74 fluids.

  1. Newnes microprocessor pocket book

    CERN Document Server

    Money, Steve

    2014-01-01

    Newnes Microprocessor Pocket Book explains the basic hardware operation of a microprocessor and describes the actions of the various types of instruction that can be executed. A summary of the characteristics of many of the popular microprocessors is presented. Apart from the popular 8- and 16-bit microprocessors, some details are also given of the popular single chip microcomputers and of the reduced instruction set computer (RISC) type processors such as the Transputer, Novix FORTH processor, and Acorn ARM processor.Comprised of 15 chapters, this book discusses the principles involved in bot

  2. Electronics engineer's reference book

    CERN Document Server

    Mazda, F F

    1989-01-01

    Electronics Engineer's Reference Book, Sixth Edition is a five-part book that begins with a synopsis of mathematical and electrical techniques used in the analysis of electronic systems. Part II covers physical phenomena, such as electricity, light, and radiation, often met with in electronic systems. Part III contains chapters on basic electronic components and materials, the building blocks of any electronic design. Part IV highlights electronic circuit design and instrumentation. The last part shows the application areas of electronics such as radar and computers.

  3. Electronics pocket book

    CERN Document Server

    Parr, E A

    1981-01-01

    Electronics Pocket Book, Fourth Edition is a nonmathematical presentation of the many varied topics covered by electronics. The book tackles electron physics, electronic components (i.e. resistors, capacitors, and conductors), integrated circuits, and the principles of a.c. and d.c. amplifiers. The text also discusses oscillators, digital circuits, digital computers, and optoelectronics (i.e., sensors, emitters, and devices that utilize light). Communications (such as line and radio communications, transmitters, receivers, and digital techniques); the principles and examples of servosystems; a

  4. Mechanical engineer's reference book

    CERN Document Server

    Parrish, A

    1973-01-01

    Mechanical Engineer's Reference Book: 11th Edition presents a comprehensive examination of the use of Systéme International d' Unités (SI) metrication. It discusses the effectiveness of such a system when used in the field of engineering. It addresses the basic concepts involved in thermodynamics and heat transfer. Some of the topics covered in the book are the metallurgy of iron and steel; screw threads and fasteners; hole basis and shaft basis fits; an introduction to geometrical tolerancing; mechanical working of steel; high strength alloy steels; advantages of making components as castings

  5. Electrical engineer's reference book

    CERN Document Server

    Jones, G R

    2013-01-01

    A long established reference book: radical revision for the fifteenth edition includes complete rearrangement to take in chapters on new topics and regroup the subjects covered for easy access to information.The Electrical Engineer's Reference Book, first published in 1945, maintains its original aims: to reflect the state of the art in electrical science and technology and cater for the needs of practising engineers. Most chapters have been revised and many augmented so as to deal properly with both fundamental developments and new technology and applications that have come to the fore since

  6. New methodologies for lower-K1 EUV OPC and RET optimization

    Science.gov (United States)

    Hooker, Kevin; Kazarian, Aram; Zhou, Xibin; Tuttle, Josh; Xiao, Guangming; Zhang, Yunqiang; Lucas, Kevin

    2017-03-01

    EUV lithography is viewed as a highly desirable technology for 5nm and 7nm node patterning cost reduction and process simplicity. However, for the 5nm and 7nm nodes EUV not only needs to function in a low-K1 resolution environment but has several new and complex patterning issues which will need accurate compensation by mask synthesis tools and flows. The main new issues are: long-range flare variation across the chip, feature dependent focus offsets due to high mask topography, asymmetry inducing shadowing effects which vary across the lens slit, significantly higher lens aberrations, illumination source changes (across the lens and with time) and new resist exposure mechanisms. These solutions must be successfully deployed at low K1 values and must be integrated together to create OPC/RET flows which have high resolution, high accuracy, and are fast to deploy. Therefore, the combined requirements of low-K1 resolution, full reticle correction accuracy and process window can be even more challenging than in current optical lithography mask synthesis flows. Advanced computational methods such as ILT and model-based SRAF optimization are well known to have considerable benefits in process window and resolution for low-K1 193 lithography. However, these methods have not been well studied to understand their benefits for lower-K1 EUV lithography where fabs must push EUV resolution, 2D accuracy and process window to their limits. In this paper, we investigate where inverse lithography methods can improve EUV patterning weaknesses vs. traditional OPC/RET. We first show how ILT can be used to guide a better understanding of optimal solutions for EUV mask synthesis. We then provide detailed comparisons of ILT and traditional methods on a wide range of mask synthesis applications.

  7. Medical illustration: from caves to cyberspace.

    Science.gov (United States)

    Tsafrir, J; Ohry, A

    2001-06-01

    The human body has been depicted in ancient cave-paintings, in primitively sculpted figures, and through all the ages in various forms of artistic expression. The earliest medical texts were descriptive but not illustrated. Later, as it became clear that knowledge of the human body and all its systems was essential to the practice of healing, texts were accompanied by illustrations which became an integral part of the teaching process. The illustrators included artists, whose interest was primarily artistic, but who were sometimes employed by surgeons or physicians to illustrate their texts. Occasionally, the physicians or scientists accompanied their texts with their own illustrations, and in the last century, medical illustration, in its infinite variety of techniques, has been developed as a profession in its own right. As knowledge was extended, permitted by social and cultural change, as well as by technological advances, the types of illustrations have ranged from gross anatomy through dissections showing the various organ systems, histological preparations, and radiological images, right up to the computerized digital imagery that is available today, which allows both static and dynamic two- and three-dimensional representations to be transmitted electronically across the world in a matter of seconds. The techniques used to represent medical knowledge pictorially have been as varied as the illustrators themselves, involving drawing, engraving, printing, photography, cinematography and digital processing. Each new technique has built on previous experience to broaden medical knowledge and make it accessible to an ever-widening audience. This vast accumulation of pictorial material has posed considerable problems of storage, cataloguing, retrieval, display and dissemination of the information, as well as questions of ethics, validity, manipulation and reliability. This paper traces these developments, illustrating them with representative examples drawn from

  8. The changing role of the medical illustrator.

    Science.gov (United States)

    Morton, R; Nicholls, J; Williams, R

    2000-06-01

    The annual meeting of the Australian Institute of Medical and Biological Illustration in Melbourne in November 1998 included keynote addresses from Richard Morton and Robin Williams. Both speakers looked at the future of the medical illustration profession, and in particular the impact of new technology. This matter was also addressed by Joe Nicholls in a presentation given at the Institute of Medical Illustrators' Annual Symposium in Warwick, UK, in September 1998. This paper is a synthesis of the ideas presented by these three speakers and elaborates on common themes in their presentations.

  9. Basic illustrated knots for the outdoors

    CERN Document Server

    Jacobson, Cliff

    2008-01-01

    Cliff Jacobson is one of North America's most respected outdoors writers and wilderness canoe guides. His experiences as a professional outfitter and canoeing consultant have resulted in more than a dozen top-selling books on camping, canoeing, navigation, and outdoor skills.

  10. Starry Cities and Astrolies - Books to communicate with the public

    Science.gov (United States)

    Stanic, N.

    2008-06-01

    Extragalactic worlds have been presented as star cities in a book of original design - STARRY CITIES - galaxies and time travel, the first book about galaxies written in Serbian for the general public. This book isn't written just for those interested in science, but for all kind of artists, philosophers and thinkers. A second book, ASTROLIES deals with common confusions concerning astronomy and astrology. These two books don't only offer interesting illustrations, data from the latest astronomical observations and currently accepted cosmological theories - they induce, by provoking curiosity in a specific and witty way, a sense of adventure and a challenge to explore. The publisher of both books is the oldest and the biggest publisher of text-books in Serbia, Zavod za udzbenike i nastavna sredstva2, currently celebrating 50 years in publishing (1957-2007). They already publish a dozen books in popular astronomy, but a special astronomical series for the general public was introduced in 2004. STARRY CITIES and ASTROLIES are part of the ongoing multidisciplinary project Astronomy. Inspiration. Art that started at the end of 2004 at the Public Observatory in Belgrade. This project intends to inspire (or perhaps even "infect") artists with cosmic themes and the fantastic scenery of the Universe.

  11. Medical Physics Data Book,

    Science.gov (United States)

    The Medical Physics Data Book is a collection of physical and chemical data useful in medical physics . The information has been extracted from other...ionizing Radiation. Carried out by the Medical Physics Data Group of the American Association of Physicists in Medicine, this compilation is meant to

  12. The enemies of books

    CERN Document Server

    Blades, William

    2012-01-01

    A fascinating look at the myriad enemies of the printed book, from fire, to neglect, to children, to the bookworm, to plain old ignorance. A passionate litany against all who would see printed literature destroyed, written by English printer and bibliographer William Blades.

  13. Bridging Inequity With Books.

    Science.gov (United States)

    Krashen, Stephen

    1998-01-01

    Providing rich supply of high-interest story books is more feasible policy for literacy education than urgent exhortations to improve teacher quality. Free reading profoundly improves students' reading and writing ability, spelling, grammar, and vocabulary. The quality of a country s or state's school libraries significantly predicts its reading…

  14. CMS Comic Book Brochure

    CERN Document Server

    2006-01-01

    To raise students' awareness of what the CMS detector is, how it was constructed and what it hopes to find. Titled "CMS Particle Hunter," this colorful comic book style brochure explains to young budding scientists and science enthusiasts in colorful animation how the CMS detector was made, its main parts, and what scientists hope to find using this complex tool.

  15. The Comic Book Project

    Science.gov (United States)

    Bitz, Michael

    2008-01-01

    The Comic Book Project (CBP) celebrates its eighth anniversary this year. The project, which just originated with one school in New York City, had grown to encompass thousands of students nationwide. The goal of the CBP is not to create comics the "Marvel way" or to develop the next Stan Lee. Rather, the goal is to give students the opportunity to…

  16. Vietnam in Childrens' Books.

    Science.gov (United States)

    United Nations Children's Fund, New York, NY. United States Committee.

    Twenty-five nonfiction and 18 fiction and folklore listings are included in this bulletin on Vietnam in childrens' books. Slides, filmstrips, and film listings are also included. Each listing is accompanied by a brief annotation. Subjects include customs and culture, the country and the people, Ho Chi Min, the Vietnamese revolution, Vietnamese…

  17. The Comic Book Project

    Science.gov (United States)

    Bitz, Michael

    2008-01-01

    The Comic Book Project (CBP) celebrates its eighth anniversary this year. The project, which just originated with one school in New York City, had grown to encompass thousands of students nationwide. The goal of the CBP is not to create comics the "Marvel way" or to develop the next Stan Lee. Rather, the goal is to give students the opportunity to…

  18. China resource book

    NARCIS (Netherlands)

    Trouwborst, K.O.; Eijndthoven, van P.J.

    1999-01-01

    The China Resource Book explains the organisation of the agricultural production in China and relates it to China's efforts to eradicate poverty and achieve self-sufficiency in food. It also highlights the variety of environmental problems, which haverisen since the rapid industrial development in t

  19. Basic Drafting: Book Two.

    Science.gov (United States)

    Davis, Ronald; And Others

    The second of a two-book course in drafting, this manual consists of 12 topics in the following units: sketching techniques, geometric constructions, orthographic views, dimensioning procedures, basic tolerancing, auxiliary views, sectional views, inking tools and techniques, axonometrics, oblique, perspective, and computer-aided drafting.…

  20. Book on CPC Published

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    A book that answers 13 questions about how the Communist Party of China(CPC) works in China and why the Party has made great achievements in the past decades has been recently published by the Beijing-based New World Press.

  1. Best Books 2010

    Science.gov (United States)

    Jones, Trevelyn; Toth, Luann; Charnizon, Marlene; Grabarek, Daryl; Fleishhacker, Joy

    2010-01-01

    This article presents the 62 books chosen by "School Library Journal's" editors as the best of the year. While novels include some historical settings and contemporary concerns, it is fantasy that continues to reign supreme. More original, and more creative than ever, it includes selections that are frightening, edgy, wildly funny, electrifying,…

  2. Book Reviews/Boekbesprekings

    African Journals Online (AJOL)

    rarer types of neurological problems which the student or trainee is likely to encounter. ... The present book is a joint effort by teachers associated with. Baltimore City ..... English and German, and weighing over 3 kg, this is a mammoth compendium of ... The 12 chapters of volume 3 cover hearing disorders, several as pects ...

  3. Books/Boeke

    African Journals Online (AJOL)

    human placenta or strips of extra-ocular muscle to improve choroidal bloodflow ... current treatments. For registrars in training, the·book provides ..... for the inspiratory splirting of the pulmonary second sound ('hang out' effect) rather than being ...

  4. Books/Boeke

    African Journals Online (AJOL)

    as an updated introduction to political psychology and describes the growing interest ... the eyes of political adversaries. Arrention is drawn to .... this, and both criteria are measures of how up to date the book is. .... control regions. The structure ...

  5. Books for Summer Reading.

    Science.gov (United States)

    Phi Delta Kappan, 1995

    1995-01-01

    Recommends many books for summer reading enjoyment, concentrating on historical and contemporary fiction. Different cultures clash in William T. Vollman's "Fathers and Crows" and John Demos's adventuresome "Unredeemed Captive." Other suggestions: "Snow Falling on Cedar Mountain" (David Gutterman) and "Foxfire" (Joyce Carol Oates). For professional…

  6. Administration Trip Books

    Science.gov (United States)

    2007-11-02

    Plan. (h) Army Community of Excellence. (i) Child development services. k. The Assistant Secretary of the Army for Manpower and Reserve Affairs ( ASAM ...RA) will — (1) Provide information as requested when the information falls under the purview of the ASAM &RA. (2) Provide recurring trip book

  7. Hurrah for Chapter Books.

    Science.gov (United States)

    Jones, Glenowyn L.

    This annotated bibliography contains a list of 42 recent Chapter Books. The bibliography is divided into the following topics: Adventure-Survival (3 titles); Autobiography-Biography (3 titles); Death (1 title); Easy Readers (8 titles); Good Reading (12 titles); Historical Fiction (10 titles); Mystery (3 titles); Newbery Award Winner, 2000; and…

  8. Bonus Activity Book.

    Science.gov (United States)

    Learning, 1993

    1993-01-01

    Elementary level activity book presents suggestions for teaching students about endangered and threatened species worldwide. Students learn about what is causing the rapid extinction rate and what needs to be done. They also discover the value of rainforests and why conservationists are fighting to save them. (SM)

  9. Books, Biodiversity, and Beyond!

    Science.gov (United States)

    Governor, Donna; Helms, Sarah

    2007-01-01

    Reading in science class does not have to be boring, but it is no secret to students or teachers that textbooks are not much fun to read. It is always a challenge for teachers to find reading materials that would grab the interests of their students. In this article, the author relates how she used Biodiversity, a nonfiction book by Dorothy…

  10. Boekbesprekinge/Book Reviews

    African Journals Online (AJOL)

    SA MEDICAL JOURNAL VOLUME 63 22 JANUARY 1983 ... Bone in clinical orthopaedics. Bone in Clinical Orthopaedics: A Study in Comparative. Osteology. ... This is oneof the more dramatic stories in the history of experimental mecticine, ... facsimile reproduction (misprints and all) of his 1833 book by. Gryphon Editions.

  11. Spoken Russian; Book Two.

    Science.gov (United States)

    Bloomfield, Leonard; Petrova, Luba

    This course in spoken Russian is intended for use in introductory conversational classes. Book II in the two volume series is divided into three major parts, each containing five learning units and one unit devoted to review. Each unit contains sections including (1) basic sentences, (2) word study and review of basic sentences, (3) listening…

  12. Book Catalog Use Study

    Science.gov (United States)

    Sacco, Concetta N.

    1973-01-01

    Technological developments of the past twenty years have resulted in renewed interest in book-form catalogs. Users were surveyed at two libraries to determine that their satisfaction with bibliographical data, entry points, and physical form. (17 references) (Author/DH)

  13. Best Books 2010

    Science.gov (United States)

    Jones, Trevelyn; Toth, Luann; Charnizon, Marlene; Grabarek, Daryl; Fleishhacker, Joy

    2010-01-01

    This article presents the 62 books chosen by "School Library Journal's" editors as the best of the year. While novels include some historical settings and contemporary concerns, it is fantasy that continues to reign supreme. More original, and more creative than ever, it includes selections that are frightening, edgy, wildly funny, electrifying,…

  14. Spoken Russian; Book Two.

    Science.gov (United States)

    Bloomfield, Leonard; Petrova, Luba

    This course in spoken Russian is intended for use in introductory conversational classes. Book II in the two volume series is divided into three major parts, each containing five learning units and one unit devoted to review. Each unit contains sections including (1) basic sentences, (2) word study and review of basic sentences, (3) listening…

  15. Bold Books for Teenagers

    Science.gov (United States)

    Gallo, Don

    2005-01-01

    "Bold Books for Teenagers" provides dynamic, informative viewpoints on important issues in publishing and teaching contemporary literature, especially literature for adolescents. Reviews of young adult literature also appear in this column. This article examines how English teachers can help students explore their interests without promoting any…

  16. Books for Summer Reading.

    Science.gov (United States)

    [Editors

    2001-01-01

    Teachers and education professors suggest various nonfiction and fiction books for summer reading enjoyment, from Robert Putnam's "Bowling Alone," C.A. Bowers's "Let Them Eat Data," and Larry McMurtry's "Roads: Driving America's Great Highways" to Kent Hauf's "Plainsong, J.M. Coetzee's "Disgrace," and Michael Cunningham's "The Hours." (MLH)

  17. The changing role of the medical illustrator?

    Science.gov (United States)

    Diedrick, M D

    1975-11-01

    The author takes issue with the claim that the role of the medical illustrator is changing today. Not so, he says. The role is the same, and the need is as great as it ever was. Rather, some medical illustrators are changing in the desire to expand their field and become "biocommunicators.' Such expansion, the author suggests, is not for everyone, and those who choose to continue in their traditional role need make no apologies. It is a vital one.

  18. Whole-book recognition.

    Science.gov (United States)

    Xiu, Pingping; Baird, Henry S

    2012-12-01

    Whole-book recognition is a document image analysis strategy that operates on the complete set of a book's page images using automatic adaptation to improve accuracy. We describe an algorithm which expects to be initialized with approximate iconic and linguistic models--derived from (generally errorful) OCR results and (generally imperfect) dictionaries--and then, guided entirely by evidence internal to the test set, corrects the models which, in turn, yields higher recognition accuracy. The iconic model describes image formation and determines the behavior of a character-image classifier, and the linguistic model describes word-occurrence probabilities. Our algorithm detects "disagreements" between these two models by measuring cross entropy between 1) the posterior probability distribution of character classes (the recognition results resulting from image classification alone) and 2) the posterior probability distribution of word classes (the recognition results from image classification combined with linguistic constraints). We show how disagreements can identify candidates for model corrections at both the character and word levels. Some model corrections will reduce the error rate over the whole book, and these can be identified by comparing model disagreements, summed across the whole book, before and after the correction is applied. Experiments on passages up to 180 pages long show that when a candidate model adaptation reduces whole-book disagreement, it is also likely to correct recognition errors. Also, the longer the passage operated on by the algorithm, the more reliable this adaptation policy becomes, and the lower the error rate achieved. The best results occur when both the iconic and linguistic models mutually correct one another. We have observed recognition error rates driven down by nearly an order of magnitude fully automatically without supervision (or indeed without any user intervention or interaction). Improvement is nearly monotonic, and

  19. BOOK REVIEW: Supergravity Supergravity

    Science.gov (United States)

    Gregory, Ruth

    2013-02-01

    Supergravity is an essential ingredient in so many areas of ultra high energy physics, yet it is rarely taught systematically, even at the graduate level. Students most often have to learn along with applying, and must use the now classic older texts. For such core material, it is surprising that there are so few good texts on the subject. It is not necessarily that supergravity is so much more conceptually complex, rather that it is technical and therefore easy for a text to become dry, dense and rather indigestible. This book, written by two experts in the field, is therefore a breath of fresh air. It not only represents a comprehensive modern overview of the subject, but achieves this with clarity, accessibility, and even humour! To paraphrase the authors, if you are not impressed by this book, you should put it down and watch television instead. It starts by reviewing, or overviewing, aspects of field theory, basic supersymmetry and gravity that will be needed for the rest of the book. This first third or so of the book is very condensed, and will not be easy to follow for those who have not encountered the material before. However, the authors acknowledge this and give plenty of suggestions for more pedagogical texts in the relevant areas, thus it does not feel overly brief. The middle section deals with the construction of supergravity, starting with basic N = 1 supergravity in 4 and 11 dimensions and gradually extending the discussion to include matter multiplets. This part of the book systematically builds up understanding and construction of models, before moving on to superconformal methods. The purpose is not to cover all supergravity theories, but to focus on a few examples in detail, and to give sufficient expertise and information for the reader to be able to deal with any other models they might need. The final part of the book deals with applications, and includes two chapters on applications in adS/CFT, which will be of most interest to new

  20. Using Picture Books in EFL College Reading Classrooms

    Science.gov (United States)

    Lee, Hsiang-Ni

    2015-01-01

    This study examined 39 Taiwanese adult EFL learners' responses to reading children's literature in a non-major freshman English class. Exposed to authentic illustrated storybooks along with a variety of literacy practices, the students' end-of-the-semester feedback has shown that they generally enjoyed the books and felt they had made progress in…

  1. Outstanding Science Trade Books for Children in 1988.

    Science.gov (United States)

    Science and Children, 1989

    1989-01-01

    Lists annotations of books based on accuracy of contents, readability, format, and illustrations. Includes number of pages in each entry, price, and availability. Topics cover animals, biographies, space science, astronomy, archaeology, anthropology, earth and life sciences, medical and health sciences, physics, technology, and engineering. (RT)

  2. Outstanding Science Trade Books for Children in 1988.

    Science.gov (United States)

    Science and Children, 1989

    1989-01-01

    Lists annotations of books based on accuracy of contents, readability, format, and illustrations. Includes number of pages in each entry, price, and availability. Topics cover animals, biographies, space science, astronomy, archaeology, anthropology, earth and life sciences, medical and health sciences, physics, technology, and engineering. (RT)

  3. Example book; Miro V3.0: fiche de cas

    Energy Technology Data Exchange (ETDEWEB)

    Donnat, Ph.; Treimany, C.; Gouedard, C.; Morice, O

    1998-06-01

    This document presents some examples which were used for debugging the code. It seemed useful to write these examples onto a book to be sure the code would not regret; to give warranties for the code`s functionality; to propose some examples to illustrate the possibilities and the limits of Miro. (author) 26 refs.

  4. Developing a Sense of Place through Books about New York

    Science.gov (United States)

    Bedford, April Whatley

    2007-01-01

    Beginning a study of literary sense of place with books about New York City makes sense because both children and adults are likely to be familiar with the city through movies, television, and advertisements, even if they have never been there. By paying close attention to the ways in which authors and illustrators convey a sense of place in these…

  5. Themes of Charlotte Zolotow's Books and Her Adult Development.

    Science.gov (United States)

    Chapman, Karen Lenz

    A study of Charlotte Zolotow's life and the themes of her children's books provides an illustration of the usefulness and problems in the application of theories of adult development, especially as they apply to women. This report of the study contains (1) discussions of Erik Erikson's and Daniel Levinson's theories of adult development; (2) a…

  6. Developing a Sense of Place through Books about New York

    Science.gov (United States)

    Bedford, April Whatley

    2007-01-01

    Beginning a study of literary sense of place with books about New York City makes sense because both children and adults are likely to be familiar with the city through movies, television, and advertisements, even if they have never been there. By paying close attention to the ways in which authors and illustrators convey a sense of place in these…

  7. Using Picture Books in EFL College Reading Classrooms

    Science.gov (United States)

    Lee, Hsiang-Ni

    2015-01-01

    This study examined 39 Taiwanese adult EFL learners' responses to reading children's literature in a non-major freshman English class. Exposed to authentic illustrated storybooks along with a variety of literacy practices, the students' end-of-the-semester feedback has shown that they generally enjoyed the books and felt they had made progress in…

  8. Book review: The Tallgrass Prairie Center guide to seed and seedling identification in the Upper Midwest

    Science.gov (United States)

    Larson, Diane L.; Galatowitsch, Susan M.

    2011-01-01

    This attractive, slim volume provides a wonderful introduction to a neglected aspect of prairie plant identification: seeds and seedlings. Williams, and the illustrator Brent Butler, take the mystery out of dichotomous keys with clear descriptions, vivid illustrations, and abundant photographs of characteristics that distinguish common, tallgrass prairie, seedlings. A botanical novice should have no problem using this book to identify seedlings in their prairie garden – presuming that they planted only those species included in the book (more on that later).

  9. Book Review: 3 Titles from A Book Apart

    Directory of Open Access Journals (Sweden)

    Nathan Mealey

    2011-07-01

    Full Text Available Three recently published books by A Book Apart, the book-publishing arm of the website A List Apart, offer concise, high-impact introductions to three tools that can be employed in facing this challenge: HTML5, CSS3, and content strategy. This article reviews the books "HTML5 For Web Designers" by Jeremy Keith; "CSS3 for Web Designers" by Dan Cederholm; and "The Elements of Content Strategy" by Erin Kissane.

  10. Going for baroque at the Escherichia coli K1 cell surface.

    Science.gov (United States)

    King, Michael R; Steenbergen, Susan M; Vimr, Eric R

    2007-05-01

    Phase variation is usually thought of as the stochastic switching between alternatively expressed ('on') and unexpressed ('off') phenotypic states. However, coupling synthesis of a monotonous homopolysaccharide to a mechanism of random but incomplete chemical modification produces almost infinite structural variation. Potentially limitless variability implies that evolution can produce highly ornate or extravagant flourishes reminiscent of the baroque style. Here, we describe an analysis of capsular polysialic acid form variation in Escherichia coli K1, demonstrating that the large number of variant structures is controlled by a single contingency locus. The mechanism for generating maximum structural diversity from maximal genetic parsimony is conferred by a simple translational switch carried on a K1-specific prophage.

  11. The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line

    DEFF Research Database (Denmark)

    Xu, Xun; Pan, Shengkai; Liu, Xin;

    2011-01-01

    Chinese hamster ovary (CHO)-derived cell lines are the preferred host cells for the production of therapeutic proteins. Here we present a draft genomic sequence of the CHO-K1 ancestral cell line. The assembly comprises 2.45 Gb of genomic sequence, with 24,383 predicted genes. We associate most...... of the assembled scaffolds with 21 chromosomes isolated by microfluidics to identify chromosomal locations of genes. Furthermore, we investigate genes involved in glycosylation, which affect therapeutic protein quality, and viral susceptibility genes, which are relevant to cell engineering and regulatory concerns....... Homologs of most human glycosylation-associated genes are present in the CHO-K1 genome, although 141 of these homologs are not expressed under exponential growth conditions. Many important viral entry genes are also present in the genome but not expressed, which may explain the unusual viral resistance...

  12. The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line

    DEFF Research Database (Denmark)

    Xu, Xun; Pan, Shengkai; Liu, Xin

    2011-01-01

    Chinese hamster ovary (CHO)-derived cell lines are the preferred host cells for the production of therapeutic proteins. Here we present a draft genomic sequence of the CHO-K1 ancestral cell line. The assembly comprises 2.45 Gb of genomic sequence, with 24,383 predicted genes. We associate most...... of the assembled scaffolds with 21 chromosomes isolated by microfluidics to identify chromosomal locations of genes. Furthermore, we investigate genes involved in glycosylation, which affect therapeutic protein quality, and viral susceptibility genes, which are relevant to cell engineering and regulatory concerns....... Homologs of most human glycosylation-associated genes are present in the CHO-K1 genome, although 141 of these homologs are not expressed under exponential growth conditions. Many important viral entry genes are also present in the genome but not expressed, which may explain the unusual viral resistance...

  13. Friedreich's Ataxia, Frataxin, PIP5K1B: Echo of a Distant Fracas

    Directory of Open Access Journals (Sweden)

    Aurélien Bayot

    2013-01-01

    Full Text Available “Frataxin fracas” were the words used when referring to the frataxin-encoding gene (FXN burst in as a motive to disqualify an alternative candidate gene, PIP5K1B, as an actor in Friedreich's ataxia (FRDA (Campuzano et al., 1996; Cossee et al., 1997; Carvajal et al., 1996. The instrumental role in the disease of large triplet expansions in the first intron of FXN has been thereafter fully confirmed, and this no longer suffers any dispute (Koeppen, 2011. On the other hand, a recent study suggests that the consequences of these large expansions in FXN are wider than previously thought and that the expression of surrounding genes, including PIP5K1B, could be concurrently modulated by these large expansions (Bayot et al., 2013. This recent observation raises a number of important and yet unanswered questions for scientists and clinicians working on FRDA; these questions are the substratum of this paper.

  14. Korean Culture as Portrayed in Young Children's Picture Books: The Pursuit of Cultural Authenticity

    Science.gov (United States)

    Wee, Su-Jeong; Park, Soyeon; Choi, Joung Sun

    2015-01-01

    The purpose of the present study is to investigate how contemporary Korea and its culture are portrayed in children's picture books published in the United States. Our analysis of the representation of Korean culture in text and illustrations was based on a sample of 33 picture books written in English and published in the US between 1990 and…

  15. Using Picture Books to Teach Fairy Tales from the Collection of the Mazza Museum

    Science.gov (United States)

    Lantz, Kate

    2005-01-01

    Picture books are the first visual arts experience many students encounter. A picture book equally emphasizes text and illustrations, and though the text often receives most of the attention, in the best cases, the pictures are excellent resources for teaching about creating and responding to images. For a resourceful teacher who knows how to use…

  16. The New Birth Order Book: Why You Are the Way You Are. Revised Edition.

    Science.gov (United States)

    Leman, Kevin

    Based on the premise that birth order powerfully influences one's personality, one's marital partner, and one's parenting style, this book presents personal anecdotes, testimonials, and descriptions of well-known individuals or individuals seen in counseling to illustrate the impact of birth order. The book also presents practical ways to take…

  17. It's So Amazing! A Book about Eggs, Sperm, Birth, Babies, and Families.

    Science.gov (United States)

    Harris, Robie H.

    This book, for children aged 7 and up, is designed to teach younger children about human biology and healthy sexuality, allowing parents and teachers to answer children's questions. Comic book style, full-color artwork illustrates the age-appropriate text and reflects an elementary school child's interest in biology and how things work. The book…

  18. It's So Amazing! A Book about Eggs, Sperm, Birth, Babies, and Families.

    Science.gov (United States)

    Harris, Robie H.

    This book, for children aged 7 and up, is designed to teach younger children about human biology and healthy sexuality, allowing parents and teachers to answer children's questions. Comic book style, full-color artwork illustrates the age-appropriate text and reflects an elementary school child's interest in biology and how things work. The book…

  19. How to Use the Comic Book as a Creative Idea to Teach History.

    Science.gov (United States)

    Chilcoat, George W.

    1988-01-01

    Discusses and gives illustrations of how to use comic books to teach history. Explores the historical background of comic books and includes detailed procedures for helping students develop their own history comics. Praises this approach as a way to enliven secondary social studies and motivate students. (GEA)

  20. Connect the Book. Martin's Big Words: The Life of Dr. Martin Luther King, Jr.

    Science.gov (United States)

    Brodie, Carolyn S.

    2005-01-01

    In honor of Martin Luther King, Jr. Day, this month's featured book is "Martin's Big Words: The Life of Dr. Martin Luther King, Jr." The book was written by Doreen Rappaport and illustrated by Bryan Collier (Jump at the Sun, 2001. 40p. ISBN 0786807148). This pictorial biography of the world-renowned civil rights leader has one of the most striking…

  1. Korean Culture as Portrayed in Young Children's Picture Books: The Pursuit of Cultural Authenticity

    Science.gov (United States)

    Wee, Su-Jeong; Park, Soyeon; Choi, Joung Sun

    2015-01-01

    The purpose of the present study is to investigate how contemporary Korea and its culture are portrayed in children's picture books published in the United States. Our analysis of the representation of Korean culture in text and illustrations was based on a sample of 33 picture books written in English and published in the US between 1990 and…

  2. Interaction of Escherichia coli K1 and K5 with Acanthamoeba castellanii Trophozoites and Cysts

    OpenAIRE

    Matin, Abdul; Jung, Suk-Yul

    2011-01-01

    The existence of symbiotic relationships between Acanthamoeba and a variety of bacteria is well-documented. However, the ability of Acanthamoeba interacting with host bacterial pathogens has gained particular attention. Here, to understand the interactions of Escherichia coli K1 and E. coli K5 strains with Acanthamoeba castellanii trophozoites and cysts, association assay, invasion assay, survival assay, and the measurement of bacterial numbers from cysts were performed, and nonpathogenic E. ...

  3. Non-Traditional Aspects of Renal Diets: Focus on Fiber, Alkali and Vitamin K1 Intake

    Science.gov (United States)

    Cupisti, Adamasco; D’Alessandro, Claudia; Gesualdo, Loreto; Cosola, Carmela; Gallieni, Maurizio; Egidi, Maria Francesca; Fusaro, Maria

    2017-01-01

    Renal diets for advanced chronic kidney disease (CKD) are structured to achieve a lower protein, phosphate and sodium intake, while supplying adequate energy. The aim of this nutritional intervention is to prevent or correct signs, symptoms and complications of renal insufficiency, delaying the start of dialysis and preserving nutritional status. This paper focuses on three additional aspects of renal diets that can play an important role in the management of CKD patients: the vitamin K1 and fiber content, and the alkalizing potential. We examined the energy and nutrients composition of four types of renal diets according to their protein content: normal diet (ND, 0.8 g protein/kg body weight (bw)), low protein diet (LPD, 0.6 g protein/kg bw), vegan diet (VD, 0.7 g protein/kg bw), very low protein diet (VLPD, 0.3 g protein/kg bw). Fiber content is much higher in the VD and in the VLPD than in the ND or LPD. Vitamin K1 content seems to follow the same trend, but vitamin K2 content, which could not be investigated, might have a different pattern. The net endogenous acid production (NEAP) value decreases from the ND and LPD to the vegetarian diets, namely VD and VLPD; the same finding occurred for the potential renal acid load (PRAL). In conclusion, renal diets may provide additional benefits, and this is the case of vegetarian diets. Namely, VD and VLPD also provide high amounts of fibers and Vitamin K1, with a very low acid load. These features may have favorable effects on Vitamin K1 status, intestinal microbiota and acid-base balance. Hence, we can speculate as to the potential beneficial effects on vascular calcification and bone disease, on protein metabolism, on colonic environment and circulating levels of microbial-derived uremic toxins. In the case of vegetarian diets, attention must be paid to serum potassium levels. PMID:28468236

  4. K1.33Mn8O16 as an electrocatalyst and a cathode

    Science.gov (United States)

    Jalili, Seifollah; Moharramzadeh Goliaei, Elham; Schofield, Jeremy

    2017-02-01

    Density functional theory (DFT) calculations are carried out to investigate the electronic, magnetic and thermoelectric properties of bulk and nanosheet K1.33Mn8O16 materials. The catalytic activity and cathodic performance of bulk and nanosheet structures are examined using the Tran-Blaha modified Becke-Johnson (TB-mBJ) exchange potential. Electronic structure calculations reveal an anti-ferromagnetic ground state, with a TB-mMBJ band gap in bulk K1.33Mn8O16 that is in agreement with experimental results. Density of state plots indicate a partial reduction of Mn4+ ions to Mn3+, without any obvious sign of Jahn-Teller distortion. Moreover, use of the O p-band center as a descriptor of catalytic activity suggests that the nanosheet has enhanced catalytic activity compared to the bulk structure. Thermoelectric parameters such as the Seebeck coefficient, electrical conductivity, and thermal conductivity are also calculated, and it is found that the Seebeck coefficients decrease with increasing temperature. High Seebeck coefficients for both spin-up and spin-down states are found in the nanosheet relative to their value in the bulk K1.33Mn8O16 structure, whereas the electrical and thermal conductivity are reduced relative to the bulk. In addition, figures of merit values are calculated as a function of the chemical potential and it is found that the nanosheet has a figure of merit of 1 at room temperature, compared to 0.5 for the bulk material. All results suggest that K1.33Mn8O16 nanosheets can be used both as a material in waste heat recovery and as an electrocatalyst in fuel cells and batteries.

  5. Learning about Marine Biology. Superific Science Book VI. A Good Apple Science Activity Book for Grades 5-8+.

    Science.gov (United States)

    Conway, Lorraine

    Based on the assumption that most students have a natural curiosity about the plant and animal life residing in the oceans, this document provides students in grades five through eight with activities in marine biology. The book provides illustrated information and learning activities dealing with: (1) diatoms; (2) the life cycle of the jellyfish;…

  6. The Burden of the Book

    DEFF Research Database (Denmark)

    Damkjær, Maria

    2012-01-01

    Review of Leah Price, How to Do Things with Books in Victorian Britain (Princeton University Press, 2012)......Review of Leah Price, How to Do Things with Books in Victorian Britain (Princeton University Press, 2012)...

  7. Exploring Cultural Diversity (Children's Books).

    Science.gov (United States)

    Galda, Lee; Cotter, Janet

    1992-01-01

    Reviews 57 children's books, combining realistic fiction, nonfiction, poetry, literary folklore, and folklore from people and places around the world, that reveal the cultural wonders of the world. Offers suggestions on how to group these books within thematic units. (MG)

  8. Moving from Books to Bytes.

    Science.gov (United States)

    Albanese, Andrew Richard

    2001-01-01

    This academic library book buying survey examines full-text databases; electronic journals; top circulating subjects; price increases for serials and resulting subscription cuts; the influence of digital choices on purchasing decisions; circulation versus use statistics; and electronic books. (LRW)

  9. Exploring Cultural Diversity (Children's Books).

    Science.gov (United States)

    Galda, Lee; Cotter, Janet

    1992-01-01

    Reviews 57 children's books, combining realistic fiction, nonfiction, poetry, literary folklore, and folklore from people and places around the world, that reveal the cultural wonders of the world. Offers suggestions on how to group these books within thematic units. (MG)

  10. TM4Book: Visualization transforms

    DEFF Research Database (Denmark)

    2011-01-01

    XSLT-scripts til visualisering af semantiske strukturer i teksteditoren TM4Book: plot, storyline og timeline......XSLT-scripts til visualisering af semantiske strukturer i teksteditoren TM4Book: plot, storyline og timeline...

  11. The Picture Book of Quantum Mechanics

    CERN Document Server

    Brandt, Siegmund

    2012-01-01

    The aim of this book is to explain the basic concepts and phenomena of quantum mechanics by means of visualization. Computer-generated illustrations in color are used extensively throughout the text, helping to establish the relation between quantum mechanics—wave functions, interference, atomic structure, and so forth—and classical physics—point mechanics, statistical mechanics, and wave optics. Even more important, by studying the pictures in parallel with the text, readers develop an intuition for such notoriously abstract phenomena as • the tunnel effect • excitation and decay of metastable states • wave-packet motion within a well • systems of distinguishable and indistinguishable particles • free wave packets and scattering in 3 dimensions • angular-momentum decomposition • stationary bound states in various 3-dimensional potentials • hybrid states • Kepler motion of wave packets in the Coulomb field • spin and magnetic resonance Illustrations from experiments in a variety of f...

  12. BOOK REVIEW: The Current Comparator

    Science.gov (United States)

    Petersons, Oskars

    1989-01-01

    This 120-page book is a concise, yet comprehensive, clearly-written and well-illustrated monograph that covers the subject matter from basic principles through design, construction and calibration details to the principal applications. The book will be useful, as a primer, to the uninitiated and, as a reference book to the practitioner involved with transformer-type ratio devices. The length of the book and the style of presentation will not overburden any informed reader. The described techniques and the cited references are primarily from the work at the National Research Council, Canada (NRC). Any omissions, however, are not serious with respect to coverage of the subject matter, since most of the development work has been done at NRC. The role of transformers and transformer-like devices for establishing accurate voltage and current ratios has been recognized for over half a century. Transformer techniques were much explored and developed in the fifties and sixties for accuracy levels suitable for standards laboratories. Three-winding voltage transformers were developed for scaling of impedances in connection with the calculable Thompson Lampard capacitor; three-winding current transformers or current comparators were initially explored for the calibration of current transformers and later for specialized impedance measurements. Extensive development of the current comparator and its applications has been and is still being conducted at the NRC by a team that was started and, until his retirement, led by N L Kusters. The team is now led by W J M Moore. He and P N Miljanic, the authors of this book, have had the principal roles in the development of the current comparator. It is fortunate for the field of metrology that considerabe resources and a talented group of researchers were available to do this development along with mechanisms that were available to transfer this technology to a private sector instrument manufacturer and, thus, disseminate it world wide

  13. Best in show [artists' book

    OpenAIRE

    Wood, Philippa

    2011-01-01

    This limited edition artists' book explores the phenomenon of prize vegetable growing. Each replica seed packet is over-printed with data that relates to a current world record holder. Further facts appear on the back to help put the statistics into context. The book was produced for a 'call for entries' to submit books that responded to the theme of 'crop'. Concertina book – machine stitched. Printed inkjet, letterpress, typewriter.

  14. Illustrations of the Relativistic Conservation Law for the Center of Energy

    CERN Document Server

    Boyer, T H

    2005-01-01

    The relativistic conservation law involving the center of energy is reviewed and illustrated using simple examples from classical electromagnetic theory. It is emphasized that this conservation law is parallel to the conservation laws for energy, linear momentum, and energy, in arising from the generators of the Poincare group for electromagnetic theory; yet this relativistic law reflecting the continuous flow of energy goes virtually unmentioned in the text books. The illustrations here present situations both where external forces are present and are absent. The cases of a parallel plate capacitor, a flattened slip-joint solenoid, and two interacting charges are included.

  15. Level up Book Club

    Science.gov (United States)

    LaGarde, Jennifer; Winner, Matthew C.

    2012-01-01

    Like all great ideas, Level Up Book Club grew out of a genuine need, the spontaneous firing of a few brain sparks, and the kind of luck that comes from being "in the right place at the right time." By mid-June 2011 the authors were already "bona fide" wonder twins--two educators who, although they'd never met, had stumbled upon each other through…

  16. The Delights of Books

    Institute of Scientific and Technical Information of China (English)

    徐保国

    2005-01-01

    Books are to mankind what memory is to the individual.They contain the history of our race,the discoveries we have made,the accumulated knowledge and experience of ages;they picture for us the marvels and beauties of nature,help us in our difficulties, comfort us in sorrow and in suffering,change hours of weariness into moments of delight,store our minds with ideas,

  17. Book Reviews Volume 3

    OpenAIRE

    2016-01-01

    Book Reviews Denis McQuail Media Performance: Mass Communication and the Public Interest, Reviewed by Farrel Corcoran. James Donald, Sentimental Education: Schooling, Popular Culture and the Regulation of Liberty London, Reviewed by Sheelagh Drudy Robert Chapman Selling The Sixties: The Pirates and Pop Music Radio, Reviewed by Pat Dunne Bob Franklin, ed. Televising Democracies with a foreword by Bernard Weatherhill , Reviewed by Brian Farrell Tim Congdon et al Paying for Broadc...

  18. The Pricing of Economics Books.

    Science.gov (United States)

    Laband, David; Hudson, John

    2003-01-01

    Examines the pricing and other characteristics of books. Notes substantial increases in book prices between 2000 and 1985 data. Suggests a major factor is the increasing importance of foreign presses that sell books at higher prices. Indicates that discount on paperbacks appear to have been relatively stable in the two years studied. (JEH)

  19. Carter G. Woodson Book Awards.

    Science.gov (United States)

    Social Education, 2000

    2000-01-01

    Presents the recipients of the 1999 Carter G. Woodson book awards that honor books focusing on ethnic minorities and race relations that are appropriate for elementary and secondary levels. Includes books that cover topics such as life for Japanese Americans in internment camps and lives of 12 black women. (CMK)

  20. The Real E-books.

    Science.gov (United States)

    Ditlea, Steve

    2000-01-01

    Focuses on the "real" e-books. Discusses Stephen King's novella released exclusively for electronic publication, and discusses experiences of another author writing on a specialized subject. Presents a brief background of e-books. Examines the differences between Portable Document Format (PDF) technology and the new Open eBook (OEB) standard.…