WorldWideScience

Sample records for jt8d-9 9a 11

  1. 75 FR 62319 - Airworthiness Directives; Pratt & Whitney JT8D-9, -9A, -11, -15, -17, and -17R Turbofan Engines

    Science.gov (United States)

    2010-10-08

    ... the AD Docket You may examine the AD docket on the Internet at http://www.regulations.gov ; or in... visit definition in paragraph (i) of the proposed AD. Specifically, clarify whether a gearbox removal or gearbox change would fit into the shop visit definition. Also, that we clarify that a nose cowl removal...

  2. Metaheuristic and Machine Learning Models for TFE-731-2, PW4056, and JT8D-9 Cruise Thrust

    Science.gov (United States)

    Baklacioglu, Tolga

    2017-08-01

    The requirement for an accurate engine thrust model has a major antecedence in airline fuel saving programs, assessment of environmental effects of fuel consumption, emissions reduction studies, and air traffic management applications. In this study, utilizing engine manufacturers' real data, a metaheuristic model based on genetic algorithms (GAs) and a machine learning model based on neural networks (NNs) trained with Levenberg-Marquardt (LM), delta-bar-delta (DBD), and conjugate gradient (CG) algorithms were accomplished to incorporate the effect of both flight altitude and Mach number in the estimation of thrust. For the GA model, the analysis of population size impact on the model's accuracy and effect of number of data on model coefficients were also performed. For the NN model, design of optimum topology was searched for one- and two-hidden-layer networks. Predicted thrust values presented a close agreement with real thrust data for both models, among which LM trained NNs gave the best accuracies.

  3. 17 CFR 250.11 - Certain acquisitions by affiliates exempted from section 9(a)(2).

    Science.gov (United States)

    2010-04-01

    ... United States: Provided, That the acquiring company is not an affiliate under section 2(a)(11)(A) of the... AND EXCHANGE COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT... section 9(a)(2). (a) Acquisitions by certain exempt holding companies. Any holding company which is...

  4. PDE9A, PDE10A, and PDE11A expression in rat trigeminovascular pain signalling system

    DEFF Research Database (Denmark)

    Kruse, Lars S; Møller, Morten; Tibaek, Maiken

    2009-01-01

    Activation of the trigeminovascular pain signalling system, including cerebral arteries, meninges, trigeminal ganglion, and brain stem, is involved in migraine. Furthermore, stimulation of cyclic nucleotide (cAMP and cGMP) production as well as inhibition of phosphodiesterases (PDEs) induces head......, the expression of PDE9A, PDE10A, and PDE11A in the trigeminovascular system. The functional implications are yet unknown, but their localisation indicates that they may have a role in the pain pathway of migraine as well as trigeminal neuralgia and trigeminal autonomic cephalalgias....

  5. Elastic scattering and breakup of 11Be on deuterons at 26.9 A MeV

    Science.gov (United States)

    Chen, J.; Lou, J. L.; Ye, Y. L.; Rangel, J.; Moro, A. M.; Pang, D. Y.; Li, Z. H.; Ge, Y. C.; Li, Q. T.; Li, J.; Jiang, W.; Sun, Y. L.; Zang, H. L.; Zhang, Y.; Aoi, N.; Ideguchi, E.; Ong, H. J.; Lee, J.; Wu, J.; Liu, H. N.; Wen, C.; Ayyad, Y.; Hatanaka, K.; Tran, T. D.; Yamamoto, T.; Tanaka, M.; Suzuki, T.; Nguyen, T. T.

    2016-12-01

    The elastic scattering and breakup reactions of the halo nucleus 11Be on deuterons at an incident energy of 26.9 A MeV are reported for the first time. Special attention has been paid to the determination and subtraction of the proton contaminations in the deuterated polyethylene (CD2)n target (where D2 denotes H22 ). The cross sections for elastic scattering are analyzed with the systematic optical potentials of Daehnick et al. and DA1p, as well as with single-folding potentials, derived from the Jeukenne-Lejeune-Mahaux effective nucleon-nucleon interaction. An extended version of the continuum-discretized coupled-channels (XCDCC) formalism, including dynamic core excitation (DCX) effects, is applied to analyze the elastic scattering and breakup data. Comparisons of the full XCDCC calculation with that omitting DCX effects indicate that the core excitation plays a remarkable role in reproducing breakup reactions of 11Be+d .

  6. Regulation of chondroitin-4-sulfotransferase (CHST11) expression by opposing effects of arylsulfatase B on BMP4 and Wnt9A.

    Science.gov (United States)

    Bhattacharyya, Sumit; Feferman, Leo; Tobacman, Joanne K

    2015-03-01

    In this report, the gene regulatory mechanism by which decline in arylsulfatase B (ARSB; N-acetylgalactosamine-4-sulfatase) reduces CHST11 (chondroitin-4-sulfotransferase; C4ST) mRNA expression in human colonic epithelial cells and in colonic epithelium of ARSB-deficient mice is presented. ARSB controls the degradation of chondroitin 4-sulfate (C4S) by removing the 4-sulfate group at the non-reducing end of the C4S chain, but has not previously been shown to affect C4S biosynthesis. The decline in CHST11 expression following ARSB reduction is attributable to effects of ARSB on bone morphogenetic protein (BMP)4, since BMP4 expression and secretion declined when ARSB was silenced. Inhibition of BMP4 by neutralizing antibody also reduced CHST11 expression. When C4S was more sulfated due to decline in ARSB, more BMP4 was sequestered by C4S in the cell membrane, and CHST11 expression declined. Exogenous recombinant BMP4, acting through a phospho-Smad3 binding site in the CHST11 promoter, increased the mRNA expression of CHST11. In contrast to the decline in BMP4 that followed decline in ARSB, Wnt9A mRNA expression was previously shown to increase when ARSB was silenced and C4S was more highly sulfated. Galectin-3 bound less to the more highly sulfated C4S, leading to increased nuclear translocation and enhanced galectin-3 interaction with Sp1 in the Wnt9A promoter. Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter through the pSmad3 binding site. These findings suggest that cellular processes mediated by differential effects of Wnt9A and BMP4 can result from opposing effects on CHST11 expression.

  7. Primary erythermalgia as a sodium channelopathy: screening for SCN9A mutations: exclusion of a causal role of SCN10A and SCN11A.

    NARCIS (Netherlands)

    Drenth, J.P.H.; Morsche, R.H.M. te; Mansour, S.; Mortimer, P.S.

    2008-01-01

    OBJECTIVES: To elucidate the rate of missense mutations in the SCN9A gene (which encodes sodium channel Na(v)1.7) (OMIM 603415) among patients with primary erythermalgia and to examine the possibility that other sodium channels can cause the disease. DESIGN: Case series. SETTING: Department of Medic

  8. Primary erythermalgia as a sodium channelopathy: screening for SCN9A mutations: exclusion of a causal role of SCN10A and SCN11A.

    NARCIS (Netherlands)

    Drenth, J.P.H.; Morsche, R.H.M. te; Mansour, S.; Mortimer, P.S.

    2008-01-01

    OBJECTIVES: To elucidate the rate of missense mutations in the SCN9A gene (which encodes sodium channel Na(v)1.7) (OMIM 603415) among patients with primary erythermalgia and to examine the possibility that other sodium channels can cause the disease. DESIGN: Case series. SETTING: Department of Medic

  9. Low temperature transport and thermodynamic properties of the Zintl compound Yb{sub 11}AlSb{sub 9}: A new Kondo lattice semiconductor

    Energy Technology Data Exchange (ETDEWEB)

    Magnavita, E.T. [CCNH, Universidade Federal do ABC (UFABC), Santo André, SP, 09210-580 (Brazil); Rettori, C. [CCNH, Universidade Federal do ABC (UFABC), Santo André, SP, 09210-580 (Brazil); Instituto de Física “Gleb Wataghin”, UNICAMP, Campinas, SP, 13083-970 (Brazil); Osorio-Guillén, J.M. [Instituto de Física, Universidad de Antioquia UdeA, Calle 70 No 52-21, Medellín (Colombia); Ferreira, F.F.; Mendonça-Ferreira, L.; Avila, M.A.; Ribeiro, R.A. [CCNH, Universidade Federal do ABC (UFABC), Santo André, SP, 09210-580 (Brazil)

    2016-06-05

    A thorough transport and thermodynamic investigation of flux-grown single crystals of the ternary Zintl phase Yb{sub 11} AlSb{sub 9}, combined with first-principles density functional theory calculations, shows that this compound is a metal above T ≈ 100 K and a semiconductor with small hybridization gap at low-T. The general behavior resembles those of Kondo lattice semiconductors, although some of the measured properties are strongly sample dependent, as often seen in hybridized f-electron materials. We thus suggest that Yb{sub 11} AlSb{sub 9} can be considered as a new Yb-based Kondo lattice semiconductor joining the family of strongly correlated electron systems. - Highlights: • First characterization at low temperatures of Yb{sub 11}AlSb{sub 9}. • Yb{sub 11}AlSb{sub 9} has a small, field dependent hybridization gap at low-T. • Yb{sub 11}AlSb{sub 9} can be considered as a new Kondo lattice semiconductor.

  10. 3,3-Dimethyl-cis-9a,13a-diphenyl-2,3,9a,11,12,13a-hexahydro-1H-benzo[h][1,4]dioxino[2′,3′:5,6][1,4]dioxino[2,3-f]chromene

    Directory of Open Access Journals (Sweden)

    Bauer O. Bernardes

    2013-09-01

    Full Text Available In the title dihydrodioxin, C31H28O5, the dioxane ring has a chair conformation, whereas each of the pyran and dioxine rings has an envelope conformation with methylene and quaternary C atoms, respectively, being the flap atoms. The phenyl rings are cis and form a dihedral angle of 82.11 (10°. The molecular structure is stabilized by C—H...O contacts. In the crystal packing, supramolecular layers parallel to (101 are sustained by C—H...π interactions.

  11. Free-throw accuracy and success as a function of ball weight in 9- to 11-year-old male players Precisão e êxito em função do peso da bola em jogadores de 9 a 11 anos de idade

    Directory of Open Access Journals (Sweden)

    José Luis Arias

    2012-06-01

    Full Text Available The goal of this study was to analyze whether 9-11 years old children can attain more free-throw accuracy and success by modifying the ball weight in basketball game. The participants were 54 children (age: mean=10.63, SD=0.55 years from six basketball teams. The participants played four games with each of the following balls: (a standard ball weight (485 g, 69-71 cm, (b a lighter ball (440 g, 69-71 cm, and (c a heavier ball (540 g, 69-71 cm. The procedures adopted in the study were: (a defining the variables, (b instructing the observers and obtaining reliability, (c monitoring the properties of the ball and filming the games, and (d recording the data from the observation. The results revealed statistically significant differences for free-throw accuracy (χ²=1.76, df=2, p=.050 and success (χ²=5.69, df=2, p=.048. Free-throw accuracy and success were higher with the 440-g ball than with the 540-g ball.O objetivo deste estudo foi analisar se crianças de 9 a 11 anos poderiam alcançar maior precisão e êxito no lance livre em função de diferentes pesos da bola no basquetebol. Participaram do presente estudo 54 crianças (idade: M=10.63, SD=0.55 de seis equipes de basquetebol. Os participantes jogaram quatro jogos com cada um das seguintes bolas: (a bola regulamentar (485 g, 69-71 cm, (b bola menos pesada (440 g, 69-71 cm, e (c bola mais pesada (540 g, 69-71 cm. Os procedimentos seguidos foram: (a definição das variáveis, (b formação dos observadores e obtenção da confiabilidade, (c controle das propriedades da bola e filmagem dos jogos, e (d gravação dos dados de observação. Os resultados revelaram diferenças estatísticas significativas para precisão (χ²=1,76; df=2; p=0,05 e êxito do lance livre (χ²=5,69; df=2; p=0,048. A precisão e êxito do lance livre foram mais elevados com a bola de 440 g em comparação com a bola de 540 g.

  12. Major earthquake of Friday March 11, 2011, magnitude 8.9 at 5:46 UT, off Honshu island (Japan); Seisme majeur au large de l'Ile d'Honshu (Japon) du vendredi 11 mars 2011 Magnitude = 8,9 a 5h46 (TU)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    On Friday March 11, 2011, at 5:46 UT (2:46 PM local time), a magnitude 8.9 earthquake took place at 80 km east of Honshu island (Japan). The earthquake affected a large part of the Honshu territory and led to the automatic emergency shutdown of all nuclear power plants of the east coast. This paper recalls first the seismo-tectonic and historical seismic context of the Japan archipelago and the first analyses of the Tohoku earthquake impact on nuclear facilities. At the time of publication of this information report, no radioactive release in the environment and no anomaly at the Tokai-Mura and Rokkasho-Mura sites were mentioned. However, the evacuation of populations in a 3 to 10 km area around the Fukushima-Dai-ichi power plant had been ordered by the Governor as preventive measure, which made one think that the situation at this specific site was particularly worrying. (J.S.)

  13. Diagnóstico Estructural a Través de la Prueba Persona Bajo la Lluvia en Niños y Niñas de 9 a 11 Años de Edad, Víctimas de Agresiones Sexuales Crónicas Structural Diagnosis Using the Person in Rain Test in Children 9 to 11 Years old, Victims of Chronic Sexual Abuse

    Directory of Open Access Journals (Sweden)

    Alejandro Pool

    2007-11-01

    Full Text Available La presente investigación consistió en establecer el diagnóstico estructural, a la luz de la teoría de las relaciones objétales de Otto Kernberg, en niños y niñas de 9 a 11 años de edad, víctimas de agresiones sexuales crónicas a través de la prueba proyectiva gráfica Persona Bajo la Lluvia. Se efectuó una comparación con un grupo control constituido por niños y niñas de los cuales no se tenía la sospecha de que hubieran sido agredidos sexualmente. Los resultados obtenidos confirmaron la hipótesis propuesta de que los niños y niñas victimizados sexualmente presentarían en mayor medida una organización limítrofe de la personalidad, en relación a los niños de los que no se tenía la sospecha de que hubieran sido vulnerados en sus derechos sexuales.This study aimed to determine structural diagnosis in light of Otto Kernberg's object relations theory, in children from 9 to 11 years old, victims of chronic sexual abuse throught the proyective test Person in Rain. These results were compared with a control group conformed by boys and girls who, presumably, were not victims of sexual abuse. The obtained results confirm the proposed hypothesis that sexually victimized children will tend to show a borderline organization compared to the control group.

  14. 22 CFR 9a.4 - Classification.

    Science.gov (United States)

    2010-04-01

    ... State shall follow the standards in E.O. 11652 and the provisions of 22 CFR 9.5 through 9.8. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Classification. 9a.4 Section 9a.4 Foreign... ENERGY PROGRAMS; RELATED MATERIAL § 9a.4 Classification. (a) Section 1 of E.O. 11932, August 4,...

  15. 22 CFR 9a.7 - Access.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Access. 9a.7 Section 9a.7 Foreign Relations... PROGRAMS; RELATED MATERIAL § 9a.7 Access. (a) Except as set forth in this section, access to information or... appropriate officer of the Department to be trustworthy and to have a need for access to the...

  16. GF11

    Science.gov (United States)

    Beetem, J.; Denneau, M.; Weingarten, D.

    1986-06-01

    GF11 is a parallel processor currently under construction at the IBM Yorktown Research Center. The machine incorporates 576 floating-point boards. Each board has space for 2 × 106 bytes of memory and is capable of 2 × 107 floating point operations per second, given the total machine a peak of 1.15 × 109 bytes of memory and 1.15× 1010 floating point operations per second. The floating-point processors are interconnected by a dynamically reconfigurable switching network. At each machine cycle any of 1024 preselected permutations of data can be realized among the processors. The main intended application of GF11 is a class of calculations arising from quantum chormodynamics.

  17. Autonomic dysfunction in SCN9A-associated primary erythromelalgia.

    Science.gov (United States)

    Kim, Min-Kyeong; Yuk, Ji-Won; Kim, Hyang-Sook; Park, Ki-Jong; Kim, Dae-Seong

    2013-04-01

    Primary erythromelalgia (EM) is an autosomal dominant disorder caused by mutations of SCN9A. It is clinically characterized by reddish discoloration and episodic burning sensation of distal extremities triggered by warmth. We report a 49-year-old male with primary EM caused by SCN9A mutation (p.F216S), in whom an autonomic reflex screening test revealed a mild sudomotor dysfunction.

  18. Alternative Splicing of G9a Regulates Neuronal Differentiation

    Directory of Open Access Journals (Sweden)

    Ana Fiszbein

    2016-03-01

    Full Text Available Chromatin modifications are critical for the establishment and maintenance of differentiation programs. G9a, the enzyme responsible for histone H3 lysine 9 dimethylation in mammalian euchromatin, exists as two isoforms with differential inclusion of exon 10 (E10 through alternative splicing. We find that the G9a methyltransferase is required for differentiation of the mouse neuronal cell line N2a and that E10 inclusion increases during neuronal differentiation of cultured cells, as well as in the developing mouse brain. Although E10 inclusion greatly stimulates overall H3K9me2 levels, it does not affect G9a catalytic activity. Instead, E10 increases G9a nuclear localization. We show that the G9a E10+ isoform is necessary for neuron differentiation and regulates the alternative splicing pattern of its own pre-mRNA, enhancing E10 inclusion. Overall, our findings indicate that by regulating its own alternative splicing, G9a promotes neuron differentiation and creates a positive feedback loop that reinforces cellular commitment to differentiation.

  19. Mutations in SCN9A, encoding a sodium channel alpha subunit, in patients with primary erythermalgia.

    Science.gov (United States)

    Yang, Y; Wang, Y; Li, S; Xu, Z; Li, H; Ma, L; Fan, J; Bu, D; Liu, B; Fan, Z; Wu, G; Jin, J; Ding, B; Zhu, X; Shen, Y

    2004-03-01

    Primary erythermalgia is a rare autosomal dominant disease characterised by intermittent burning pain with redness and heat in the extremities. A previous study established the linkage of primary erythermalgia to a 7.94 cM interval on chromosome 2q, but the causative gene was not identified. We performed linkage analysis in a Chinese family with primary erythermalgia, and screened the mutations in the two candidate genes, SCN9A and GCA, in the family and a sporadic patient. Linkage analysis yielded a maximum lod score of 2.11 for both markers D2S2370 and D2S2330. Based on critical recombination events in two patients in the family, we further limited the genetic region to 5.98 cM between D2S2370 and D2S2345. We then identified two missense mutations in SCN9A in the family (T2573A) and the sporadic patient (T2543C). Our data suggest that mutations in SCN9A cause primary erythermalgia. SCN9A, encoding a voltage-gated sodium channel alpha subunit predominantly expressed in sensory and sympathetic neurones, may play an important role in nociception and vasomotor regulation.

  20. Two novel SCN9A mutations causing insensitivity to pain.

    Science.gov (United States)

    Nilsen, K B; Nicholas, A K; Woods, C G; Mellgren, S I; Nebuchennykh, M; Aasly, J

    2009-05-01

    The sensation of pain is important and there may be serious consequences if it is missing. Recently, the genetic basis for a channelopathy characterised by a congenital inability to experience pain has been described and channelopathy-associated insensitivity to pain has been proposed as a suitable name for this condition. Different mutations in the SCN9A gene causing loss of function of the voltage-gated sodium channel Nav1.7 have been reported in patients with this rare disease. Here we describe a woman with insensitivity to pain with two novel mutations in the SCN9A gene, coding for the Nav1.7 channel. We also discuss the finding of anosmia which apparently is a common feature in these patients.

  1. Secondary Metabolites of Aspergillus sp. CM9a, an E ndophytic Fungus of Cephalotaxus mannii

    Directory of Open Access Journals (Sweden)

    Heng Xue

    2012-01-01

    Full Text Available Eleven compounds belonging to eight structure types, namely cyclopentenedione (1, diketopiperazines (2, 9, 10, lactone (3, benzophenone (4, 5, terpene (6, anthraquinone (7, diphenyl ethers (10, and alkaloid (11 were isolated from the cultivation extract of the strain Aspergillus sp. CM9a, which was isolated from the stems of Cephalotaxus mannii. Among them, compounds 1, 2, and 3 were determined to b e new ones on the basis of spectroscopic data including 1D- and 2D - NMR experiments and HR Q-TOF MS. The structures of the eight known compounds were characterized based on their NMR data and by comparison with those reported.

  2. TU-A-9A-11: Gold Nanoparticles Enhanced Diffuse Optical Tomography: A Proof of Concept Study

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Y; Dogan, N [Department of Radiation Oncology, University of Miami School of Medicine, Miami, FL (United States)

    2014-06-15

    Purpose: To investigate the feasibility and potential of gold nanoparticles (GNP) enhanced diffuse optical tomography (DOT) as a novel imaging strategy for tumor detection. Methods: Simulation was performed on a digital homogeneous cylindrical phantom of 30mm×30mm. Gold nanorods (GNR) with aspect ratio 3.9 and effective radius 21.86nm were used as contrast agent. The peak light absorption for these GNR occurs at 842nm within the near-infrared region, with the absorption cross-section of 1.97×10{sup -14}m{sup -2} and scatter cross-section of 1.07×10{sup -14}m{sup -2}. A 6mmdiameter sphere of GNR solution was positioned inside the tissue-simulating phantom. Simulations were performed at the GNR concentration level of 1nM, 100pM and 10pM, respectively. The points representing laser sources and light detectors were around the phantom with 30o apart tangentially and 1mm apart axially for 9 rows. As one point being source, all the other points within the current row and nearby four rows become detectors. Hence there are 108 source points in total and 55 detector points corresponding to each source. Forward light transport at 842nm wavelength was run on a three-dimensional mesh of 33186 nodes (∼0.5mm resolution) to acquire the light emission data. Reconstruction was performed on a coarse mesh of 19408 nodes (∼1mm resolution) with ∼20minutes on a 2.4GHz CPU and 8GB RAM computer. Results: The position of the GNR solution at 1nM, 100pM and 10pM concentration was reconstructed, respectively, with <1mm error. The GNR concentration was interpreted from the reconstructed absorption coefficient within the enhanced volume. The reconstructed maximum concentrations were 0.3nM, 120.0pM, and 5.3pM, respectively. Conclusion: To the best of our knowledge, this is the first time to apply GNP to enhance DOT. The simulation results showed the high sensitivity of GNP enhanced DOT, which is in pM concentration level, compared to the μM level for MRI agents and nM level for PET agents.

  3. A sodium channel gene SCN9A polymorphism that increases nociceptor excitability.

    Science.gov (United States)

    Estacion, Mark; Harty, T Patrick; Choi, Jin-Sung; Tyrrell, Lynda; Dib-Hajj, Sulayman D; Waxman, Stephen G

    2009-12-01

    Sodium channel Na(V)1.7, encoded by the SCN9A gene, is preferentially expressed in nociceptive primary sensory neurons, where it amplifies small depolarizations. In studies on a family with inherited erythromelalgia associated with Na(V)1.7 gain-of-function mutation A863P, we identified a nonsynonymous single-nucleotide polymorphism within SCN9A in the affected proband and several unaffected family members; this polymorphism (c. 3448C&T, Single Nucleotide Polymorphisms database rs6746030, which produces the amino acid substitution R1150W in human Na(V)1.7 [hNa(V)1.7]) is present in 1.1 to 12.7% of control chromosomes, depending on ethnicity. In this study, we examined the effect of the R1150W substitution on function of the hNa(V)1.7 channel, and on the firing of dorsal root ganglion (DRG) neurons in which this channel is normally expressed. We show that this polymorphism depolarizes activation (7.9-11mV in different assays). Current-clamp analysis shows that the 1150W allele depolarizes (6mV) resting membrane potential and increases ( approximately 2-fold) the firing frequency in response to depolarization in DRG neurons in which it is present. Our results suggest that polymorphisms in the Na(V)1.7 channel may influence susceptibility to pain.

  4. Data of evolutionary structure change: 1BKGC-1GD9A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BKGC-1GD9A 1BKG 1GD9 C A MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAG...EPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTP-EETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLP...528 1GD9 A 1GD9A 1GD9 A 1GD9A HIS CA 377 THR CA 466 1GD

  5. Data of evolutionary structure change: 1ELTA-2FO9A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ELTA-2FO9A 1ELT 2FO9 A A VVGGRVAQPNSWPWQISLQYKSGSSYYHTCGGSLIRQGW...VGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPY... EEEEEEEEEE EEEEEEGG HHHHHHHH 0 1ELT... A 1ELTA

  6. Partial deletion 11q

    DEFF Research Database (Denmark)

    Hertz, Jens Michael; Tommerup, N; Sørensen, F B;

    1995-01-01

    We describe the cytogenetic findings and the dysmorphic features in a stillborn girl with a large de novo terminal deletion of the long arm of chromosome 11. The karyotype was 46,XX,del(11)(q21qter). By reviewing previous reports of deletion 11q, we found that cleft lip and palate are most...

  7. Intelligent Autonomous Systems 11: IAS-11

    NARCIS (Netherlands)

    Christensen, H.I.; Groen, F.; Petriu, E.

    2010-01-01

    This volume contains the proceedings of the eleventh International Conference on Intelligent Autonomous Systems (IAS-11) at the University of Ottawa in Canada. As ever, the purpose of the IAS conference is to bring together leading international researchers with an interest in all aspects of the

  8. Data of evolutionary structure change: 1BKGD-1GD9A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BKGD-1GD9A 1BKG 1GD9 D A MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAG...EPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTP-EETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLP...hain>D 1BKGD LSVTP-EETIV ...29 1GD9 A 1GD9A 1BKG D 1BKGD

  9. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  10. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  11. Determination of 9-Deoxo-9a-Aza-9a-Homoerythromycin A and Related Substances by High-Performance Liquid Chromatography

    Institute of Scientific and Technical Information of China (English)

    SHI Ying; YAO Guo-wei; OU Yu-xiang; MA Min

    2005-01-01

    A high-performance liquid chromatography(HPLC) method was developed and validated for the assay of 9-deoxo-9a-aza-9a-homoerythromycin A and related substances that might coexist in products as impurities that originate from the synthesis processes. A chromatographic system comprising an ODS 150 mm ×4.6 mm I.D. column, a mobile phase of cetonitrile monobasic potassium phosphate buffer (25/75), a flow rate of 1.2 mL/min, a temperature of 30 ℃ and a UV detector set at 205 nm has shown good chromatographic separation for 9-deoxo-9a-aza-9a-homoerythromycin A and other related substances. The linearity of the calibration curves, the precision, expressed as relative standard deviations, of the HPLC method have been studied. The HPLC method under study was found to be specific, precise, accurate and reproducible, indicating stability.

  12. 22q11-deletionssyndrom

    DEFF Research Database (Denmark)

    Olesen, Charlotte; Agergaard, Peter; Boers, Maria

    2010-01-01

    22q11 deletion syndrome (formerly named CATCH22, DiGeorge, Velo-Cardio-Facial, Caylor, Kinouchi and Shprintzen syndrome) occurs in approximately 1/2000 to 4000 children. The genetic lesion is remarkably uniform, occurring mainly as 3 or 1.5 MB deletions in the 22q11.2 region. However, the clinical...

  13. The GF11 supercomputer

    Science.gov (United States)

    Beetem, J.; Denneau, M.; Weingarten, D.

    1987-01-01

    GF11 is a parallel computer currently under construction at the IBM Yorktown Research Center. The machine incorporates 576 floating-point processors arranged in a modified SIMD architecture. Each has space for 2 Mbytes of memory and is capable of 20 Mflops, giving the total machine a peak of 1.125 Gbytes of memory and 11.52 Gflops. The floating-point processors are interconnected by a dynamically reconfigurable non-blocking switching network. At each machine cycle any of 1024 pre-selected permutations of data can be realized among the processors. The main intended application of GF11 is a class of calculations arising from quantum chromodynamics.

  14. Tetratricopeptide repeat domain 9A is an interacting protein for tropomyosin Tm5NM-1

    Directory of Open Access Journals (Sweden)

    Ho Gay

    2008-08-01

    Full Text Available Abstract Background Tetratricopeptide repeat domain 9A (TTC9A protein is a recently identified protein which contains three tetratricopeptide repeats (TPRs on its C-terminus. In our previous studies, we have shown that TTC9A was a hormonally-regulated gene in breast cancer cells. In this study, we found that TTC9A was over-expressed in breast cancer tissues compared with the adjacent controls (P Methods Breast samples from 25 patients including the malignant breast tissues and the adjacent normal tissues were processed for Southern blot analysis. Yeast-two-hybrid assay, GST pull-down assay and co-immunoprecipitation were used to identify and verify the interaction between TTC9A and other proteins. Results Tropomyosin Tm5NM-1 was identified as one of the TTC9A partner proteins. The interaction between TTC9A and Tm5NM-1 was further confirmed by GST pull-down assay and co-immunoprecipitation in mammalian cells. TTC9A domains required for the interaction were also characterized in this study. The results suggested that the first TPR domain and the linker fragment between the first two TPR domains of TTC9A were important for the interaction with Tm5NM-1 and the second and the third TPR might play an inhibitory role. Conclusion Since the primary function of tropomyosin is to stabilize actin filament, its interaction with TTC9A may play a role in cell shape and motility. In our previous results, we have found that progesterone-induced TTC9A expression was associated with increased cell motility and cell spreading. We speculate that TTC9A acts as a chaperone protein to facilitate the function of tropomyosins in stabilizing microfilament and it may play a role in cancer cell invasion and metastasis.

  15. Infrequent SCN9A mutations in congenital insensitivity to pain and erythromelalgia

    OpenAIRE

    Klein, Christopher J.; Wu, Yanhong; Kilfoyle, Dean H; Sandroni, Paola; Davis, Mark D; Gavrilova, Ralitza H; Low, Phillip A.; Dyck, Peter J.

    2012-01-01

    Objective Mutations in SCN9A have been reported in (1) congenital insensitivity to pain (CIP); (2) primary erythromelalgia; (3) paroxysmal extreme pain disorder; (4) febrile seizures and recently (5) small fibre sensory neuropathy. We sought to investigate for SCN9A mutations in a clinically well-characterised cohort of patients with CIP and erythromelalgia. Methods We sequenced all exons of SCN9A in 19 clinically well-studied cases including 6 CIP and 13 erythromelalgia (9 with family histor...

  16. The disintegrin domain of ADAM9: a ligand for multiple β1 renal integrins

    Science.gov (United States)

    2004-01-01

    Renal tubular epithelial cells in all nephron segments express a distinct member of the metalloprotease-disintegrin family, ADAM9 (a disintegrin and metalloprotease 9), in a punctate basolateral distribution co-localized to the β1 integrin chain [Mahimkar, Baricos, Visaya, Pollock and Lovett (2000) J. Am. Soc. Nephrol. 11, 595–603]. Discrete segments of the nephron express several defined β1 integrins, suggesting that ADAM9 interacts with multiple renal integrins and thereby regulates epithelial cell–matrix interactions. Intact ADAM9 and a series of deletion constructs sequentially lacking the metalloprotease domain and the disintegrin domain were assembled as chimaeras with a C-terminal GFP (green fluorescent protein) tag. Stable expression of the ADAM9/GFP protein on the surface of HEK-293 cells (human embryonic kidney 293 cells) significantly decreased adhesion to types I and IV collagen, vitronectin and laminin, but had little effect on adhesion to fibronectin. Expression of the disintegrin/cysteine-rich/GFP construct yielded a similar, but more marked pattern of decreased adhesion. Expression of the cysteine-rich/GFP construct had no effect on adhesion, indicating that the disintegrin domain was responsible for the competitive inhibition of cell–matrix binding. To define the specific renal tubular β1 integrins interacting with the ADAM9 disintegrin domain, a recombinant GST (glutathione S-transferase)-disintegrin protein was used as a substrate in adhesion assays in the presence or absence of specific integrin-blocking antibodies. Inclusion of antibodies to α1, α3, α6, αv and β1 blocked adhesion of HEK-293 cells to GST-disintegrin protein. Immobilized GST-disintegrin domain perfused with renal cortical lysates specifically recovered the α3, α6, αv and β1 integrin chains by Western analysis. It is concluded that ADAM9 is a polyvalent ligand, through its disintegrin domain, for multiple renal integrins of the β1 class. PMID:15361064

  17. The disintegrin domain of ADAM9: a ligand for multiple beta1 renal integrins.

    Science.gov (United States)

    Mahimkar, Rajeev M; Visaya, Orvin; Pollock, Allan S; Lovett, David H

    2005-01-15

    Renal tubular epithelial cells in all nephron segments express a distinct member of the metalloprotease-disintegrin family, ADAM9 (a disintegrin and metalloprotease 9), in a punctate basolateral distribution co-localized to the beta1 integrin chain [Mahimkar, Baricos, Visaya, Pollock and Lovett (2000) J. Am. Soc. Nephrol. 11, 595-603]. Discrete segments of the nephron express several defined beta1 integrins, suggesting that ADAM9 interacts with multiple renal integrins and thereby regulates epithelial cell-matrix interactions. Intact ADAM9 and a series of deletion constructs sequentially lacking the metalloprotease domain and the disintegrin domain were assembled as chimaeras with a C-terminal GFP (green fluorescent protein) tag. Stable expression of the ADAM9/GFP protein on the surface of HEK-293 cells (human embryonic kidney 293 cells) significantly decreased adhesion to types I and IV collagen, vitronectin and laminin, but had little effect on adhesion to fibronectin. Expression of the disintegrin/cysteine-rich/GFP construct yielded a similar, but more marked pattern of decreased adhesion. Expression of the cysteine-rich/GFP construct had no effect on adhesion, indicating that the disintegrin domain was responsible for the competitive inhibition of cell-matrix binding. To define the specific renal tubular beta1 integrins interacting with the ADAM9 disintegrin domain, a recombinant GST (glutathione S-transferase)-disintegrin protein was used as a substrate in adhesion assays in the presence or absence of specific integrin-blocking antibodies. Inclusion of antibodies to alpha1, alpha3, alpha6, alphav and beta1 blocked adhesion of HEK-293 cells to GST-disintegrin protein. Immobilized GST-disintegrin domain perfused with renal cortical lysates specifically recovered the alpha3, alpha6, alphav and beta1 integrin chains by Western analysis. It is concluded that ADAM9 is a polyvalent ligand, through its disintegrin domain, for multiple renal integrins of the beta1

  18. SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.

    Science.gov (United States)

    Liu, Hong; Ma, Yan; He, Hong-Wei; Wang, Jia-Ping; Jiang, Jian-Dong; Shao, Rong-Guang

    2015-01-01

    Autophagy, a self-catabolic process, has been found to be involved in abrogating the proliferation and metastasis of breast cancer. SLC9A3R1 (solute carrier family 9, subfamily A [NHE3, cation proton antiporter 3], member 3 regulator 1), a multifunctional scaffold protein, is involved in suppressing breast cancer cells proliferation and the SLC9A3R1-related signaling pathway regulates the activation of autophagy processes. However, the precise regulatory mechanism and signaling pathway of SLC9A3R1 in the regulation of autophagy processes in breast cancer cells remains unknown. Here, we report that the stability of BECN1, the major component of the autophagic core lipid kinase complex, is augmented in SLC9A3R1-overexpressing breast cancer MDA-MB-231 cells, subsequently stimulating autophagy by attenuating the interaction between BECN1 and BCL2. Initially, we found that SLC9A3R1 partially stimulated autophagy through the PTEN-PI3K-AKT1 signaling cascade in MDA-MB-231 cells. SLC9A3R1 then attenuated the interaction between BECN1 and BCL2 to stimulate the autophagic core lipid kinase complex. Further findings revealed that SLC9A3R1 bound to BECN1 and subsequently blocked ubiquitin-dependent BECN1 degradation. And the deletion of the C-terminal domain of SLC9A3R1 resulted in significantly reduced binding to BECN1. Moreover, the lack of C-terminal of SLC9A3R1 neither reduced the ubiquitination of BECN1 nor induced autophagy in breast cancer cells. The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells. These findings indicate that the SLC9A3R1-BECN1 signaling pathway participates in the activation of autophagy processes in breast cancer cells.

  19. 40 CFR 60.482-9a - Standards: Delay of repair.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standards: Delay of repair. 60.482-9a..., Reconstruction, or Modification Commenced After November 7, 2006 § 60.482-9a Standards: Delay of repair. (a) Delay of repair of equipment for which leaks have been detected will be allowed if repair within 15...

  20. Depletion of G9a gene induces cell apoptosis in human gastric carcinoma.

    Science.gov (United States)

    Lin, Xiaolei; Huang, Yiqun; Zou, Yong; Chen, Xingsheng; Ma, Xudong

    2016-05-01

    G9a is a mammalian histone methyltransferase that contributes to the epigenetic silencing of tumor suppressor genes. Evidence suggests that G9a is required to maintain the malignant phenotype, but little documentation show the role of G9a function in mediating tumor growth. We retrospectively analyzed the protein of G9a and monomethylated histone H3 lysine 9 (H3K9 me1), and dimethylated histone H3 lysine 9 (H3K9 me2) in 175 cases of gastric carcinoma by immunohistochemistry. RNAi-based inhibition of G9a in MGC803 cancer cell line was studied. G9a depletion was done by transient transfection using Lipofectamine 2000. Depletion efficiency of G9a was tested using real-time PCR and western blot analysis. Cell apoptosis and proliferation were detected by TUNEL assay and MTT, respectively. The proteins of H3K9 me1, me2, trimethylation of H3K9 (H3K9 me3), monomethylated histone H3 lysine 27 (H3K27 me1), dimethylated histone H3 lysine 27 (H3K27 me2) and histone acetylated H3, apoptotic proteins were studied by western blot analysis. G9a and H3K9 me2 expression was higher in gastric cancer cells compared to the control (pgastric carcinoma, (pgastric cancer. It might be of therapeutic benefit in gastric cancers.

  1. Discovery of Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase

    Energy Technology Data Exchange (ETDEWEB)

    Xiong, Yan; Li, Fengling; Babault, Nicolas; Dong, Aiping; Zeng, Hong; Wu, Hong; Chen, Xin; Arrowsmith, Cheryl H.; Brown, Peter J.; Liu, Jing; Vedadi, Masoud; Jin, Jian

    2017-02-14

    G9a-like protein (GLP) and G9a are highly homologous protein lysine methyltransferases (PKMTs) sharing approximately 80% sequence identity in their catalytic domains. GLP and G9a form a heterodimer complex and catalyze mono- and dimethylation of histone H3 lysine 9 and nonhistone substrates. Although they are closely related, GLP and G9a possess distinct physiological and pathophysiological functions. Thus, GLP or G9a selective small-molecule inhibitors are useful tools to dissect their distinct biological functions. We previously reported potent and selective G9a/GLP dual inhibitors including UNC0638 and UNC0642. Here we report the discovery of potent and selective GLP inhibitors including 4 (MS0124) and 18 (MS012), which are >30-fold and 140-fold selective for GLP over G9a and other methyltransferases, respectively. The cocrystal structures of GLP and G9a in the complex with either 4 or 18 displayed virtually identical binding modes and interactions, highlighting the challenges in structure-based design of selective inhibitors for either enzyme.

  2. Association analysis of SCN9A gene variants with borderline personality disorder.

    Science.gov (United States)

    Tadić, André; Baskaya, Omur; Victor, Anja; Lieb, Klaus; Höppner, Wolfgang; Dahmen, Norbert

    2008-12-01

    Borderline personality disorder (BPD) is a serious psychiatric disorder affecting about 1-2% of the general population. Key features of BPD are emotional instability, strong impulsivity, repeated self-injurious behavior (SIB) and dissociation. In the etiology of BPD and its predominant symptoms, genetic factors have been suggested. The voltage-gated sodium channel Nav1.7 is expressed in sensory neurons and in the hippocampus, a key region of the limbic system probably dysfunctional in BPD and dissociative disorders. The alpha-subunit of Nav1.7 is encoded by the SCN9A gene on chromosome 2 and variations of SCN9A can lead to complete inability to sense pain. The aim of the present study was to test for associations between SCN9A gene variants and BPD as well as BPD-related phenotypes. We genotyped ten tagging single nucleotide polymorphisms (SNPs) within the SCN9A gene in 161 well-defined Caucasian BPD patients and 156 healthy controls. We found no globally significant association of SCN9A markers with BPD at level 5%. However, in the female and in the male subsample, different SCN9A markers and individual haplotypes showed uncorrected p-valuesSCN9A markers and dissociative symptoms. Although our results were largely negative, replication studies in an independent sample are warranted to follow up on the potential role of SCN9A gene variants in BPD and dissociative symptoms, paying special attention to a possible gender different etiology.

  3. Identification and characterization of two CYP9A genes associated with pyrethroid detoxification in Locusta migratoria.

    Science.gov (United States)

    Zhu, Wenya; Yu, Rongrong; Wu, Haihua; Zhang, Xueyao; Liu, Yaoming; Zhu, Kun Yan; Zhang, Jianzhen; Ma, Enbo

    2016-09-01

    Cytochrome P450s (CYPs) constitute one of the largest gene super families and distribute widely in all living organisms. In this study, the full-length cDNA sequences of two LmCYP9A genes (LmCYP9AQ1 and LmCYP9A3) were cloned from Locusta migratoria. We analyzed the expression patterns of two LmCYP9A genes in various tissues and different developmental stages using real-time quantitative PCR. Then we evaluated the detoxification functions of the two LmCYP9A genes by testing mortalities with four kinds of pyrethroid treatment after RNA interference (RNAi), respectively. Combining with docking structure of two LmCYP9A genes, their detoxification properties were extensively analyzed. The full-length cDNAs of LmCYP9AQ1 and LmCYP9A3 putatively encoded 525 and 524 amino acid residues, respectively. Both LmCYP9A genes were expressed throughout the developmental stages. The expression of LmCYP9AQ1 in the brain was higher than that in other examined tissues, whereas the LmCYP9A3 was mainly expressed in the fat body. The mortalities of nymphs exposed to deltamethrin and permethrin increased from 27.7% to 77.7% and 27.7% to 58.3%, respectively, after dsLmCYP9A3 injection. While the mortalities of nymphs exposed to fluvalinate increased from 29.8% to 53.0% after LmCYP9AQ1 was silenced using RNA interference. Our results suggested that the two LmCYP9A genes may be involved in different pyrethroid insecticide detoxification in L. migratoria.

  4. Impacts of March 11

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ Feng: The world-shocking September 11 terrorist attacks occurred in the United States in 2001, and two and a half years late the world saw panic-stricken terrorist attacks of the same kind in Spain. Ever since then March 11 has become another day that is engraved on the mind of the people all over the world. The terrorist event in Madrid has not only produced great impact on Spain and other European nations as well as on the common people, but also spurred the European nations to reflect on a series of important issues and to make some adjustments of their policies.

  5. Discovery and optimization of adamantyl carbamate inhibitors of 11β-HSD1.

    Science.gov (United States)

    Tice, Colin M; Zhao, Wei; Krosky, Paula M; Kruk, Barbara A; Berbaum, Jennifer; Johnson, Judith A; Bukhtiyarov, Yuri; Panemangalore, Reshma; Scott, Boyd B; Zhao, Yi; Bruno, Joseph G; Howard, Lamont; Togias, Jennifer; Ye, Yuan-Jie; Singh, Suresh B; McKeever, Brian M; Lindblom, Peter R; Guo, Joan; Guo, Rong; Nar, Herbert; Schuler-Metz, Annette; Gregg, Richard E; Leftheris, Katerina; Harrison, Richard K; McGeehan, Gerard M; Zhuang, Linghang; Claremon, David A

    2010-11-15

    Synthesis of 2-adamantyl carbamate derivatives of piperidines and pyrrolidines led to the discovery of 9a with an IC(50) of 15.2 nM against human 11β-HSD1 in adipocytes. Optimization for increased adipocyte potency, metabolic stability and selectivity afforded 11k and 11l, both of which were >25% orally bioavailable in rat.

  6. The RD11 Collaboration

    CERN Multimedia

    CERN Audiovisual Unit

    1993-01-01

    Presentation of the RD11 Collaboration which is specialized in elaborating the second level trigger for the LHC. Also named EAST (Embedded Architectures for Second-level Triggering) in LHC Experiments.With John Strong, Rudy Bock, Werner Krischer, Gennaddi Klioutchnikov, Claudia Bondila, Iosif Legrand and Erwin Denes.

  7. 11 Alou 03.pmd

    African Journals Online (AJOL)

    hond

    2007-07-11

    Jul 11, 2007 ... pose modes of coming to consciousness and of co-naissance, ... Return to My Native Land): Qui et quels nous sommes?, “Who and what are we?” ..... soul. He and Mycéa are united as a couple; the country and the world are ...

  8. 11.RESPIRATORY SYSTEM

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    11.1.Lung function930671 The effects of persantine on pulmonary arte-rial pressure of rats exposed to hypoxia.RAN Pixin,Respir Dis Instit,Tongji Hosp,TongjiMed Univ,Wuhan,430030.Chin J Tuberc & RespirDis 1993;16(4):216—217.In the chronic hypoxic model of pulmonary hyper-

  9. Reference: SURECOREATSULTR11 [PLACE

    Lifescience Database Archive (English)

    Full Text Available Yamaya T, Takahashi H. Identification of a novel cis-acting element conferring sulfur deficiency response in Arabidopsis roots. Plant J. 42: 305-314 (2005). PubMed: 15842617 ... ...SURECOREATSULTR11 Maruyama-Nakashita A, Nakamura Y, Watanabe-Takahashi A, Inoue E,

  10. A novel peptide targeting Clec9a on dendritic cell for cancer immunotherapy

    Science.gov (United States)

    Yan, Zhongyi; Wu, Yahong; Du, Jiangfeng; Li, Guodong; Wang, Shengdian; Cao, Wenpeng; Zhou, Xiuman; Wu, Chunjing; Zhang, Dan; Jing, Xueli; Li, Yifan; Wang, Hongfei; Gao, Yanfeng; Qi, Yuanming

    2016-01-01

    Dendritic cells (DCs) are professional antigen-presenting cells with antigen recognition molecules on the surface. Clec9a is selectively expressed on mouse CD8a+ DCs and CD103+ DCs subsets, which are functionally similar to human BDCA3+ DCs. It is reported that Clec9a is responsible for the antigen cross-presentation of these DC subsets. In the present study, by using phage display technique, we discovered a novel peptide WH, which can selectively bind to mouse Flt3L induced Clec9a+ DCs or Clec9a over-expressed HEK-293T cells. Furthermore, by using computer-aided docking model and mutation assay, we observed that Asp248 and Trp250 are two key residues for Clec9a to bind with peptide WH. When coupled with OVA257-264 epitope, peptide WH can significantly enhance the ability of Clec9a+ DCs to activate OVA-specific CD8+ T cells, which elicit strong ability to secret IFN-γ, express perforin and granzyme B mRNA. In B16-OVA lung metastasis mouse model, WH-OVA257-264 fusion peptide can also enhance the activation of CD8+ T cells and decrease the lung metastasis loci. All these results suggested that peptide WH could be considered as an antigen delivery carrier targeting Clec9a+ DCs for cancer immunotherapy. PMID:27250027

  11. 50 CFR 11.11 - Notice of violation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Notice of violation. 11.11 Section 11.11 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... be a waiver of the notice ef assessment required by § 11.14, and of the opportunity for a...

  12. Protein lysine methyltransferase G9a acts on non-histone targets

    Science.gov (United States)

    Rathert, Philipp; Dhayalan, Arunkumar; Murakami, Marie; Zhang, Xing; Tamas, Raluca; Jurkowska, Renata; Komatsu, Yasuhiko; Shinkai, Yoichi; Cheng, Xiaodong; Jeltsch, Albert

    2009-01-01

    By methylation of peptide arrays, we determined the specificity profile of the protein methyltransferase G9a. We show that it mostly recognizes an Arg-Lys sequence and that its activity is inhibited by methylation of the arginine residue. Using the specificity profile, we identified new non-histone protein targets of G9a, including CDYL1, WIZ, ACINUS and G9a (automethylation), as well as peptides derived from CSB. We demonstrate potential downstream signaling pathways for methylation of non-histone proteins. PMID:18438403

  13. The non-synonymous SNP, R1150W, in SCN9A is not associated with chronic widespread pain susceptibility

    Directory of Open Access Journals (Sweden)

    Holliday Kate L

    2012-09-01

    Full Text Available Abstract Background Mutations in SCN9A, encoding the alpha subunit of the voltage-gated sodium channel (Nav1.7, have caused severe pain disorders and congenital insensitivity to pain. The aim of this study was to validate the previously reported association between a common non-synonymous polymorphism (R1150W, rs6746030 in SCN9A and chronic widespread pain (CWP, in independent population-based cohorts. Findings Genotype data for rs6746030 was available in four population-based cohorts (EPIFUND, the European Male Ageing Study (EMAS, the Framingham study and the Dyne Steel DNA Bank of Ageing and Cognition. Pain was assessed using body manikins and CWP was scored using American College of Rheumatology (ACR criteria in all cohorts, except the Framingham study which assessed widespread pain (WP using ACR criteria on a joint pain homunculus. Controls were subjects who reported no pain. Logistic regression (additive genetic model was used to test for association between rs6746030 and CWP compared to controls, adjusting for study centre in EMAS. Generalised estimating equation regression was used to test for association between rs6746030 and WP, whilst accounting for relatedness between subjects in the Framingham study. Genotype data for rs6746030 was available for 1071 CWP cases and 3212 controls. There was no significant association between CWP and rs6476030 in individual cohorts or when combined in a fixed-effects meta-analysis (Odds Ratio = 0.96 (95% confidence interval 0.82, 1.11 p = 0.567. Conclusions In contrast to a previous study, no association between a non-synonymous polymorphism in SCN9A and CWP was observed in multiple population-based cohorts.

  14. SCN9A mutations in paroxysmal extreme pain disorder: allelic variants underlie distinct channel defects and phenotypes.

    Science.gov (United States)

    Fertleman, Caroline R; Baker, Mark D; Parker, Keith A; Moffatt, Sarah; Elmslie, Frances V; Abrahamsen, Bjarke; Ostman, Johan; Klugbauer, Norbert; Wood, John N; Gardiner, R Mark; Rees, Michele

    2006-12-07

    Paroxysmal extreme pain disorder (PEPD), previously known as familial rectal pain (FRP, or OMIM 167400), is an inherited condition characterized by paroxysms of rectal, ocular, or submandibular pain with flushing. A genome-wide linkage search followed by mutational analysis of the candidate gene SCN9A, which encodes hNa(v)1.7, identified eight missense mutations in 11 families and 2 sporadic cases. Functional analysis in vitro of three of these mutant Na(v)1.7 channels revealed a reduction in fast inactivation, leading to persistent sodium current. Other mutations in SCN9A associated with more negative activation thresholds are known to cause primary erythermalgia (PE). Carbamazepine, a drug that is effective in PEPD, but not PE, showed selective block of persistent current associated with PEPD mutants, but did not affect the negative activation threshold of a PE mutant. PEPD and PE are allelic variants with distinct underlying biophysical mechanisms and represent a separate class of peripheral neuronal sodium channelopathy.

  15. Data of evolutionary structure change: 1AW9A-2GDRD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW9A-2GDRD 1AW9 2GDR A D APLKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTT-G...AHKQPDFLALNPFGQIPALVDG-DEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGD...NFISSELHKSFSPLFN---------PASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADI---YLFVVLGWSAYVNID--LSPWPSLQAFQGRVGGREAVQ...LN CA 145 2GDR ...D 2GDRD VDLASKKTASG EE EE

  16. Data of evolutionary structure change: 1BK9A-2QOGD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BK9A-2QOGD 1BK9 2QOG A D SLIQFETLIMKVAKKSGMFWYSNYGCYCGWGGQGRPQDA...TDRCCFVHDCCYGKVTGCDPKMDVYSFSEENGDIVCGGDDPCKKEICECDRAAAICFRDNLTLYNDKKYWAFGAKNCPQEESEPC SLLQFNKMI.../pdbChain> 2QOGD LSTYK-NEYMF

  17. Apollo 11 Mission Commemorated

    Science.gov (United States)

    Showstack, Randy

    2009-07-01

    On 24 July 1969, 4 days after Apollo 11 Mission Commander Neil Armstrong and Lunar Module Eagle Pilot Eugene “Buzz” Aldrin had become the first people to walk on the Moon, they and Apollo 11 Command Module Pilot Michael Collins peered through a window of the Mobile Quarantine Facility on board the U.S.S. Hornet following splashdown of the command module in the central Pacific as U.S. President Richard Nixon told them, “This is the greatest week in the history of the world since the creation.” Forty years later, the Apollo 11 crew and other Apollo-era astronauts gathered at several events in Washington, D. C., to commemorate and reflect on the Apollo program, that mission, and the future of manned spaceflight. “I don’t know what the greatest week in history is,” Aldrin told Eos. “But it was certainly a pioneering opening the door. With the door open when we touched down on the Moon, that was what enabled humans to put many more footprints on the surface of the Moon.”

  18. Histone H3K9 methyltransferase G9a represses PPARγ expression and adipogenesis

    OpenAIRE

    Wang, Lifeng; Xu, Shiliyang; Lee, Ji-Eun; Baldridge, Anne; Grullon, Sean; Peng, Weiqun; Ge, Kai

    2012-01-01

    PPARγ promotes adipogenesis while Wnt proteins inhibit adipogenesis. However, the mechanisms that control expression of these positive and negative master regulators of adipogenesis remain incompletely understood. By genome-wide histone methylation profiling in preadipocytes, we find that among gene loci encoding adipogenesis regulators, histone methyltransferase (HMT) G9a-mediated repressive epigenetic mark H3K9me2 is selectively enriched on the entire PPARγ locus. H3K9me2 and G9a levels dec...

  19. Essential roles of G9a in cell proliferation and differentiation during tooth development.

    Science.gov (United States)

    Kamiunten, Taichi; Ideno, Hisashi; Shimada, Akemi; Arai, Yoshinori; Terashima, Tatsuo; Tomooka, Yasuhiro; Nakamura, Yoshiki; Nakashima, Kazuhisa; Kimura, Hiroshi; Shinkai, Yoichi; Tachibana, Makoto; Nifuji, Akira

    2017-08-15

    Teeth develop through interactions between epithelial and mesenchymal tissues mediated by a signaling network comprised of growth factors and transcription factors. However, little is known about how epigenetic modifiers affect signaling pathways and thereby regulate tooth formation. We previously reported that the histone 3 lysine 9 (H3K9) methyltransferase (MTase) G9a is specifically enriched in the tooth mesenchyme during mouse development. In this study, we investigated the functions of G9a in tooth development using G9a conditional knockout (KO) mice. We used Sox9-Cre mice to delete G9a in the tooth mesenchyme because Sox9 is highly expressed in the mesenchyme derived from the cranial neural crest. Immunohistochemical analyses revealed that G9a expression was significantly decreased in the mesenchyme of Sox9-Cre;G9afl/fl (G9a cKO) mice compared with that in Sox9-Cre;G9a fl/+(control) mice. Protein levels of the G9a substrate H3K9me2 were also decreased in the tooth mesenchyme. G9a cKO mice showed smaller tooth germ after embryonic day (E) 16.5 and E17.5, but not at E15.5. The developing cusp tips, which were visible in control mice, were absent in G9a cKO mice at E17.5. At 3 weeks after birth, small first molars with smaller cusps and unseparated roots were formed. Organ culture of tooth germs derived from E15.5 cKO mouse embryos showed impaired tooth development, suggesting that tooth development per se is affected independently of skull development. BrdU labeling experiments revealed that the proliferation rates were decreased in the mesenchyme in G9a cKO mice at E17.5. In addition, the proliferation rates in the tooth inner enamel epithelium were also decreased. In situ hybridization revealed altered localization of genes associated with tooth development. In cKO mice, intensively localized expression of mRNAs encoding bone morphogenic protein (Bmp2 and Bmp4) was observed in the tooth mesenchyme at E17.5, similar to the expression patterns observed in

  20. At WA11

    CERN Multimedia

    1977-01-01

    Starting with february 1977 the WA5 spectrometer of the Indiana-Saclay Collaboration originally designed to study hadron backward scattering on protons, and later modified by the Indiana-Imperial College (London)-Saclay-Southampton Collaboration, was used (experiment WA11) to search for high mass states produced with the J/psi. On the left, Tom Marshall moves in a beam hodoscope. On the right, at the entrance of the Goliath magnet, one sees the 1 m long hydrogen target. (Later the set-up was reshuffled, and the hydrogen target was replaced by a set of Be targets located upstream of the magnet.)

  1. COMP and Col9A3 mutations and their relationship to the pseudoachondroplasia phenotype.

    Science.gov (United States)

    Jung, Woon-Won; Balce, Gracia Cielo; Cho, Jae-Woo; Jung, Sung-Chul; Hong, Suk-Joo; Song, Hae-Ryong

    2010-12-01

    While pseudoachondroplasia (PSACH) is almost exclusively caused by cartilage oligomeric matrix protein (COMP) mutations, many patients identified with the PSACH phenotype do not have this mutation, suggesting gene and locus heterogeneity. In order to further characterize this entity, we studied 32 clinically and radiographically diagnosed PSACH patients, among 19 families. COMP and collagen (Col) IX (A1, A2 and A3) mutations, were determined. Patients who tested negative for pathological gene mutations but who were identified with the PSACH phenotype, were included. The phenotypes were characterized according to height deviation (cm) from normal, lower extremity mechanical axis deviation (MAD), cervical and thoracolumbar spine involvement, pelvic index, as well as hip, knee, ankle and hand involvement. We report an 81% mutation detection rate for PSACH, of which COMP+Col9A3 mutations were more prevalent (61%) than COMP mutations alone (30%). Of our PSACH patients, 19% tested negative for both COMP and Col9A3 mutations, and they presented with the greatest mean height deviations, but the least mean MADs. While all the PSACH mutations consistently produced the severe phenotype, the V426A mutation in Col9A3 produced the most severe. Mother-daughter and father-son phenotypic similarities were noted in the COMP+Col9A3 families. Col9A3 and gender play confounding roles in the phenotypic severity of PSACH. The presence of the PSACH phenotype in patients who tested negative for known mutations further confirms the genetic heterogeneity of this condition.

  2. SCN9A mutations define primary erythermalgia as a neuropathic disorder of voltage gated sodium channels.

    Science.gov (United States)

    Drenth, Joost P H; te Morsche, Rene H M; Guillet, Gerard; Taieb, Alain; Kirby, R Lee; Jansen, Jan B M J

    2005-06-01

    Primary erythermalgia is a rare disorder characterized by recurrent attacks of red, warm and painful hands, and/or feet. We previously localized the gene for primary erythermalgia to a 7.94 cM region on chromosome 2q. Recently, Yang et al identified two missense mutations of the sodium channel alpha subunit SCN9A in patients with erythermalgia. The presence of voltage-gated sodium channels in sensory neurons is thought to play a crucial role in several chronic painful neuropathies. We examined four different families and two sporadic cases and detected missense sequence variants in SCN9A to be present in primary erythermalgia patients. A total of five of six mutations were located in highly conserved regions. One family with autosomal dominantly inherited erythermalgia was double heterozygous for two separate SCN9A mutations. These data establish primary erythermalgia as a neuropathic disorder and offers hope for treatment of this incapacitating painful disorder.

  3. Educación emocional en Educación Primaria para niños de 9 a 11 años

    OpenAIRE

    Ríos-Carrera, Jessica

    2016-01-01

    Las emociones forman parte de nuestra vida desde el momento en que nacemos. Es por ello que juegan un papel fundamental en nuestra existencia y experiencia vital, al regular nuestras relaciones con nosotros mismos y con los demás. La afectividad, los sentimientos forman parte de ese gran cúmulo emocional que sentimos a lo largo de nuestra vida. Durante la infancia, el desarrollo emocional es especialmente significativo, porque ocurre de forma pura y transparente, en la medida que el niño esté...

  4. SLC9A9 Co-expression modules in autism-associated brain regions.

    Science.gov (United States)

    Patak, Jameson; Hess, Jonathan L; Zhang-James, Yanli; Glatt, Stephen J; Faraone, Stephen V

    2016-07-21

    SLC9A9 is a sodium hydrogen exchanger present in the recycling endosome and highly expressed in the brain. It is implicated in neuropsychiatric disorders, including autism spectrum disorders (ASDs). Little research concerning its gene expression patterns and biological pathways has been conducted. We sought to investigate its possible biological roles in autism-associated brain regions throughout development. We conducted a weighted gene co-expression network analysis on RNA-seq data downloaded from Brainspan. We compared prenatal and postnatal gene expression networks for three ASD-associated brain regions known to have high SLC9A9 gene expression. We also performed an ASD-associated single nucleotide polymorphism enrichment analysis and a cell signature enrichment analysis. The modules showed differences in gene constituents (membership), gene number, and connectivity throughout time. SLC9A9 was highly associated with immune system functions, metabolism, apoptosis, endocytosis, and signaling cascades. Gene list comparison with co-immunoprecipitation data was significant for multiple modules. We found a disproportionately high autism risk signal among genes constituting the prenatal hippocampal module. The modules were enriched with astrocyte and oligodendrocyte markers. SLC9A9 is potentially involved in the pathophysiology of ASDs. Our investigation confirmed proposed functions for SLC9A9, such as endocytosis and immune regulation, while also revealing potential roles in mTOR signaling and cell survival.. By providing a concise molecular map and interactions, evidence of cell type and implicated brain regions we hope this will guide future research on SLC9A9. Autism Res 2016. © 2016 International Society for Autism Research, Wiley Periodicals, Inc.

  5. Inhibition of H3K9 methyltransferase G9a ameliorates methylglyoxal-induced peritoneal fibrosis

    Science.gov (United States)

    Maeda, Kazuya; Doi, Shigehiro; Nakashima, Ayumu; Nagai, Takuo; Irifuku, Taisuke; Ueno, Toshinori; Masaki, Takao

    2017-01-01

    Activity of H3K9 histone methyltransferase G9a is reportedly induced by transforming growth factor-β1 (TGF-β1) and plays an important role in the progression of cancer and fibrosis. In this study, we investigated whether inhibition of G9a-mediated H3K9 methylation attenuates peritoneal fibrosis in mice and human peritoneal mesothelial cells (HPMCs). Nonadherent cells of peritoneal dialysis (PD) patients were isolated from PD effluent to examine expression of G9a. Peritoneal fibrosis was induced by peritoneal injection of methylglyoxal (MGO) in male C57/B6 mice for 3 weeks. BIX01294, a G9a inhibitor, was administered by subcutaneous injection. Effects of BIX01294 on MGO-induced pathological and functional changes in mice were evaluated by immunohistochemistry and a peritoneal equilibration test. HPMCs were isolated from human omentum, and the inhibitory effect of BIX01294 on TGF-β1-induced fibrotic changes was investigated in the HPMCs by western blotting. G9a was upregulated in nonadherent cells of human PD effluent, the peritoneum of MGO-injected mice, and TGF-β1-stimulated HPMCs. BIX01294 significantly reduced the submesothelial zone thickness and cell density in MGO-injected mice. Immunohistochemical staining revealed that BIX01294 treatment decreased not only mono-methylation of H3K9 (H3K9me1), but also the number of mesenchymal cells, accumulation of collagen, and infiltration of monocytes. In addition to the pathological changes, BIX01294 reduced the level of TGF-β1 in peritoneal fluid and improved peritoneal functions. Furthermore, BIX01294 inhibited TGF-β1-induced fibrotic changes along with suppression of H3K9me1 in HPMCs. Therefore, inhibition of H3K9 methyltransferase G9a suppresses peritoneal fibrosis through a reduction of H3K9me1. PMID:28278257

  6. Enhanced expression of Wnt9a in the flexor tenosynovium in idiopathic carpal tunnel syndrome.

    Science.gov (United States)

    Yamanaka, Yoshiaki; Menuki, Kunitaka; Zenke, Yukichi; Hirasawa, Hideyuki; Sakai, Akinori

    2015-10-01

    This study aimed to clarify the association between abnormal Wnt signaling and the cause of idiopathic carpal tunnel syndrome (ICTS) and whether an association exists between Wnt signaling and cell proliferation in the flexor tenosynovium. The subjects included nine patients with ICTS; the controls were nine patients with distal radius fractures without any symptoms of carpal tunnel syndrome. We extracted mRNA from the flexor tenosynovium and compared the expression levels of genes encoding 17 types of Wnt in both subjects and controls via quantitative real-time polymerase chain reaction (PCR). Expression levels of factors involved in cell proliferation, such as estrogen-responsive finger protein, epidermal growth factor receptor, heparin binding-epidermal growth factor-like growth factor, insulin-like growth factor-1, and vascular endothelial growth factor (VEGF) were also measured using quantitative real-time PCR. In addition, we compared the Wnt and MIB-1 protein expression levels to clarify the effect of Wnt on cell proliferation. Quantitative real-time PCR revealed significantly greater expression of the gene encoding Wnt9a in subjects with ICTS than in controls and also revealed a positive correlation between the expression of genes encoding Wnt9a and VEGF in subjects with ICTS. Quantitative evaluation using immunohistochemical staining also indicated more marked Wnt9a expression in subjects than in controls. However, there was no relationship between the expression of Wnt9a and the cell proliferation index MIB-1. These results indicate that Wnt9a expression is enhanced in ICTS and that Wnt9a may be involved in VEGF expression in ICTS.

  7. Mutations in Sodium Channel Gene SCN9A and the Pain Perception Disorders

    OpenAIRE

    Marković, Danica; Janković, Radmilo; Veselinović, Ines

    2015-01-01

    Voltage-gated sodium channels (NaV) play a crucial role in development and propagation of action potentials in neurons and muscle cells. NaV1.7 channels take a special place in modern science since it is believed that they contribute to nerve hyperexcitability. Mutations of the gene SCN9A, which codes the α subunit of NaV1.7 channels, are associated with pain perception disorders (primary erythermalgia, congenital analgesia, and paroxysmal pain disorder). It is considered that the SCN9A gene ...

  8. Inherited erythromelalgia due to mutations in SCN9A: natural history, clinical phenotype and somatosensory profile.

    Science.gov (United States)

    McDonnell, Aoibhinn; Schulman, Betsy; Ali, Zahid; Dib-Hajj, Sulayman D; Brock, Fiona; Cobain, Sonia; Mainka, Tina; Vollert, Jan; Tarabar, Sanela; Waxman, Stephen G

    2016-04-01

    Inherited erythromelalgia, the first human pain syndrome linked to voltage-gated sodium channels, is widely regarded as a genetic model of human pain. Because inherited erythromelalgia was linked to gain-of-function changes of sodium channel Na(v)1.7 only a decade ago, the literature has mainly consisted of reports of genetic and/or clinical characterization of individual patients. This paper describes the pattern of pain, natural history, somatosensory profile, psychosocial status and olfactory testing of 13 subjects with primary inherited erythromelalgia with mutations of SCN9A, the gene encoding Na(v)1.7. Subjects were clinically profiled using questionnaires, quantitative sensory testing and olfaction testing during the in-clinic phase of the study. In addition, a detailed pain phenotype for each subject was obtained over a 3-month period at home using diaries, enabling subjects to self-report pain attacks, potential triggers, duration and severity of pain. All subjects reported pain and heat in the extremities (usually feet and/or hands), with pain attacks triggered by heat or exercise and relieved mainly by non-pharmacological manoeuvres such as cooling. A large proportion of pain attacks (355/1099; 32%) did not involve a specific trigger. There was considerable variability in the number, duration and severity of pain attacks between subjects, even those carrying the same mutation within a family, and within individuals over the 12-13 week observation period. Most subjects (11/13) had pain between attacks. For these subjects, mean pain severity between pain attacks was usually lower than that during an attack. Olfaction testing using the Sniffin'T test did not demonstrate hyperosmia. One subject had evidence of orthostatic hypotension. Overall, there was a statistically significant correlation between total Hospital Anxiety and Depression Scale scores (P= 0.005) and pain between attacks and for Hospital Anxiety and Depression Scale Depression scores and pain

  9. Mid-infrared interferometry of the massive young stellar object NGC3603 - IRS 9A

    CERN Document Server

    Vehoff, S; Monnier, J D; Tuthill, P; Nuernberger, D E A; Siebenmorgen, R; Chesneau, O; Duschl, W J

    2010-01-01

    We present observations and models for one of these MYSO candidates, NGC3603 IRS 9A. Our goal is to investigate with infrared interferometry the structure of IRS 9A on scales as small as 200AU, exploiting the fact that a cluster of O and B stars has blown away much of the obscuring foreground dust and gas. Observations in the N-band were carried out with the MIDI beam combiner attached to the VLTI. Additional interferometric observations which probe the structure of IRS 9A on larger scales were performed with an aperture mask installed in the T-ReCS instrument of Gemini South. The spectral energy distribution (SED) is constrained by the MIDI N-band spectrum and by data from the Spitzer Space Telescope. Our efforts to model the structure and SED of IRS 9A range from simple geometrical models of the brightness distribution to one- and two-dimensional radiative transfer computations. The target is resolved by T-ReCS, with an equivalent (elliptical) Gaussian width of 330mas by 280mas (2300 AU by 2000 AU). Despite...

  10. Pain perception is altered by a nucleotide polymorphism in SCN9A.

    NARCIS (Netherlands)

    Reimann, F.; Cox, J.J.; Belfer, I.; Diatchenko, L.; Zaykin, D.V.; McHale, D.P.; Drenth, J.P.H.; Dai, F.; Wheeler, J.; Sanders, F.; Wood, L.; Wu, T.X.; Karppinen, J.; Nikolajsen, L.; Mannikko, M.; Max, M.B.; Kiselycznyk, C.; Poddar, M.; Morsche, R.H.M. te; Smith, S.; Gibson, D.; Kelempisioti, A.; Maixner, W.; Gribble, F.M.; Woods, C.G.

    2010-01-01

    The gene SCN9A is responsible for three human pain disorders. Nonsense mutations cause a complete absence of pain, whereas activating mutations cause severe episodic pain in paroxysmal extreme pain disorder and primary erythermalgia. This led us to investigate whether single nucleotide polymorphisms

  11. Novel SCN9A mutations underlying extreme pain phenotypes: unexpected electrophysiological and clinical phenotype correlations.

    Science.gov (United States)

    Emery, Edward C; Habib, Abdella M; Cox, James J; Nicholas, Adeline K; Gribble, Fiona M; Woods, C Geoffrey; Reimann, Frank

    2015-05-20

    The importance of NaV1.7 (encoded by SCN9A) in the regulation of pain sensing is exemplified by the heterogeneity of clinical phenotypes associated with its mutation. Gain-of-function mutations are typically pain-causing and have been associated with inherited erythromelalgia (IEM) and paroxysmal extreme pain disorder (PEPD). IEM is usually caused by enhanced NaV1.7 channel activation, whereas mutations that alter steady-state fast inactivation often lead to PEPD. In contrast, nonfunctional mutations in SCN9A are known to underlie congenital insensitivity to pain (CIP). Although well documented, the correlation between SCN9A genotypes and clinical phenotypes is still unclear. Here we report three families with novel SCN9A mutations. In a multiaffected dominant family with IEM, we found the heterozygous change L245 V. Electrophysiological characterization showed that this mutation did not affect channel activation but instead resulted in incomplete fast inactivation and a small hyperpolarizing shift in steady-state slow inactivation, characteristics more commonly associated with PEPD. In two compound heterozygous CIP patients, we found mutations that still retained functionality of the channels, with two C-terminal mutations (W1775R and L1831X) exhibiting a depolarizing shift in channel activation. Two mutations (A1236E and L1831X) resulted in a hyperpolarizing shift in steady-state fast inactivation. To our knowledge, these are the first descriptions of mutations with some retained channel function causing CIP. This study emphasizes the complex genotype-phenotype correlations that exist for SCN9A and highlights the C-terminal cytoplasmic region of NaV1.7 as a critical region for channel function, potentially facilitating analgesic drug development studies.

  12. 11 CFR 9033.11 - Documentation of disbursements.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Documentation of disbursements. 9033.11 Section 9033.11 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: PRESIDENTIAL..., ledgers, fundraising solicitation material, accounting systems documentation, and any related...

  13. 11 CFR 7.11 - Political and organization activity.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Political and organization activity. 7.11... Responsibilities of Employees or Commissioners § 7.11 Political and organization activity. (a) Due to the Federal... which the employee is on active duty status. (c) Employees on leave, leave without pay, or on furlough...

  14. Expression of MIG-6, WNT-9A, and WNT-7B during osteoarthritis.

    Science.gov (United States)

    Velasquillo, Cristina; Garciadiego-Cázares, David; Almonte, Maylin; Bustamante, Marcia; Ibarra, Clemente; Kouri, Juan B; Chimal-Monroy, Jesús

    2007-11-01

    Although the molecular mechanisms for initiation of cartilage destruction in osteoarthritis (OA) are unknown, it has been demonstrated that disruption of mitogen-inducible gene 6 (Mig-6) in mice leads to the onset of a degenerative joint disease like OA. On this basis, we correlated gene expression of Mig-6 with Wnt-9a and Wnt-7b genes; we showed downregulation of Mig-6, Wnt-7b, and Wnt-9a during OA, while Wnt-7b was expressed also in osteoblast-like cells. Here we suggest that Aggrecan degradation occurs before the downregulation of Mig-6. It remains to be proven whether there is any relation between Wnt signaling and Aggrecan degradation.

  15. VizieR Online Data Catalog: SABOCA NGC 3603 IRS 9A images (Hummel+, 2015)

    Science.gov (United States)

    Hummel, C. A.; Stanke, T.; Galvan-Madrid, R.; Koribalski, B. S.

    2015-10-01

    Observations of NGC 3603 MM2 at 350um with the SABOCA bolometer array attached to the APEX telescope on the Chajnantor plateau in Chile were carried out on September 15, 2011, providing a beam FWHM of 7.8". The precipitable water vapor column was about 0.2mm during the observations, which lasted about 15 minutes for a spiral raster map of about 1.5 arcminutes in radius centered on IRS 9A. (2 data files).

  16. STS-26 crew poses for group portrait on shuttle mockup middeck in Bldg 9A

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, crewmembers pose on shuttle mockup middeck (port side) in the Shuttle Mockup and Integration Laboratory Bldg 9A. Clockwise from left foreground are Commander Frederick H. Hauck, Mission Specialist (MS) George D. Nelson, Pilot Richard O. Covey, MS John M. Lounge, and MS David C. Hilmers. Crewmembers are wearing flight coveralls (jump suits). Nelson stands on middeck ladder and Lounge sits in open side hatch. Photograph was taken by Keith Meyers of the NEW YORK TIMES.

  17. Pain perception is altered by a nucleotide polymorphism in SCN9A.

    Science.gov (United States)

    Reimann, Frank; Cox, James J; Belfer, Inna; Diatchenko, Luda; Zaykin, Dmitri V; McHale, Duncan P; Drenth, Joost P H; Dai, Feng; Wheeler, Jerry; Sanders, Frances; Wood, Linda; Wu, Tian-Xia; Karppinen, Jaro; Nikolajsen, Lone; Männikkö, Minna; Max, Mitchell B; Kiselycznyk, Carly; Poddar, Minakshi; Te Morsche, Rene H M; Smith, Shad; Gibson, Dustin; Kelempisioti, Anthi; Maixner, William; Gribble, Fiona M; Woods, C Geoffrey

    2010-03-16

    The gene SCN9A is responsible for three human pain disorders. Nonsense mutations cause a complete absence of pain, whereas activating mutations cause severe episodic pain in paroxysmal extreme pain disorder and primary erythermalgia. This led us to investigate whether single nucleotide polymorphisms (SNPs) in SCN9A were associated with differing pain perception in the general population. We first genotyped 27 SCN9A SNPs in 578 individuals with a radiographic diagnosis of osteoarthritis and a pain score assessment. A significant association was found between pain score and SNP rs6746030; the rarer A allele was associated with increased pain scores compared to the commoner G allele (P = 0.016). This SNP was then further genotyped in 195 pain-assessed people with sciatica, 100 amputees with phantom pain, 179 individuals after lumbar discectomy, and 205 individuals with pancreatitis. The combined P value for increased A allele pain was 0.0001 in the five cohorts tested (1277 people in total). The two alleles of the SNP rs6746030 alter the coding sequence of the sodium channel Nav1.7. Each was separately transfected into HEK293 cells and electrophysiologically assessed by patch-clamping. The two alleles showed a difference in the voltage-dependent slow inactivation (P = 0.042) where the A allele would be predicted to increase Nav1.7 activity. Finally, we genotyped 186 healthy females characterized by their responses to a diverse set of noxious stimuli. The A allele of rs6746030 was associated with an altered pain threshold and the effect mediated through C-fiber activation. We conclude that individuals experience differing amounts of pain, per nociceptive stimulus, on the basis of their SCN9A rs6746030 genotype.

  18. Leptin-STAT3-G9a Signaling Promotes Obesity-Mediated Breast Cancer Progression.

    Science.gov (United States)

    Chang, Chao-Ching; Wu, Meng-Ju; Yang, Jer-Yen; Camarillo, Ignacio G; Chang, Chun-Ju

    2015-06-01

    Obesity has been linked to breast cancer progression but the underlying mechanisms remain obscure. Here we report how leptin, an obesity-associated adipokine, regulates a transcriptional pathway to silence a genetic program of epithelial homeostasis in breast cancer stem-like cells (CSC) that promotes malignant progression. Using genome-wide ChIP-seq and RNA expression profiling, we defined a role for activated STAT3 and G9a histone methyltransferase in epigenetic silencing of miR-200c, which promotes the formation of breast CSCs defined by elevated cell surface levels of the leptin receptor (OBR(hi)). Inhibiting the STAT3/G9a pathway restored expression of miR-200c, which in turn reversed the CSC phenotype to a more differentiated epithelial phenotype. In a rat model of breast cancer driven by diet-induced obesity, STAT3 blockade suppressed the CSC-like OBR(hi) population and abrogated tumor progression. Together, our results show how targeting STAT3-G9a signaling regulates CSC plasticity during obesity-related breast cancer progression, suggesting a novel therapeutic paradigm to suppress CSC pools and limit breast malignancy. ©2015 American Association for Cancer Research.

  19. An SCN9A channelopathy causes congenital inability to experience pain.

    Science.gov (United States)

    Cox, James J; Reimann, Frank; Nicholas, Adeline K; Thornton, Gemma; Roberts, Emma; Springell, Kelly; Karbani, Gulshan; Jafri, Hussain; Mannan, Jovaria; Raashid, Yasmin; Al-Gazali, Lihadh; Hamamy, Henan; Valente, Enza Maria; Gorman, Shaun; Williams, Richard; McHale, Duncan P; Wood, John N; Gribble, Fiona M; Woods, C Geoffrey

    2006-12-14

    The complete inability to sense pain in an otherwise healthy individual is a very rare phenotype. In three consanguineous families from northern Pakistan, we mapped the condition as an autosomal-recessive trait to chromosome 2q24.3. This region contains the gene SCN9A, encoding the alpha-subunit of the voltage-gated sodium channel, Na(v)1.7, which is strongly expressed in nociceptive neurons. Sequence analysis of SCN9A in affected individuals revealed three distinct homozygous nonsense mutations (S459X, I767X and W897X). We show that these mutations cause loss of function of Na(v)1.7 by co-expression of wild-type or mutant human Na(v)1.7 with sodium channel beta(1) and beta(2) subunits in HEK293 cells. In cells expressing mutant Na(v)1.7, the currents were no greater than background. Our data suggest that SCN9A is an essential and non-redundant requirement for nociception in humans. These findings should stimulate the search for novel analgesics that selectively target this sodium channel subunit.

  20. The dendritic cell subtype-restricted C-type lectin Clec9A is a target for vaccine enhancement

    OpenAIRE

    Caminschi, Irina; Proietto, Anna I.; Ahmet, Fatma; Kitsoulis, Susie; Shin Teh, Joo; Lo, Jennifer C. Y.; Rizzitelli, Alexandra; Wu, Li; Vremec, David; van Dommelen, Serani L.H.; Campbell, Ian K.; Maraskovsky, Eugene; Braley, Hal; Davey, Gayle M.; Mottram, Patricia

    2008-01-01

    A novel dendritic cell (DC)–restricted molecule, Clec9A, was identified by gene expression profiling of mouse DC subtypes. Based on sequence similarity, a human ortholog was identified. Clec9A encodes a type II membrane protein with a single extracellular C-type lectin domain. Both the mouse Clec9A and human CLEC9A were cloned and expressed, and monoclonal antibodies (mAbs) against each were generated. Surface staining revealed that Clec9A was selective for mouse DCs and was restricted to the...

  1. Copper(II) complexes of alloferon 1 with point mutations (H1A) and (H9A) stability structure and biological activity.

    Science.gov (United States)

    Matusiak, Agnieszka; Kuczer, Mariola; Czarniewska, Elżbieta; Rosiński, Grzegorz; Kowalik-Jankowska, Teresa

    2014-09-01

    Mono- and polynuclear copper(II) complexes of the alloferon 1 with point mutations (H1A) A(1)GVSGH(6)GQH(9)GVH(12)G (Allo1A) and (H9A) H(1)GVSGH(6)GQA(9)GVH(12)G (Allo9A) have been studied by potentiometric, UV-visible, CD, EPR spectroscopic and mass spectrometry (MS) methods. To obtain a complete complex speciation different metal-to-ligand molar ratios ranging from 1:1 to 4:1 for Allo1A and to 3:1 for Allo9A were studied. The presence of the His residue in first position of the peptide chain changes the coordination abilities of the Allo9A peptide in comparison to that of the Allo1A. Imidazole-N3 atom of N-terminal His residue of the Allo9A peptide forms stable 6-membered chelate with the terminal amino group. Furthermore, the presence of two additional histidine residues in the Allo9A peptide (H(6),H(12)) leads to the formation of the CuL complex with 4N {NH2,NIm-H(1),NIm-H(6),NIm-H(12)} binding site in wide pH range (5-8). For the Cu(II)-Allo1A system, the results demonstrated that at physiological pH7.4 the predominant complex the CuH-1L consists of the 3N {NH2,N(-),CO,NIm} coordination mode. The inductions of phenoloxidase activity and apoptosis in vivo in Tenebrio molitor cells by the ligands and their copper(II) complexes at pH7.4 were studied. The Allo1A, Allo1K peptides and their copper(II) complexes displayed the lowest hemocytotoxic activity while the most active was the Cu(II)-Allo9A complex formed at pH7.4. The results may suggest that the N-terminal-His(1) and His(6) residues may be more important for their proapoptotic properties in insects than those at positions 9 and 12 in the peptide chain.

  2. The purine-utilizing bacterium Clostridium acidurici 9a: a genome-guided metabolic reconsideration.

    Directory of Open Access Journals (Sweden)

    Katrin Hartwich

    Full Text Available Clostridium acidurici is an anaerobic, homoacetogenic bacterium, which is able to use purines such as uric acid as sole carbon, nitrogen, and energy source. Together with the two other known purinolytic clostridia C. cylindrosporum and C. purinilyticum, C. acidurici serves as a model organism for investigation of purine fermentation. Here, we present the first complete sequence and analysis of a genome derived from a purinolytic Clostridium. The genome of C. acidurici 9a consists of one chromosome (3,105,335 bp and one small circular plasmid (2,913 bp. The lack of candidate genes encoding glycine reductase indicates that C. acidurici 9a uses the energetically less favorable glycine-serine-pyruvate pathway for glycine degradation. In accordance with the specialized lifestyle and the corresponding narrow substrate spectrum of C. acidurici 9a, the number of genes involved in carbohydrate transport and metabolism is significantly lower than in other clostridia such as C. acetobutylicum, C. saccharolyticum, and C. beijerinckii. The only amino acid that can be degraded by C. acidurici is glycine but growth on glycine only occurs in the presence of a fermentable purine. Nevertheless, the addition of glycine resulted in increased transcription levels of genes encoding enzymes involved in the glycine-serine-pyruvate pathway such as serine hydroxymethyltransferase and acetate kinase, whereas the transcription levels of formate dehydrogenase-encoding genes decreased. Sugars could not be utilized by C. acidurici but the full genetic repertoire for glycolysis was detected. In addition, genes encoding enzymes that mediate resistance against several antimicrobials and metals were identified. High resistance of C. acidurici towards bacitracin, acriflavine and azaleucine was experimentally confirmed.

  3. Linkage between increased nociception and olfaction via a SCN9A haplotype.

    Directory of Open Access Journals (Sweden)

    Dirk Heimann

    Full Text Available BACKGROUND AND AIMS: Mutations reducing the function of Nav1.7 sodium channels entail diminished pain perception and olfactory acuity, suggesting a link between nociception and olfaction at ion channel level. We hypothesized that if such link exists, it should work in both directions and gain-of-function Nav1.7 mutations known to be associated with increased pain perception should also increase olfactory acuity. METHODS: SCN9A variants were assessed known to enhance pain perception and found more frequently in the average population. Specifically, carriers of SCN9A variants rs41268673C>A (P610T; n = 14 or rs6746030C>T (R1150W; n = 21 were compared with non-carriers (n = 40. Olfactory function was quantified by assessing odor threshold, odor discrimination and odor identification using an established olfactory test. Nociception was assessed by measuring pain thresholds to experimental nociceptive stimuli (punctate and blunt mechanical pressure, heat and electrical stimuli. RESULTS: The number of carried alleles of the non-mutated SCN9A haplotype rs41268673C/rs6746030C was significantly associated with the comparatively highest olfactory threshold (0 alleles: threshold at phenylethylethanol dilution step 12 of 16 (n = 1, 1 allele: 10.6±2.6 (n = 34, 2 alleles: 9.5±2.1 (n = 40. The same SCN9A haplotype determined the pain threshold to blunt pressure stimuli (0 alleles: 21.1 N/m(2, 1 allele: 29.8±10.4 N/m(2, 2 alleles: 33.5±10.2 N/m(2. CONCLUSIONS: The findings established a working link between nociception and olfaction via Nav1.7 in the gain-of-function direction. Hence, together with the known reduced olfaction and pain in loss-of-function mutations, a bidirectional genetic functional association between nociception and olfaction exists at Nav1.7 level.

  4. STS-26 crew in JSC Shuttle Mockup and Integration Laboratory Bldg 9A

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, crewmembers model the new (navy blue) partial pressure suits (launch and entry suits (LESs)) for entry and launch phases before a training exercise in JSC's Shuttle Mockup and Integration Laboratory Bldg 9A. Pictured (left to right) are Mission Specialist (MS) David C. Hilmers, Commander Frederick H. Hauck, Pilot Richard O. Covey, MS John M. Lounge, and MS George D. Nelson. During Crew Station Review (CSR) #3, the crew is scheduled to check out the new partial pressure suits and crew escape system (CES) configurations to evaluate crew equipment and procedures related to emergency egress methods and proposed crew escape options.

  5. Note: Development of 9 A current source for precise resistance measurement method.

    Science.gov (United States)

    Štambuk, Igor; Malarić, Roman

    2012-10-01

    In this Note, design of voltage controlled current source intended to be used in precise resistance measurement system in the range from 0.1 mΩ to 10 Ω is presented. The design specifications of current source include gross-tuning of current in the range from 0.1 mA to 9 A, low noise, low temperature coefficient, and short term stability better than 50 ppm. The realized current source has achieved better short term stability than comparable commercial devices.

  6. SCN9A channelopathy associated autosomal recessive Congenital Indifference to Pain. A case report.

    Science.gov (United States)

    Rajasekharan, S; Martens, L; Domingues, L; Cauwels, R

    2017-03-01

    Congenital Indifference to Pain (CIP) is a rare condition that inhibits the ability of patients to perceive physical pain but otherwise keeps normal sensory modalities. The condition has been mapped to an autosomal recessive trait to chromosome 2q 24.3 with mutations on the SCN9A gene. A 2 year old Caucasian female presented with CIP. Bite injuries, tongue wounds and unaccounted dental trauma episodes were frequently reported. Preventive instructions and possible treatment modalities were discussed with the parents. The cornerstone of treating CIP patients is an extensive preventive approach alongside regular oral examination at home by parents as well as routine recall appointments with dentists.

  7. Inhibition of H3K9 methyltransferase G9a induces autophagy and apoptosis in oral squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Aishu; Qiu, Yu [Chongqing Key Laboratory for Oral Diseases and Biomedical Sciences, Chongqing Medical University, Chongqing, 401147 (China); Affiliated Hospital of Stomatology, Chongqing Medical University, Chongqing, 401147 (China); Cui, Hongjuan [State Key Laboratory of Silkworm Genome Biology, Southwest University, Chongqing, 400716 (China); Fu, Gang, E-mail: fg.ras@hotmail.com [Chongqing Key Laboratory for Oral Diseases and Biomedical Sciences, Chongqing Medical University, Chongqing, 401147 (China); Affiliated Hospital of Stomatology, Chongqing Medical University, Chongqing, 401147 (China)

    2015-03-27

    Objective: To explore whether inhibition of H3K9 Methyltransferase G9a could exert an antitumoral effect in oral squamous cell carcinoma (OSCC). Materials and methods: First we checked G9a expression in two OSCC cell lines Tca8113 and KB. Next we used a special G9a inhibitor BIX01294 (BIX) to explore the effect of inhibition of G9a on OSCC in vitro. Cell growth was tested by typlan blue staining, MTT assay and Brdu immunofluorescence staining. Cell autophagy was examined by monodansylcadaverine (MDC) staining, LC3-II immunofluorescence staining and LC3-II western blot assay. Cell apoptosis was checked by FITC Annexin-V and PI labeling, tunnel staining and caspase 3 western blot assay. Finally, the effect of inhibition of G9a on clonogenesis and tumorigenesis capacity of OSCC was analyzed by soft agar growth and xenograft model. Results: Here we showed that G9a was expressed in both Tca8113 and KB cells. Inhibition of G9a using BIX significantly reduced cell growth and proliferation in Tca8113 and KB. Inhibition of G9a induced cell autophagy with conversion of LC3-I to LC3-II and cell apoptosis with the expression of cleaved caspase 3. We also found that inhibition of G9a reduced colony formation in soft agar and repressed tumor growth in mouse xenograph model. Conclusion: Our results suggested that G9a might be a potential epigenetic target for OSCC treatment. - Highlights: • Inhibition of G9a reduced cell growth and proliferation in OSCC cells. • Inhibition of G9a induces autophagy and apoptosis in OSCC cells. • Inhibition of G9a repressed tumor growth in mouse xenograph model.

  8. Severe case and literature review of primary erythromelalgia: novel SCN9A gene mutation.

    Science.gov (United States)

    Skeik, Nedaa; Rooke, Thom W; Davis, Mark Denis P; Davis, Dawn Marie R; Kalsi, Henna; Kurth, Ingo; Richardson, Randal C

    2012-02-01

    Erythromelalgia is a rare clinical syndrome characterized by intermittent heat, redness, swelling and pain more commonly affecting the lower extremities. Symptoms are mostly aggravated by warmth and are eased by a cold temperature. In some cases, symptoms can be very severe and disabling. Erythromelalgia can be classified as either familial or sporadic, with the familial form inherited in an autosomal dominant manner. Recently, there has been a lot of progress in studying Na(v)1.7 sodium channels (expressed mostly in the sympathetic and nociceptive small-diameter sensory neurons of the dorsal root ganglion) and different mutations affecting the encoding SCN9A gene that leads to channelopathies responsible for some disorders, including primary erythromelalgia. We present a severe case of progressive primary erythromelalgia caused by a new de novo heterozygous missense mutation (c.2623C>G) of the SCN9A gene which substitutes glutamine 875 by glutamic acid (p.Q875E). To our knowledge, this mutation has not been previously reported in the literature. We also provided a short literature review about erythromelalgia and Na(v) sodium channelopathies.

  9. C-11 cyanide production system

    Science.gov (United States)

    Kim, Dohyun; Alexoff, David; Kim, Sung Won; Hooker, Jacob; Ferrieri, Richard A

    2015-01-13

    A method for providing .sup.11C-labeled cyanides from .sup.11C labeled oxides in a target gas stream retrieved from an irradiated high pressure gaseous target containing O.sub.2 is provided, wherein .sup.11C labeled oxides are reduced with H.sub.2 in the presence of a nickel catalyst under a pressure and a temperature sufficient to form a product stream comprising at least about 95% .sup.11CH.sup.4 , the .sup.11CH.sub.4 is then combined with an excess of NH.sub.3 in a carrier/reaction stream flowing at an accelerated velocity and the combined .sup.11CH4 carrier/reaction stream is then contacted with a platinum (Pt) catalyst particulate supported on a substantially-chemically-nonreactive heat-stable support at a temperature of at least about 900 .degree. C., whereby a product stream comprising at least about 60%H.sup.11CN is provided in less than 10 minutes from retrieval of the .sup.11C labeled oxide.

  10. .11

    African Journals Online (AJOL)

    Infantile colic can be distressing to parents whose infant is inconsolable during ... ing, offer balanced advice on treatments, and provide support to the family. ... colic, and method of data collection.1'2 ... paternal) personality or anxiety causes.

  11. 11 CFR 9405.11 - Miscellaneous fee provisions.

    Science.gov (United States)

    2010-01-01

    ... FREEDOM OF INFORMATION ACT § 9405.11 Miscellaneous fee provisions. (a) Charging Interest—notice and rate... determining whether a belief would be reasonable is the time period over which the requests have occurred. (d...

  12. VLTI+MIDI STUDY OF THE HIGH MASS PROTOSTELLAR CANDIDATE NGC3603 IRS 9A

    Directory of Open Access Journals (Sweden)

    D. E. A. Nürnberger

    2010-01-01

    Full Text Available La formaci n y evoluci n temprana de estrellas gran masa est entre los temas m s \\calientes" en astrof sica. Los estudios interferom tricos de estas estrellas jovenes y de sus ambientes circunestelares (envolturas, discos y jets en las longitudes de onda del infrarrojo cercano y medio a n son escasos y en t erminos de su an lisis de datos/interpretaci n muy desa antes. Aqu reportamos sobre observaciones del candidato protoestelar de alta masa NGC3603 IRS 9A que emprendimos con VLTI+MIDI en el 2005, complementado por im genes en el infrarrojo cercano y medio y datos espectrosc picos. Discutimos nuestros resultados obtenidos mediante dedicados esfuerzos de modelado, empleando ambos c digos DUSTY y MC3D de transferencia radiativa para un n mero seleccionado de geometr as de la fuente y distribuciones super ciales del brillo.

  13. Strange meson production in Al+Al collisions at 1.9A GeV

    CERN Document Server

    Gasik, P; Herrmann, N; Leifels, Y; Matulewicz, T; Andronic, A; Averbeck, R; Barret, V; Basrak, Z; Bastid, N; Benabderrahmane, M L; Berger, M; Buehler, P; Cargnelli, M; Čaplar, R; Crochet, P; Czerwiakowa, O; Deppner, I; Dupieux, P; Dželalija, M; Fabbietti, L; Fodor, Z; Gašparić, I; Grishkin, Y; Hartmann, O N; Hildenbrand, K D; Hong, B; Kang, T I; Kecskemeti, J; Kim, Y J; Kirejczyk, M; Kiš, M; Koczon, P; Kotte, R; Lebedev, A; Fèvre, A Le; Liu, J L; Lopez, X; Manko, V; Marton, J; Münzer, R; Petrovici, M; Rami, F; Reischl, A; Reisdorf, W; Ryu, M S; Schmidt, P; Schüttauf, A; Seres, Z; Sikora, B; Sim, K S; Simion, V; Siwek-Wilczyńska, K; Smolyankin, V; Suzuki, K; Tymiński, Z; Wagner, P; Weber, I; Widmann, E; Wiśniewski, K; Xiao, Z G; Yushmanov, I; Zhang, Y; Zhilin, A; Zinyuk, V; Zmeskal, J

    2015-01-01

    The production of K$^+$, K$^-$ and $\\varphi$(1020) mesons is studied in Al+Al collisions at beam energy of 1.9A GeV which is close or below the production threshold in NN reactions. Inverse slopes, anisotropy parameters, and total emission yields of K$^{\\pm}$ mesons are obtained. A comparison of the ratio of kinetic energy distributions of K$^-$ and K$^+$ mesons to the HSD transport model calculations suggests that the inclusion of in-medium modifications of kaon properties is necessary to reproduce the ratio. The inverse slope and total yield of $\\phi$ mesons are deduced. The contribution to K$^-$ production from $\\phi$ meson decays is found to be [17 $\\pm$ 3 (stat) $^{+2}_{-7}$ (syst)] %. The results are in line with previous K$^{\\pm}$ and $\\phi$ data obtained for different colliding systems at similar incident beam energies.

  14. Student experimenter stands near middeck lockers in JSC Bldg 9A mockup

    Science.gov (United States)

    1991-01-01

    Student experimenter Constantine Costes, STS-42 Commander Ronald J. Grabe, STS-42 Mission Specialist (MS) William F. Readdy, and Integration Engineer Neal Christie discuss Coates' student experiment 83-02 (SE 83-02) entitled 'Zero-G Capillary Rise of Liquid through Granular Porous Media' in JSC Mockup and Integration Laboratory Bldg 9A Full Fuselage Trainer (FFT). On FFT middeck, Costes stands behind Readdy (kneeling) as Christie demonstrates experiment setup and Grabe looks on (47326). The team also examines experiment components at middeck stowage locker (47323) and at FFT open side hatch (47324, 47325). The experiment is designed to investigate the capillary and forced flow characteristics of blue-tinted water in three glass tubes with three sizes of glass beads. SE 83-02 is scheduled to be flown on STS-42 aboard Discovery, Orbiter Vehicle (OV) 103.

  15. STS-26 crew training in JSC Shuttle Mockup and Integration Laboratory Bldg 9A

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, crewmembers use a bit of orchestrated humor to demonstrate the aft (back) zipper feature on the new (navy blue) partial pressure suits (launch and entry suits (LESs)) before a training exercise in JSC's Shuttle Mockup and Integration Laboratory Bldg 9A. Left to right are Commander Frederick H. Hauck, Mission Specialist (MS) George D. Nelson, MS David C. Hilmers, MS John M. Lounge, and Pilot Richard O. Covey. During Crew Station Review (CSR) #3, the crew is scheduled to check out the new partial pressure suits and crew escape system (CES) configurations to evaluate crew equipment and procedures related to emergency egress methods and proposed crew escape options.

  16. Congenital insensitivity to pain: novel SCN9A missense and in-frame deletion mutations.

    Science.gov (United States)

    Cox, James J; Sheynin, Jony; Shorer, Zamir; Reimann, Frank; Nicholas, Adeline K; Zubovic, Lorena; Baralle, Marco; Wraige, Elizabeth; Manor, Esther; Levy, Jacov; Woods, C Geoffery; Parvari, Ruti

    2010-09-01

    SCN9Aencodes the voltage-gated sodium channel Na(v)1.7, a protein highly expressed in pain-sensing neurons. Mutations in SCN9A cause three human pain disorders: bi-allelic loss of function mutations result in Channelopathy-associated Insensitivity to Pain (CIP), whereas activating mutations cause severe episodic pain in Paroxysmal Extreme Pain Disorder (PEPD) and Primary Erythermalgia (PE). To date, all mutations in SCN9A that cause a complete inability to experience pain are protein truncating and presumably lead to no protein being produced. Here, we describe the identification and functional characterization of two novel non-truncating mutations in families with CIP: a homozygously-inherited missense mutation found in a consanguineous Israeli Bedouin family (Na(v)1.7-R896Q) and a five amino acid in-frame deletion found in a sporadic compound heterozygote (Na(v)1.7-DeltaR1370-L1374). Both of these mutations map to the pore region of the Na(v)1.7 sodium channel. Using transient transfection of PC12 cells we found a significant reduction in membrane localization of the mutant protein compared to the wild type. Furthermore, voltage clamp experiments of mutant-transfected HEK293 cells show a complete loss of function of the sodium channel, consistent with the absence of pain phenotype. In summary, this study has identified critical amino acids needed for the normal subcellular localization and function of Na(v)1.7.

  17. ISS Expedition 11 Press Kit

    Data.gov (United States)

    National Aeronautics and Space Administration — Press kit for ISS mission Expedition 11 from 04/2005-10/2005. Press kits contain information about each mission overview, crew, mission timeline, benefits, and media...

  18. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Keywords: guest reviews, hotel ratings, marketing, social media. Geven de sociale media ... their offerings (online travel agents), or to generate income from referrals to ...... TripAdvisor tries to respond to fake hotel reviews. Newsweek, 11 June ...

  19. Turning physics up to 11

    CERN Multimedia

    2008-01-01

    Rock guitars, superstrings, 11 dimensions and the world's largest and highest energy particle accelerator are the lead instruments for the Institute of Physics' latest drive to get kids interested in science.

  20. 11 Theses on Entrepreneurship Education

    DEFF Research Database (Denmark)

    Blenker, Per

    2015-01-01

    . These theses are formulated around questions of the ontology of entrepreneurship, the entrepreneurial process, entrepreneurial learning and entrepreneurship education. Results The 11 theses are short, precise and constitute a framework, which educators and researchers can use either for agreeing or disagreeing......Questions I care about How can I best contribute to establishing clarity and precision to the way we develop the central elements of entrepreneurship education research? Approach Inspired by Karl Marx´s 11 theses on Feuerbach the paper establishes 11 short theses on entrepreneurship education...... on what should be the foundation of entrepreneurship education research. Implications The paper produces a few central statements (theses) that entrepreneurship educators and entrepreneurship education researchers would benefit from either agreeing or disagreeing on. Value/Originality The 11 theses...

  1. Syntheses of 11-hydroxylated guaianolides

    DEFF Research Database (Denmark)

    Lauridsen, A.; Cornett, Claus; Vulpius, T.;

    1996-01-01

    Two epimeric guaianolides, both prepared from alpha-santonin, were 11-hydroxylated using 2-phenylsulfonyl-3-phenyloxaziridine as a reagent. Extensive use of protecting groups enabled selective acylation of the 3- and 10-hydroxy groups....

  2. HUC 8-11 Boundaries

    Data.gov (United States)

    Kansas Data Access and Support Center — This data set is a digital hydrologic unit boundary that is at the 4-digit, 6-digit, 8-digit, and 11-digit level. The data set was developed by delineating the...

  3. Interaction between bradykinin potentiating nonapeptide (BPP9a) and {beta}-cyclodextrin: A structural and thermodynamic study

    Energy Technology Data Exchange (ETDEWEB)

    Lula, Ivana; De Sousa, Frederico B. [Departamento de Quimica, Instituto de Ciencias Exatas, Universidade Federal de Minas Gerais, Av. Antonio Carlos, 6627, 31270-901, Belo Horizonte, MG (Brazil); Denadai, Angelo M.L. [Centro Federal de Educacao Tecnologica de Minas Gerais, CEFET-MG, Campus VII, 35.183-006, Timoteo, MG (Brazil); Ferreira de Lima, Guilherme; Duarte, Helio Anderson [Departamento de Quimica, Instituto de Ciencias Exatas, Universidade Federal de Minas Gerais, Av. Antonio Carlos, 6627, 31270-901, Belo Horizonte, MG (Brazil); Mares Guia, Thiago R. dos [Departamento de Bioquimica e Imunologia, ICB, Universidade Federal de Minas Gerais, 31270-901, Belo Horizonte, MG (Brazil); Faljoni-Alario, Adelaide [Departamento de Bioquimica, Instituto de Quimica, Universidade de Sao Paulo, 05508-900, Sao Paulo, SP (Brazil); Santoro, Marcelo M. [Departamento de Bioquimica e Imunologia, ICB, Universidade Federal de Minas Gerais, 31270-901, Belo Horizonte, MG (Brazil); Camargo, Antonio C.M. de [Center for Applied Toxinology CAT-CEPID, Laboratorio Especial de Toxicologia Aplicada, Instituto Butantan, 05503-900, Sao Paulo, SP (Brazil); Santos, Robson A.S. dos [Departamento de Fisiologia e Biofisica, ICB, Universidade Federal de Minas Gerais, 31270-901, Belo Horizonte, MG (Brazil); and others

    2012-02-01

    Herein, we demonstrate the physical and chemical characterizations of the supramolecular complex formed between {beta}-cyclodextrin ({beta}CD) and bradykinin potentiating nonapeptide (BPP9a), an endogenous toxin found in Bothrops jararaca. Circular dichroism results indicate a conformational change in the BPP9a secondary structure upon its complexation with {beta}CD. Nuclear magnetic resonance results, mainly from NOESY experiments, and theoretical calculations showed a favorable interaction between the tryptophan residue of BPP9a and the {beta}CD cavity. Thermodynamic inclusion parameters were investigated by isothermal titration calorimetry, demonstrating that {beta}CD/BPP9a complex formation is an exothermic process that results in a reduction in entropy. Additionally, in vitro degradation study of BPP9a against trypsin (37 Degree-Sign C, pH 7.2) showed higher stability of peptide in presence of {beta}CD. This {beta}CD/BPP9a complex, which presents new chemical properties arising from the peptide inclusion process, may be useful as an antihypertensive drug in oral pharmaceutical formulations. Highlights: Black-Right-Pointing-Pointer Cd and NMR showed evidences for the existence of more than one structure in solution. Black-Right-Pointing-Pointer Complexation with {beta}CD reduces the conformational rigidity of the peptide. Black-Right-Pointing-Pointer {beta}CD cavity recognize Trp and/or Pro segments of BPP9a. Black-Right-Pointing-Pointer Interactions involving disaggregation of BPP9a assemblies and binding with {beta}CD.

  4. Regulation of Nav1.7 : A Conserved SCN9A Natural Antisense Transcript Expressed in Dorsal Root Ganglia

    NARCIS (Netherlands)

    Koenig, Jennifer; Werdehausen, Robert; Linley, John E; Habib, Abdella M; Vernon, Jeffrey; Lolignier, Stephane; Eijkelkamp, Niels; Zhao, Jing; Okorokov, Andrei L; Woods, C Geoffrey; Wood, John N; Cox, James J

    2015-01-01

    The Nav1.7 voltage-gated sodium channel, encoded by SCN9A, is critical for human pain perception yet the transcriptional and post-transcriptional mechanisms that regulate this gene are still incompletely understood. Here, we describe a novel natural antisense transcript (NAT) for SCN9A that is conse

  5. VLTI/MIDI Observations of the Massive Protostellar Candidate NGC 3603 IRS 9A

    CERN Document Server

    Vehoff, Stefan; Hummel, Christian A; Duschl, Wolfgang J

    2007-01-01

    We used MIDI, the mid-infrared interferometric instrument of the VLTI, to observe the massive protostellar candidate IRS 9A, located at a distance of about 7 kpc at the periphery of the NGC 3603 star cluster. Our ongoing analysis shows that MIDI almost fully resolves the object on all observed baselines, yet below 9 $\\mu$m we detect a steep rise of the visibility. This feature is modelled as a combination of a compact hot component and a resolved warm envelope which lowers the correlated flux at longer wavelengths. The extended envelope can already be seen in both MIDI's acquisition images and in complementary data from aperture masking observations at the Gemini South telescope. Its shape is asymmetric, which could indicate a circumstellar disk inclined against the line of sight. The compact component is possibly related to the inner edge of this (accretion) disk. The uncorrelated mid-infrared spectrum appears featureless and could be caused by optically thick emission without a significant contribution from...

  6. Draft crystal structure of the vault shell at 9-A resolution.

    Directory of Open Access Journals (Sweden)

    Daniel H Anderson

    2007-11-01

    Full Text Available Vaults are the largest known cytoplasmic ribonucleoprotein structures and may function in innate immunity. The vault shell self-assembles from 96 copies of major vault protein and encapsulates two other proteins and a small RNA. We crystallized rat liver vaults and several recombinant vaults, all among the largest non-icosahedral particles to have been crystallized. The best crystals thus far were formed from empty vaults built from a cysteine-tag construct of major vault protein (termed cpMVP vaults, diffracting to about 9-A resolution. The asymmetric unit contains a half vault of molecular mass 4.65 MDa. X-ray phasing was initiated by molecular replacement, using density from cryo-electron microscopy (cryo-EM. Phases were improved by density modification, including concentric 24- and 48-fold rotational symmetry averaging. From this, the continuous cryo-EM electron density separated into domain-like blocks. A draft atomic model of cpMVP was fit to this improved density from 15 domain models. Three domains were adapted from a nuclear magnetic resonance substructure. Nine domain models originated in ab initio tertiary structure prediction. Three C-terminal domains were built by fitting poly-alanine to the electron density. Locations of loops in this model provide sites to test vault functions and to exploit vaults as nanocapsules.

  7. Extracellular proteases of Halobacillus blutaparonensis strain M9, a new moderately halophilic bacterium

    Science.gov (United States)

    Santos, Anderson F.; Valle, Roberta S.; Pacheco, Clarissa A.; Alvarez, Vanessa M.; Seldin, Lucy; Santos, André L.S.

    2013-01-01

    Halophilic microorganisms are source of potential hydrolytic enzymes to be used in industrial and/or biotechnological processes. In the present study, we have investigated the ability of the moderately halophilic bacterium Halobacillus blutaparonensis (strain M9), a novel species described by our group, to release proteolytic enzymes. This bacterial strain abundantly proliferated in Luria-Bertani broth supplemented with 2.5% NaCl as well as secreted proteases to the extracellular environment. The production of proteases occurred in bacterial cells grown under different concentration of salt, ranging from 0.5% to 10% NaCl, in a similar way. The proteases secreted by H. blutaparonensis presented the following properties: (i) molecular masses ranging from 30 to 80 kDa, (ii) better hydrolytic activities under neutral-alkaline pH range, (iii) expression modulated according to the culture age, (iv) susceptibility to phenylmethylsulphonyl fluoride, classifying them as serine-type proteases, (v) specific cleavage over the chymotrypsin substrate, and (vi) enzymatic stability in the presence of salt (up to 20% NaCl) and organic solvents (e.g., ether, isooctane and cyclohexane). The proteases described herein are promising for industrial practices due to its haloalkaline properties. PMID:24688526

  8. Extracellular proteases of Halobacillus blutaparonensis strain M9, a new moderately halophilic bacterium

    Directory of Open Access Journals (Sweden)

    Anderson F. Santos

    2013-12-01

    Full Text Available Halophilic microorganisms are source of potential hydrolytic enzymes to be used in industrial and/or biotechnological processes. In the present study, we have investigated the ability of the moderately halophilic bacterium Halobacillus blutaparonensis (strain M9, a novel species described by our group, to release proteolytic enzymes. This bacterial strain abundantly proliferated in Luria-Bertani broth supplemented with 2.5% NaCl as well as secreted proteases to the extracellular environment. The production of proteases occurred in bacterial cells grown under different concentration of salt, ranging from 0.5% to 10% NaCl, in a similar way. The proteases secreted by H. blutaparonensis presented the following properties: (i molecular masses ranging from 30 to 80 kDa, (ii better hydrolytic activities under neutral-alkaline pH range, (iii expression modulated according to the culture age, (iv susceptibility to phenylmethylsulphonyl fluoride, classifying them as serine-type proteases, (v specific cleavage over the chymotrypsin substrate, and (vi enzymatic stability in the presence of salt (up to 20% NaCl and organic solvents (e.g., ether, isooctane and cyclohexane. The proteases described herein are promising for industrial practices due to its haloalkaline properties.

  9. Draft crystal structure of the vault shell at 9-A resolution.

    Science.gov (United States)

    Anderson, Daniel H; Kickhoefer, Valerie A; Sievers, Stuart A; Rome, Leonard H; Eisenberg, David

    2007-11-01

    Vaults are the largest known cytoplasmic ribonucleoprotein structures and may function in innate immunity. The vault shell self-assembles from 96 copies of major vault protein and encapsulates two other proteins and a small RNA. We crystallized rat liver vaults and several recombinant vaults, all among the largest non-icosahedral particles to have been crystallized. The best crystals thus far were formed from empty vaults built from a cysteine-tag construct of major vault protein (termed cpMVP vaults), diffracting to about 9-A resolution. The asymmetric unit contains a half vault of molecular mass 4.65 MDa. X-ray phasing was initiated by molecular replacement, using density from cryo-electron microscopy (cryo-EM). Phases were improved by density modification, including concentric 24- and 48-fold rotational symmetry averaging. From this, the continuous cryo-EM electron density separated into domain-like blocks. A draft atomic model of cpMVP was fit to this improved density from 15 domain models. Three domains were adapted from a nuclear magnetic resonance substructure. Nine domain models originated in ab initio tertiary structure prediction. Three C-terminal domains were built by fitting poly-alanine to the electron density. Locations of loops in this model provide sites to test vault functions and to exploit vaults as nanocapsules.

  10. C9.A/14 steelwork joints de poutres par plaque frontale : assemblages par gousset

    CERN Document Server

    2015-01-01

    Les Tables de résistances ultimes des assemblages boulonnés par plaque frontale et par gousset, complétées par une description des modèles de calcul et des exemples d’application, ont pour but de faciliter la tâche de l'ingénieur et du constructeur. Cette première partie C9.A/14 contient les chapitres suivants: - Joints de poutres par plaque frontale en acier S235 et S355 - Assemblages par gousset en acier S235 et S355 Les Tables contiennent des données relatives à la géométrie ainsi que les valeurs de calcul correspondantes des résistances ultimes des assemblages ; elles remplacent le chapitre « Assemblages par plaques frontales et boulons HR » des anciennes Tables C9.1 de 1983 / 2002. Le calcul de ces assemblages par plaque frontale est basé sur les hypothèses du modèle de la méthode des composants décrite dans la norme SN EN 1993-1-8. Les vérifications sont effectuées selon la norme SIA 263:2013. Les assemblages par gousset remplacent les assemblages par double cornière, (telle...

  11. 11 CFR 9004.11 - Winding down costs.

    Science.gov (United States)

    2010-01-01

    ... winding down costs that may be paid for with public funds shall not exceed the lesser of: (1) 2.5% of the expenditure limitation pursuant to 11 CFR 110.8(a)(2); or (2) 2.5% of the total of: (i) The candidate's expenditures subject to the expenditure limitation as of the end of the expenditure report period; plus (ii...

  12. Notes on 11 September | Apuntes sobre el 11 de septiembre

    Directory of Open Access Journals (Sweden)

    Marco Palla

    2002-12-01

    Full Text Available The analysis of the immediate present should arouse the interest of professional historians as witnesses of their time. Their capacity for historical foresight generated by events such as those of 11 September ought to go beyond the immediate ‘chronicle’ and aspire instead to a more ‘reflective’ history. The events of 11 September should therefore be seen as part of a wider process, and as a catalyst accelerating trends which had already begun. | El análisis del presente inmediato debe suscitar el interés del historiador profesional como testigo de su época. Su capacidad de previsión histórica a partir de acontecimientos como los sucedidos el 11 de septiembre debe superar la «historiacrónica » en beneficio de la «larga duración». El 11 de septiembre se inserta así en un proceso más amplio, acelerando tendencias en marcha.

  13. Role of the sodium channel SCN9A in genetic epilepsy with febrile seizures plus and Dravet syndrome.

    Science.gov (United States)

    Mulley, John C; Hodgson, Bree; McMahon, Jacinta M; Iona, Xenia; Bellows, Susannah; Mullen, Saul A; Farrell, Kevin; Mackay, Mark; Sadleir, Lynette; Bleasel, Andrew; Gill, Deepak; Webster, Richard; Wirrell, Elaine C; Harbord, Michael; Sisodiya, Sanyjay; Andermann, Eva; Kivity, Sara; Berkovic, Samuel F; Scheffer, Ingrid E; Dibbens, Leanne M

    2013-09-01

    Mutations of the SCN1A subunit of the sodium channel is a cause of genetic epilepsy with febrile seizures plus (GEFS(+) ) in multiplex families and accounts for 70-80% of Dravet syndrome (DS). DS cases without SCN1A mutation inherited have predicted SCN9A susceptibility variants, which may contribute to complex inheritance for these unexplained cases of DS. Compared with controls, DS cases were significantly enriched for rare SCN9A genetic variants. None of the multiplex febrile seizure or GEFS(+) families could be explained by highly penetrant SCN9A mutations.

  14. FY11 Force Structure Announcement

    Science.gov (United States)

    2010-01-01

    D-9) Rep E. Towns (D-10) Rep Y. Clarke (D-11) Rep N. Velazquez (D-12) Rep M. McMahon (D-13) Rep C. Maloney (D-14) Rep C. Rangel (D-15) Rep J. Serrano...D-9) Rep E. Towns (D-10) Rep Y. Clarke (D-11) Rep N. Velazquez (D-12) Rep M. McMahon (D-13) Rep C. Maloney (D-14) Rep C. Rangel (D-15) Rep J. Serrano... Velazquez (D-12) Rep M. McMahon (D-13) Rep C. Maloney (D-14) Rep C. Rangel (D-15) Rep J. Serrano (D-16) Rep E. Engel (D-17) Rep N. Lowey (D-18) Rep J

  15. A stop codon mutation in SCN9A causes lack of pain sensation.

    Science.gov (United States)

    Ahmad, Sultan; Dahllund, Leif; Eriksson, Anders B; Hellgren, Dennis; Karlsson, Urban; Lund, Per-Eric; Meijer, Inge A; Meury, Luc; Mills, Tracy; Moody, Adrian; Morinville, Anne; Morten, John; O'donnell, Dajan; Raynoschek, Carina; Salter, Hugh; Rouleau, Guy A; Krupp, Johannes J

    2007-09-01

    The general lack of pain experience is a rare occurrence in humans, and the molecular causes for this phenotype are not well understood. Here we have studied a Canadian family from Newfoundland with members who exhibit a congenital inability to experience pain. We have mapped the locus to a 13.7 Mb region on chromosome 2q (2q24.3-2q31.1). Screening of candidate genes in this region identified a protein-truncating mutation in SCN9A, which encodes for the voltage-gated sodium channel Na(v)1.7. The mutation is a C-A transversion at nucleotide 984 transforming the codon for tyrosine 328 to a stop codon. The predicted product lacks all pore-forming regions of Na(v)1.7. Indeed, expression of this altered gene in a cell line did not produce functional responses, nor did it cause compensatory effects on endogenous voltage-gated sodium currents when expressed in ND7/23 cells. Because a homozygous knockout of Na(v)1.7 in mice has been shown to be lethal, we explored why a deficiency of Na(v)1.7 is non-lethal in humans. Expression studies in monkey, human, mouse and rat tissue indicated species-differences in the Na(v)1.7 expression profile. Whereas in rodents the channel was strongly expressed in hypothalamic nuclei, only weak mRNA levels were detected in this area in primates. Furthermore, primate pituitary and adrenal glands were devoid of signal, whereas these two glands were mRNA-positive in rodents. This species difference may explain the non-lethality of the observed mutation in humans. Our data further establish Na(v)1.7 as a critical element of peripheral nociception in humans.

  16. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 9–17. Printed in ... hospitality industry as well. TripAdvisor is the ... Qatar, Dubai and Abu Dhabi, an industry representative body, .... for the people who invest heavily in a first class hotel and do.

  17. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 25–29. Printed in South Africa ... by which people give meaning to their experiences, especially in new situations. ... managers in this industry also play an important role in the strategic decision ...

  18. American Literature after September 11

    DEFF Research Database (Denmark)

    Bjerre, Thomas Ærvold

    2009-01-01

    Artiklen gennemgår de amerikanske romaner, der behandler terrorangrebene 11. september og tiden derefter. Opsummerer fælles træk ved romanerne og fokuserer til sidst på Don DeLillos Falling Man. Udgivelsesdato: Februar 2009...

  19. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 1–3. Printed in South Africa ... the backdrop of a rapidly evolving industry, the message is of particular significance. Gastronomy is a ... father's restaurant De Echoput. I'm glad that I listened to ...

  20. Construction and detection of expression vectors of microRNA-9a in BmN cells

    Institute of Scientific and Technical Information of China (English)

    Yong HUANG; Quan ZOU; Sheng-peng WANG; Shun-ming TANG; Guo-zheng ZHANG; Xing-jia SHEN

    2011-01-01

    MicroRNAs (miRNAs) are small endogenous RNAs molecules,approximately 21-23 nucleotides in length,which regulate gene expression by base-pairing with 3' untranslated regions (UTRs) of target mRNAs.However,the functions of only a few miRNAs in organisms are known.Recently,the expression vector of artificial miRNA has become a promising tool for gene function studies.Here,a method for easy and rapid construction of eukaryotic miRNA expression vector was described.The cytoplasmic actin 3 (A3) promoter and flanked sequences of miRNA-9a (miR-9a)precursor were amplified from genomic DNA of the silkworm (Bombyx mori) and was inserted into pCDNA3.0 vector to construct a recombinant plasmid.The enhanced green fluorescent protein (EGFP) gene was used as reporter gene.The Bombyx mori N (BmN) cells were transfected with recombinant miR-9a expression plasmid and were harvested 48 h post transfection.Total RNAs of BmN cells transfected with recombinant vectors were extracted and the expression of miR-9a was evaluated by reverse transcriptase polymerase chain reaction (RT-PCR) and Northern blot.Tests showed that the recombinant miR-9a vector was successfully constructed and the expression of miR-9a with EGFP was detected.=miRNA-9a (miR-9a),EGFP gene,Bombyx mori N (BmN) Cells,Expression vector

  1. Bilateral congenital corneal anesthesia in a patient with SCN9A mutation, confirmed primary erythromelalgia, and paroxysmal extreme pain disorder.

    Science.gov (United States)

    Kim, David Ta; Rossignol, Elsa; Najem, Kinda; Ospina, Luis H

    2015-10-01

    The SCN9A gene codes for the sodium voltage-gated channel NaV 1.7. Gain of function mutations cause pain disorders such as primary erythromelalgia, paroxysmal extreme pain disorder, and small fiber neuropathy. Loss of function mutations lead to congenital insensitivity to pain. We report the case of a 6-year-old girl with a SCN9A mutation who presented with both gain of function and loss of function phenotypes, including congenital corneal anesthesia.

  2. Biallelic truncating SCN9A mutation identified in four families with congenital insensitivity to pain from Pakistan.

    Science.gov (United States)

    Sawal, H A; Harripaul, R; Mikhailov, A; Dad, R; Ayub, M; Jawad Hassan, M; Vincent, J B

    2016-12-01

    (a) Homozygosity-mapping-by-descent of four Bhakkar congenital indifference/insensitivity to pain (CIP) families. (b) Identification of mutation Met1190* in SCN9A. (c) SCN9A/NaV1.7 2D structure (as predicted by CCTOP and SMART) and approximate position of known nonsense (*) and missense (M) mutations ( www.hgmd.cf.ac.uk), as well as the Bhakkar mutation (this study) in red.

  3. Long-term remission of primary erythermalgia with R1150W polymorphism in SCN9A after chemical lumbar sympathectomy.

    Science.gov (United States)

    Zhang, Long; Wang, Wen-hui; Li, Lin-feng; Dong, Guo-xiang; Zhao, Jun; Luan, Jing-yuan; Sun, Ting-ting

    2010-01-01

    Primary erythermalgia (PEM) is recalcitrant and long-term remission is difficult to achieve. Favorable results of treatment using carbamazepine or mexiletine have been identified in some PEM patients with SCN9A gene mutations. However, no therapeutic studies regarding patients without pathogenic SCN9A gene mutation have been reported. Here we present a PEM case with R1150W polymorphism in SCN9A and a five-year remission was achieved by chemical lumbar sympathectomy (CLS). A 15-year-old girl with severe PEM attacks in both feet and lower legs was treated with CLS and followed up for five years. The encoding exons and their flanking sequences in the SCN9A gene were amplified and sequenced. A 50% immediate pain reduction was achieved after CLS. Burning pain, erythema and swelling in the lower legs disappeared in four days, and all ulceration healed in a month. The patient resumed normal exercise five months after CLS. There were no relapses in the following five years. R1150W polymorphism in SCN9A was detected in the patient and her healthy father. Long-term remission was achieved after CLS in this PEM case with R1150W polymorphism in SCN9A. The effectiveness of CLS and phenotype/genotype of PEM should be further studied in larger samples.

  4. Regulation of Nav1.7: A Conserved SCN9A Natural Antisense Transcript Expressed in Dorsal Root Ganglia.

    Directory of Open Access Journals (Sweden)

    Jennifer Koenig

    Full Text Available The Nav1.7 voltage-gated sodium channel, encoded by SCN9A, is critical for human pain perception yet the transcriptional and post-transcriptional mechanisms that regulate this gene are still incompletely understood. Here, we describe a novel natural antisense transcript (NAT for SCN9A that is conserved in humans and mice. The NAT has a similar tissue expression pattern to the sense gene and is alternatively spliced within dorsal root ganglia. The human and mouse NATs exist in cis with the sense gene in a tail-to-tail orientation and both share sequences that are complementary to the terminal exon of SCN9A/Scn9a. Overexpression analyses of the human NAT in human embryonic kidney (HEK293A and human neuroblastoma (SH-SY5Y cell lines show that it can function to downregulate Nav1.7 mRNA, protein levels and currents. The NAT may play an important role in regulating human pain thresholds and is a potential candidate gene for individuals with chronic pain disorders that map to the SCN9A locus, such as Inherited Primary Erythromelalgia, Paroxysmal Extreme Pain Disorder and Painful Small Fibre Neuropathy, but who do not contain mutations in the sense gene. Our results strongly suggest the SCN9A NAT as a prime candidate for new therapies based upon augmentation of existing antisense RNAs in the treatment of chronic pain conditions in man.

  5. Regulation of Nav1.7: A Conserved SCN9A Natural Antisense Transcript Expressed in Dorsal Root Ganglia.

    Science.gov (United States)

    Koenig, Jennifer; Werdehausen, Robert; Linley, John E; Habib, Abdella M; Vernon, Jeffrey; Lolignier, Stephane; Eijkelkamp, Niels; Zhao, Jing; Okorokov, Andrei L; Woods, C Geoffrey; Wood, John N; Cox, James J

    2015-01-01

    The Nav1.7 voltage-gated sodium channel, encoded by SCN9A, is critical for human pain perception yet the transcriptional and post-transcriptional mechanisms that regulate this gene are still incompletely understood. Here, we describe a novel natural antisense transcript (NAT) for SCN9A that is conserved in humans and mice. The NAT has a similar tissue expression pattern to the sense gene and is alternatively spliced within dorsal root ganglia. The human and mouse NATs exist in cis with the sense gene in a tail-to-tail orientation and both share sequences that are complementary to the terminal exon of SCN9A/Scn9a. Overexpression analyses of the human NAT in human embryonic kidney (HEK293A) and human neuroblastoma (SH-SY5Y) cell lines show that it can function to downregulate Nav1.7 mRNA, protein levels and currents. The NAT may play an important role in regulating human pain thresholds and is a potential candidate gene for individuals with chronic pain disorders that map to the SCN9A locus, such as Inherited Primary Erythromelalgia, Paroxysmal Extreme Pain Disorder and Painful Small Fibre Neuropathy, but who do not contain mutations in the sense gene. Our results strongly suggest the SCN9A NAT as a prime candidate for new therapies based upon augmentation of existing antisense RNAs in the treatment of chronic pain conditions in man.

  6. 德阳四星FS-CIF11

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    FS-CIF11是德阳四星电子为欧姆龙PLC开发的外设口和RS232到RS422/485接口模快,其功能囊括并超过欧姆龙的CPM1-CIF11(外设口转RS422)、NT-AL001(RS232转RS422)、3G2A9-A12)04-E(RS232转RS422)模块。用于CPM1A/2A、CQM1、C200Hα等系列PLC,可连接PLC的外设口或RS232通信口(自动识别),输出为RS422(四线全双工)或RS485(二线半双工),

  7. RCS043938-2904.9: A New Rich Cluster of Galaxies at z=0.951

    CERN Document Server

    Barrientos, L F; Yee, H K C; Infante, L; Ellingson, E; Hall, P B; Hertling, G; Gladders, Michael D.; Infante, Leopoldo; Ellingson, Erica; Hall, Patrick B.; Hertling, Gisela

    2004-01-01

    We present deep I, J_s, K_s imaging and optical spectroscopy of the newly discovered Red-Sequence Cluster Survey cluster RCS043938-2904.9. This cluster, drawn from an extensive preliminary list, was selected for detailed study on the basis of its apparent optical richness. Spectroscopy of 11 members places the cluster at z=0.951 +- 0.006, and confirms the photometric redshift estimate from the (R-z) color-magnitude diagram. Analysis of the infrared imaging data demonstrates that the cluster is extremely rich, with excess counts in the Ks-band exceeding the expected background counts by 9 sigma. The properties of the galaxies in RCS043938-2904.9 are consistent with those seen in other clusters at similar redshifts. Specifically, the red-sequence color, slope and scatter, and the size-magnitude relation of these galaxies are all consistent with that seen in the few other high redshift clusters known, and indeed are consistent with appropriately evolved properties of local cluster galaxies. The apparent consiste...

  8. 1+1 Gaudin Model

    Directory of Open Access Journals (Sweden)

    Andrei V. Zotov

    2011-07-01

    Full Text Available We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic curve. In sl(2 case we study the equations in detail and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve. We also analyze the 2-site case in its own right and describe its relation to the principal chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  9. 1+1 Gaudin Model

    CERN Document Server

    Zotov, A

    2010-01-01

    We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N) case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic cure. In sl(2) case we study the equations in details and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve). We also analyze the 2-site case in its own right and describe its relation to the principle chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  10. Advances in magnetic resonance 11

    CERN Document Server

    Waugh, John S

    2013-01-01

    Advances in Magnetic Resonance, Volume 11, presents a variety of contributions to the theory and practice of magnetic resonance. The book contains three chapters and begins with a discussion of the principles and applications of dynamic nuclear polarization, with emphasis on molecular motions and collisions, intermolecular couplings, and chemical interactions. Subsequent chapters focus on the assessment of a proposed broadband decoupling method and studies of time-domain (or Fourier transform) multiple-quantum nuclear magnetic resonance.

  11. N-Cyclohexyl-11-(octylthioundecanamide

    Directory of Open Access Journals (Sweden)

    Eva-Maria Schön

    2010-07-01

    Full Text Available A practical synthesis of N-cyclohexyl-11-(octylthioundecanamide by thiol-ene click coupling reaction under UV light irradiation is reported. The title compound was characterized by elemental analysis, FT-IR, 1H NMR, 13C NMR and MS spectroscopic methods. This molecule was found to be an efficient gelator for fluid oils, and the main physical parameters of the formed gels were also examined.

  12. The Histone Methyltransferase Inhibitor A-366 Uncovers a Role for G9a/GLP in the Epigenetics of Leukemia.

    Directory of Open Access Journals (Sweden)

    William N Pappano

    Full Text Available Histone methyltransferases are epigenetic regulators that modify key lysine and arginine residues on histones and are believed to play an important role in cancer development and maintenance. These epigenetic modifications are potentially reversible and as a result this class of enzymes has drawn great interest as potential therapeutic targets of small molecule inhibitors. Previous studies have suggested that the histone lysine methyltransferase G9a (EHMT2 is required to perpetuate malignant phenotypes through multiple mechanisms in a variety of cancer types. To further elucidate the enzymatic role of G9a in cancer, we describe herein the biological activities of a novel peptide-competitive histone methyltransferase inhibitor, A-366, that selectively inhibits G9a and the closely related GLP (EHMT1, but not other histone methyltransferases. A-366 has significantly less cytotoxic effects on the growth of tumor cell lines compared to other known G9a/GLP small molecule inhibitors despite equivalent cellular activity on methylation of H3K9me2. Additionally, the selectivity profile of A-366 has aided in the discovery of a potentially important role for G9a/GLP in maintenance of leukemia. Treatment of various leukemia cell lines in vitro resulted in marked differentiation and morphological changes of these tumor cell lines. Furthermore, treatment of a flank xenograft leukemia model with A-366 resulted in growth inhibition in vivo consistent with the profile of H3K9me2 reduction observed. In summary, A-366 is a novel and highly selective inhibitor of G9a/GLP that has enabled the discovery of a role for G9a/GLP enzymatic activity in the growth and differentiation status of leukemia cells.

  13. Genetics Home Reference: spastic paraplegia type 11

    Science.gov (United States)

    ... Home Health Conditions spastic paraplegia type 11 spastic paraplegia type 11 Enable Javascript to view the expand/ ... Download PDF Open All Close All Description Spastic paraplegia type 11 is part of a group of ...

  14. SLC9A6 mutations cause X-linked mental retardation, microcephaly, epilepsy, and ataxia, a phenotype mimicking Angelman syndrome.

    Science.gov (United States)

    Gilfillan, Gregor D; Selmer, Kaja K; Roxrud, Ingrid; Smith, Raffaella; Kyllerman, Mårten; Eiklid, Kristin; Kroken, Mette; Mattingsdal, Morten; Egeland, Thore; Stenmark, Harald; Sjøholm, Hans; Server, Andres; Samuelsson, Lena; Christianson, Arnold; Tarpey, Patrick; Whibley, Annabel; Stratton, Michael R; Futreal, P Andrew; Teague, Jon; Edkins, Sarah; Gecz, Jozef; Turner, Gillian; Raymond, F Lucy; Schwartz, Charles; Stevenson, Roger E; Undlien, Dag E; Strømme, Petter

    2008-04-01

    Linkage analysis and DNA sequencing in a family exhibiting an X-linked mental retardation (XLMR) syndrome, characterized by microcephaly, epilepsy, ataxia, and absent speech and resembling Angelman syndrome, identified a deletion in the SLC9A6 gene encoding the Na(+)/H(+) exchanger NHE6. Subsequently, other mutations were found in a male with mental retardation (MR) who had been investigated for Angelman syndrome and in two XLMR families with epilepsy and ataxia, including the family designated as having Christianson syndrome. Therefore, mutations in SLC9A6 cause X-linked mental retardation. Additionally, males with findings suggestive of unexplained Angelman syndrome should be considered as potential candidates for SLC9A6 mutations.

  15. 7 CFR 1739.11 - Eligible project.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Eligible project. 1739.11 Section 1739.11 Agriculture... BROADBAND GRANT PROGRAM Community Connect Grant Program § 1739.11 Eligible project. To be eligible for a grant, the Project must: (a) Serve a Rural Area where Broadband Transmission Service does not...

  16. Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride

    NARCIS (Netherlands)

    Guskov, Albert; Kern, Jan; Gabdulkhakov, Azat; Broser, Matthias; Zouni, Athina; Saenger, Wolfram

    2009-01-01

    Photosystem II (PSII) is a large homodimeric protein-cofactor complex located in the photosynthetic thylakoid membrane that acts as light-driven water:plastoquinone oxidoreductase. The crystal structure of PSII from Thermosynechococcus elongatus at 2.9-A resolution allowed the unambiguous assignment

  17. 22 CFR 9a.1 - Security of certain information and material related to the International Energy Program.

    Science.gov (United States)

    2010-04-01

    ... GENERAL SECURITY INFORMATION REGULATIONS APPLICABLE TO CERTAIN INTERNATIONAL ENERGY PROGRAMS; RELATED MATERIAL § 9a.1 Security of certain information and material related to the International Energy Program... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Security of certain information and...

  18. Dmy initiates masculinity by altering Gsdf/Sox9a2/Rspo1 expression in medaka (Oryzias latipes).

    Science.gov (United States)

    Chakraborty, Tapas; Zhou, Lin Yan; Chaudhari, Aparna; Iguchi, Taisen; Nagahama, Y

    2016-01-25

    Despite identification of several sex-determining genes in non-mammalian vertebrates, their detailed molecular cascades of sex determination/differentiation are not known. Here, we used a novel RNAi to characterise the molecular mechanism of Dmy (the sex-determining gene of medaka)-mediated masculinity in XY fish. Dmy knockdown (Dmy-KD) suppressed male pathway (Gsdf, Sox9a2, etc.) and favoured female cascade (Rspo1, etc.) in embryonic XY gonads, resulting in a fertile male-to-female sex-reversal. Gsdf, Sox9a2, and Rspo1 directly interacted with Dmy, and co-injection of Gsdf and Sox9a2 re-established masculinity in XY-Dmy-KD transgenics, insinuating that Dmy initiates masculinity by stimulating and suppressing Gsdf/Sox9a2 and Rspo1 expression, respectively. Gonadal expression of Wt1a starts prior to Dmy and didn't change upon Dmy-KD. Furthermore, Wt1a stimulated the promoter activity of Dmy, suggesting Wt1a as a regulator of Dmy. These findings provide new insights into the role of vertebrate sex-determining genes associated with the molecular interplay between the male and female pathways.

  19. Mutations in sodium-channel gene SCN9A cause a spectrum of human genetic pain disorders.

    NARCIS (Netherlands)

    Drenth, J.P.H.; Waxman, S.G.

    2007-01-01

    The voltage-gated sodium-channel type IX alpha subunit, known as Na(v)1.7 and encoded by the gene SCN9A, is located in peripheral neurons and plays an important role in action potential production in these cells. Recent genetic studies have identified Na(v)1.7 dysfunction in three different human pa

  20. Mutations in sodium-channel gene SCN9A cause a spectrum of human genetic pain disorders.

    NARCIS (Netherlands)

    Drenth, J.P.H.; Waxman, S.G.

    2007-01-01

    The voltage-gated sodium-channel type IX alpha subunit, known as Na(v)1.7 and encoded by the gene SCN9A, is located in peripheral neurons and plays an important role in action potential production in these cells. Recent genetic studies have identified Na(v)1.7 dysfunction in three different human pa

  1. 中国汉族病理性近视人群的COL9A2基因突变分析%Analysis of COL9A2 gene mutations in a Chinese Han population with pathological myopia

    Institute of Scientific and Technical Information of China (English)

    陈蓉; 龚波; 李倩; 曾光群; 郝(芳); 李宁; 石毅; 张丁丁

    2014-01-01

    目的 对COL9A2基因进行突变分析,探讨中国汉族病理性近视的分子发病机制.方法 选取400例病理性近视患者和400名正常对照,对其中200例患者和200名对照的COL9A2基因全部外显子进行Sanger测序;对检测到的变异位点,应用SNaPshot方法在另外200例患者和200名对照中进行基因分型.结果 通过Sanger测序,在200例病理性近视患者中未检出已报道的D281fs移码突变,但1例患者检测出COL9A2基因第2外显子c.143G>C杂合错义突变,另外1例患者检测出COL9A2基因第17外显子c.884G>A杂合错义突变,在正常对照中未检测到c.143G>C和c.884G>A突变.同时在外显子编码区检测到COL9A2基因rs2228564 SNP位点,其等位基因频率在患者组与正常对照组间的差异无统计学意义(P>0.05).应用SNaPshot方法对另外的200例患者和200名正常对照的这些位点进行基因分型验证,1例患者检测到COL9A2基因第2外显子c.143G>C突变,2例患者检测到COL9A2基因第17外显子c.884G>A突变,rs2228564 SNP位点的等位基因频率在两组间的差异无统计学意义(P>0.05).结论 中国汉族病理性近视与COL9A2基因D281fs移码突变可能无关,COL9A2基因第2外显子c.143G>C突变和第17外显子c.884G>A突变可能与病理性近视的发病有关.%Objective To analyze the mutation of COL9A2 gene and investigate the molecular pathogenesis of pathological myopia in a Han Chinese population.Methods Mutation in the coding region of the COL9A2 gene was screened by Sanger sequencing in 200 subjects with pathological myopia and 200 normal controls.The detected variants were genotyped by SNaPshot method in another 200 myopic cases and 200 normal controls.Results Sanger sequencing has failed to detect the reported D281fs frameshift mutation in the 200 cases.A novel variant,c.143G>C heterozygous missense mutation in exon 2,was identified in a myopic subject,and another novel variant,c.884G

  2. Ocean sciences after September 11

    Science.gov (United States)

    McPhaden, Michael J.

    The terrorist attacks in New York City and Washington D.C. on September 11, 2001 shocked the world with their audacity and destruction. Shortly thereafter, bioterrorists struck through the U.S. postal system. Virtually overnight, major policy shifts took place in the United States that catapulted national security and homeland defense to the top of the political agenda. The consequences were unimaginable just a few months before: an international coalition at war against the Taliban in Afghanistan, major increases in U.S. defense spending, tightened security measures at airports, government facilities, and research laboratories, and a new sense of vulnerability in the post-cold war era. AGU itself was directly affected: three of its members perished in the hijacked planes, or on the ground in New York City.

  3. 11th KES International Conference

    CERN Document Server

    Kusek, Mario; Chen-Burger, Yun-Heh; Howlett, Robert; Jain, Lakhmi

    2017-01-01

    This volume highlights new trends and challenges in research on agents and the new digital and knowledge economy, and includes 23 papers classified into the following categories: business process management, agent-based modeling and simulation, and anthropic-oriented computing. All papers were originally presented at the 11th International KES Conference on Agents and Multi-Agent Systems – Technologies and Applications (KES-AMSTA 2017) held June 21–23, 2017 in Vilamoura, Algarve, Portugal. Today’s economy is driven by technologies and knowledge. Digital technologies can free, shift and multiply choices, and often intrude on the territory of other industries by providing new ways of conducting business operations and creating value for customers and companies. The topics covered in this volume include software agents, multi-agent systems, agent modeling, mobile and cloud computing, big data analysis, business intelligence, artificial intelligence, social systems, computer embedded systems and nature insp...

  4. The Apollo 11 Prime Crew

    Science.gov (United States)

    1969-01-01

    Portrait of the prime crew of the Apollo 11 lunar landing mission. From left to right they are: Commander, Neil A. Armstrong, Command Module Pilot, Michael Collins, and Lunar Module Pilot, Edwin E. Aldrin Jr. On July 20th 1969 at 4:18 PM, EDT the Lunar Module 'Eagle' landed in a region of the Moon called the Mare Tranquillitatis, also known as the Sea of Tranquillity. After securing his spacecraft, Armstrong radioed back to earth: 'Houston, Tranquility Base here, the Eagle has landed'. At 10:56 p.m. that same evening and witnessed by a worldwide television audience, Neil Armstrong stepped off the 'Eagle's landing pad onto the lunar surface and said: 'That's one small step for a man, one giant leap for mankind.' He became the first human to set foot upon the Moon.

  5. 11th International Conference Mechatronics

    CERN Document Server

    Brezina, Tomas

    2016-01-01

    Focusing on the most rapidly changing areas of mechatronics, this book discusses signals and system control, mechatronic products, metrology and nanometrology, automatic control & robotics, biomedical engineering, photonics, design manufacturing and testing of MEMS. It is reflected in the list of contributors, including an international group of 302 leading researchers representing 12 countries. The book is intended for use in academic, government and industry R&D departments, as an indispensable reference tool for the years to come. Thid volume can serve a global community as the definitive reference source in Mechatronics. The book comprises carefully selected 93 contributions presented at the 11th International Conference Mechatronics 2015, organized by Faculty of Mechatronics, Warsaw University of Technology, on September 21-23, in Warsaw, Poland. .

  6. Inland post-glacial dispersal in East Asia revealed by mitochondrial haplogroup M9a'b

    Directory of Open Access Journals (Sweden)

    Wang Wen-Zhi

    2011-01-01

    Full Text Available Abstract Background Archaeological studies have revealed a series of cultural changes around the Last Glacial Maximum in East Asia; whether these changes left any signatures in the gene pool of East Asians remains poorly indicated. To achieve deeper insights into the demographic history of modern humans in East Asia around the Last Glacial Maximum, we extensively analyzed mitochondrial DNA haplogroup M9a'b, a specific haplogroup that was suggested to have some potential for tracing the migration around the Last Glacial Maximum in East Eurasia. Results A total of 837 M9a'b mitochondrial DNAs (583 from the literature, while the remaining 254 were newly collected in this study pinpointed from over 28,000 subjects residing across East Eurasia were studied here. Fifty-nine representative samples were further selected for total mitochondrial DNA sequencing so we could better understand the phylogeny within M9a'b. Based on the updated phylogeny, an extensive phylogeographic analysis was carried out to reveal the differentiation of haplogroup M9a'b and to reconstruct the dispersal histories. Conclusions Our results indicated that southern China and/or Southeast Asia likely served as the source of some post-Last Glacial Maximum dispersal(s. The detailed dissection of haplogroup M9a'b revealed the existence of an inland dispersal in mainland East Asia during the post-glacial period. It was this dispersal that expanded not only to western China but also to northeast India and the south Himalaya region. A similar phylogeographic distribution pattern was also observed for haplogroup F1c, thus substantiating our proposition. This inland post-glacial dispersal was in agreement with the spread of the Mesolithic culture originating in South China and northern Vietnam.

  7. Inland post-glacial dispersal in East Asia revealed by mitochondrial haplogroup M9a'b.

    Science.gov (United States)

    Peng, Min-Sheng; Palanichamy, Malliya Gounder; Yao, Yong-Gang; Mitra, Bikash; Cheng, Yao-Ting; Zhao, Mian; Liu, Jia; Wang, Hua-Wei; Pan, Hui; Wang, Wen-Zhi; Zhang, A-Mei; Zhang, Wen; Wang, Dong; Zou, Yang; Yang, Yang; Chaudhuri, Tapas Kumar; Kong, Qing-Peng; Zhang, Ya-Ping

    2011-01-10

    Archaeological studies have revealed a series of cultural changes around the Last Glacial Maximum in East Asia; whether these changes left any signatures in the gene pool of East Asians remains poorly indicated. To achieve deeper insights into the demographic history of modern humans in East Asia around the Last Glacial Maximum, we extensively analyzed mitochondrial DNA haplogroup M9a'b, a specific haplogroup that was suggested to have some potential for tracing the migration around the Last Glacial Maximum in East Eurasia. A total of 837 M9a'b mitochondrial DNAs (583 from the literature, while the remaining 254 were newly collected in this study) pinpointed from over 28,000 subjects residing across East Eurasia were studied here. Fifty-nine representative samples were further selected for total mitochondrial DNA sequencing so we could better understand the phylogeny within M9a'b. Based on the updated phylogeny, an extensive phylogeographic analysis was carried out to reveal the differentiation of haplogroup M9a'b and to reconstruct the dispersal histories. Our results indicated that southern China and/or Southeast Asia likely served as the source of some post-Last Glacial Maximum dispersal(s). The detailed dissection of haplogroup M9a'b revealed the existence of an inland dispersal in mainland East Asia during the post-glacial period. It was this dispersal that expanded not only to western China but also to northeast India and the south Himalaya region. A similar phylogeographic distribution pattern was also observed for haplogroup F1c, thus substantiating our proposition. This inland post-glacial dispersal was in agreement with the spread of the Mesolithic culture originating in South China and northern Vietnam.

  8. Histone H1 variant-specific lysine methylation by G9a/KMT1C and Glp1/KMT1D

    Directory of Open Access Journals (Sweden)

    Weiss Thomas

    2010-03-01

    Full Text Available Abstract Background The linker histone H1 has a key role in establishing and maintaining higher order chromatin structure and in regulating gene expression. Mammals express up to 11 different H1 variants, with H1.2 and H1.4 being the predominant ones in most somatic cells. Like core histones, H1 has high levels of covalent modifications; however, the full set of modifications and their biological role are largely unknown. Results In this study, we used a candidate screen to identify enzymes that methylate H1 and to map their corresponding methylation sites. We found that the histone lysine methyltransferases G9a/KMT1C and Glp1/KMT1D methylate H1.2 in vitro and in vivo, and we mapped this novel site to lysine 187 (H1.2K187 in the C-terminus of H1. This H1.2K187 methylation is variant-specific. The main target for methylation by G9a in H1.2, H1.3, H1.5 and H1.0 is in the C-terminus, whereas H1.4 is preferentially methylated at K26 (H1.4K26me in the N-terminus. We found that the readout of these marks is different; H1.4K26me can recruit HP1, but H1.2K187me cannot. Likewise, JMJD2D/KDM4 only reverses H1.4K26 methylation, clearly distinguishing these two methylation sites. Further, in contrast to C-terminal H1 phosphorylation, H1.2K187 methylation level is steady throughout the cell cycle. Conclusions We have characterised a novel methylation site in the C-terminus of H1 that is the target of G9a/Glp1 both in vitro and in vivo. To our knowledge, this is the first demonstration of variant-specific histone methylation by the same methyltransferases, but with differing downstream readers, thereby supporting the hypothesis of H1 variants having specific functions.

  9. Research Progress of SCN9A Gene%SCN9A基因研究进展

    Institute of Scientific and Technical Information of China (English)

    孙贺东; 资晓宏

    2009-01-01

    SCN9A,encoding the voltage-gated sodium channel alpha subunit type Ⅸ,is predominanfly expressed in sensory and sympathetic neurons,with strikingly high levels in DRG.In 2004,Yang-yong and others firstly found out that the mutations in SCN9A caused primary erythermalgia(IEM),and then researchers found out that SCN9A mutations also caused paroxysmal extreme pain disorder(PEPD)and congenital indifference to pain(CIP).The pathogenic mechanism of SCN9A mutations and the relationship between SCN9A and pain have gradually become a hot spot of today's research.Up till now.there are many studies on SCN9A gene either on molecular level based on patch clamp technique or on global level based on gene knock-out technique.In this article we make a review of these studies.%SCN9A基因编码电压门控钠离子通道α-亚单位第Ⅸ型,主要在周围神经系统的感觉和交感神经表达,在背根神经节高表达.2004年我国学者杨勇等证明SCN9A是原发性红斑性肢痛症的致病基因,后来又有研究表明SCN9A是阵发性剧痛症、先天性无痛觉症的致病基因,SCN9A基因的致病机制及其与痛觉的关系逐渐成为科研热点,国内外学者在基于膜片钳技术的分子水平和基因敲除技术的整体水平都做了大量研究,本文对其研究进展作一概述.

  10. Crystal structures of the two epimers from the unusual thermal C6-epimerization of 5-oxo-1,2,3,5,5a,6,7,9b-octahydro-7,9a-epoxypyrrolo[2,1-a]isoindole-6-carboxylic acid, 5a(RS,6(SR,7(RS,9a(SR,9b(SR and 5a(RS,6(RS,7(RS,9a(SR,9b(SR

    Directory of Open Access Journals (Sweden)

    Dmitry S. Poplevin

    2016-10-01

    Full Text Available The isomeric title compounds, C12H13NO4 (Ia and C12H13NO4 (IIa, the products of an usual thermal C6-epimerization of 5-oxo-1,2,3,5,5a,6,7,9b-octahydro-7,9a-epoxypyrrolo[2,1-a]isoindole-6-carboxylic acid, represent the two different diastereomers and have very similar molecular geometries. The molecules of both compounds comprise a fused tetracyclic system containing four five-membered rings (pyrrolidine, pyrrolidinone, dihydrofuran and tetrahydrofuran, all of which adopt the usual envelope conformations. The dihedral angle between the basal planes of the pyrrolidine and pyrrolidinone rings are 14.3 (2 and 16.50 (11°, respectively, for (Ia and (IIa. The nitrogen atom has a slightly pyramidalized geometry [bond-angle sum = 355.9 and 355.3°, for (Ia and (IIa], respectively. In the crystal of (Ia, molecules form zigzag-like hydrogen-bonded chains along [010] through strong O—H...O hydrogen bonds and are further linked by weak C—H...O hydrogen bonds into complex two-tier layers parallel to (100. Unlike (Ia, the crystal of (IIa contains centrosymmetric cyclic hydrogen-bonded dimers [graph set R22(14], formed through strong O—H...O hydrogen bonds and are further linked by weak C—H...O hydrogen bonds into ribbons extending across [101].

  11. C-11 radiochemistry in cancer imaging applications.

    Science.gov (United States)

    Tu, Z; Mach, R H

    2010-01-01

    Carbon-11 (C-11) radiotracers are widely used for the early diagnosis of cancer, monitoring therapeutic response to cancer treatment, and pharmacokinetic investigations of anticancer drugs. PET imaging permits non-invasive monitoring of metabolic processes and molecular targets, while carbon-11 radiotracers allow a "hot-for cold" substitution of biologically active molecules. Advances in organic synthetic chemistry and radiochemistry as well as improved automated techniques for radiosynthesis have encouraged investigators in developing carbon-11 tracers for use in oncology imaging studies. The short half-life of carbon-11 (20.38 minutes) creates special challenges for the synthesis of C-11 labeled tracers; these include the challenges of synthesizing C-11 target compounds with high radiochemical yield, high radiochemical purity and high specific activity in a short time and on a very small scale. The optimization of conditions for making a carbon-11 tracer include the late introduction of the C-11 isotope, the rapid formation and purification of the target compound, and the use of automated systems to afford a high yield of the target compound in a short time. In this review paper, we first briefly introduce some basic principles of PET imaging of cancer; we then discuss principles of carbon-11 radiochemistry, focus on specific advances in radiochemistry, and describe the synthesis of C-11 radiopharmaceuticals developed for cancer imaging. The carbon-11 radiochemistry approaches described include the N,O, and S-alkylations of [(11)C]methyl iodide/[(11)C]methyl triflate and analogues of [(11)C]methyl iodide and their applications for making carbon-11 tracers; we then address recent advances in exploring a transmetallic complex mediated [(11)C]carbonyl reaction for oncologic targets.

  12. 16 CFR 1031.11 - Procedural safeguards.

    Science.gov (United States)

    2010-01-01

    ....11 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL COMMISSION PARTICIPATION AND COMMISSION EMPLOYEE INVOLVEMENT IN VOLUNTARY STANDARDS ACTIVITIES Employee Involvement § 1031.11 Procedural... involvement in voluntary standards activities set forth in subpart A of this part. (b) Commission...

  13. A SCN9A gene-encoded dorsal root ganglia sodium channel polymorphism associated with severe fibromyalgia

    Directory of Open Access Journals (Sweden)

    Vargas-Alarcon Gilberto

    2012-02-01

    Full Text Available Abstract Background A consistent line of investigation suggests that autonomic nervous system dysfunction may explain the multi-system features of fibromyalgia (FM; and that FM is a sympathetically maintained neuropathic pain syndrome. Dorsal root ganglia (DRG are key sympathetic-nociceptive short-circuit sites. Sodium channels located in DRG (particularly Nav1.7 act as molecular gatekeepers for pain detection. Nav1.7 is encoded in gene SCN9A of chromosome 2q24.3 and is predominantly expressed in the DRG pain-sensing neurons and sympathetic ganglia neurons. Several SCN9A sodium channelopathies have been recognized as the cause of rare painful dysautonomic syndromes such as paroxysmal extreme pain disorder and primary erythromelalgia. The aim of this study was to search for an association between fibromyalgia and several SCN9A sodium channels gene polymorphisms. Methods We studied 73 Mexican women suffering from FM and 48 age-matched women who considered themselves healthy. All participants filled out the Fibromyalgia Impact Questionnaire (FIQ. Genomic DNA from whole blood containing EDTA was extracted by standard techniques. The following SCN9A single-nucleotide polymorphisms (SNP were determined by 5' exonuclease TaqMan assays: rs4371369; rs4387806; rs4453709; rs4597545; rs6746030; rs6754031; rs7607967; rs12620053; rs12994338; and rs13017637. Results The frequency of the rs6754031 polymorphism was significantly different in both groups (P = 0.036 mostly due to an absence of the GG genotype in controls. Interestingly; patients with this rs6754031 GG genotype had higher FIQ scores (median = 80; percentile 25/75 = 69/88 than patients with the GT genotype (median = 63; percentile 25/75 = 58/73; P = 0.002 and the TT genotype (median = 71; percentile 25/75 = 64/77; P = 0.001. Conclusion In this ethnic group; a disabling form of FM is associated to a particular SCN9A sodium channel gene variant. These preliminary results raise the possibility that

  14. 7 CFR 614.11 - Mediation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Mediation. 614.11 Section 614.11 Agriculture... AGRICULTURE CONSERVATION OPERATIONS NRCS APPEAL PROCEDURES § 614.11 Mediation. (a) A participant who wishes to pursue mediation must file request for mediation under this part with the NRCS official designated in...

  15. 7 CFR 160.11 - Quality requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Quality requirements. 160.11 Section 160.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... STANDARDS FOR NAVAL STORES General § 160.11 Quality requirements. The several standards for spirits of...

  16. 16 CFR 1507.11 - Party poppers.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Party poppers. 1507.11 Section 1507.11... FIREWORKS DEVICES § 1507.11 Party poppers. Party poppers (also known by other names such as “Champagne Party Poppers,” and “Party Surprise Poppers,”) shall not contain more than 0.25 grains of...

  17. 46 CFR 98.33-11 - Smoking.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Smoking. 98.33-11 Section 98.33-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS SPECIAL CONSTRUCTION, ARRANGEMENT... Combustible Liquids and Other Regulated Materials § 98.33-11 Smoking. No person may smoke when— (a) Within...

  18. 25 CFR 11.601 - Marriage licenses.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Marriage licenses. 11.601 Section 11.601 Indians BUREAU... ORDER CODE Domestic Relations § 11.601 Marriage licenses. A marriage license shall be issued by the clerk of the court in the absence of any showing that the proposed marriage would be invalid under...

  19. 45 CFR 605.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Discrimination prohibited. 605.11 Section 605.11... Employment Practices § 605.11 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  20. 34 CFR 104.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Discrimination prohibited. 104.11 Section 104.11... ASSISTANCE Employment Practices § 104.11 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  1. 7 CFR 917.11 - Production area.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Production area. 917.11 Section 917.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Order Regulating Handling Definitions § 917.11 Production area. Production area means the State of...

  2. 16 CFR 1209.11 - Effective date.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Effective date. 1209.11 Section 1209.11 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INTERIM SAFETY STANDARD FOR CELLULOSE INSULATION The Standard § 1209.11 Effective date. All cellulose insulation...

  3. 46 CFR 97.11-1 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 97.11-1 Section 97.11-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS OPERATIONS Stability Letter § 97.11-1 Posting. If a stability letter is issued under § 170.120 of this chapter, it must be...

  4. 42 CFR 491.11 - Program evaluation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Program evaluation. 491.11 Section 491.11 Public... Certification; and FQHCs Conditions for Coverage § 491.11 Program evaluation. (a) The clinic or center carries out, or arranges for, an annual evaluation of its total program. (b) The evaluation includes review...

  5. 28 CFR 100.11 - Allowable costs.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Allowable costs. 100.11 Section 100.11 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) COST RECOVERY REGULATIONS, COMMUNICATIONS ASSISTANCE FOR LAW ENFORCEMENT ACT OF 1994 § 100.11 Allowable costs. (a) Costs that are eligible...

  6. 7 CFR 905.11 - Fiscal period.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Fiscal period. 905.11 Section 905.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... TANGELOS GROWN IN FLORIDA Order Regulating Handling Definitions § 905.11 Fiscal period. Fiscal period...

  7. 7 CFR 1216.11 - Fiscal year.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Fiscal year. 1216.11 Section 1216.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Peanut Promotion, Research, and Information Order Definitions § 1216.11 Fiscal year....

  8. 39 CFR 447.11 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Applicability. 447.11 Section 447.11 Postal Service UNITED STATES POSTAL SERVICE PERSONNEL RULES OF CONDUCT FOR POSTAL EMPLOYEES Applicability and Definitions § 447.11 Applicability. This part contains rules of conduct for the employees of the Postal...

  9. 49 CFR 262.11 - Application process.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Application process. 262.11 Section 262.11 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... IMPROVEMENT PROJECTS § 262.11 Application process. (a) All grant applications for opportunities funded...

  10. 23 CFR 652.11 - Planning.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Planning. 652.11 Section 652.11 Highways FEDERAL HIGHWAY... ACCOMMODATIONS AND PROJECTS § 652.11 Planning. Federally aided bicycle and pedestrian projects implemented within... unless excluded by agreement between the State and the metropolitan planning organization. ...

  11. 12 CFR 370.11 - Enforcement mechanisms.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Enforcement mechanisms. 370.11 Section 370.11 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY TEMPORARY LIQUIDITY GUARANTEE PROGRAM § 370.11 Enforcement mechanisms. (a) Termination of Participation....

  12. 46 CFR 160.017-11 - Materials.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials. 160.017-11 Section 160.017-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Chain Ladder § 160.017-11 Materials. (a) Suspension members...

  13. 46 CFR 163.002-11 - Materials.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials. 163.002-11 Section 163.002-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-11 Materials. (a) Gears. Each gear in a pilot...

  14. 46 CFR 163.003-11 - Materials.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Materials. 163.003-11 Section 163.003-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-11 Materials. (a) Suspension members. Each...

  15. 10 CFR 63.11 - Deliberate misconduct.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Deliberate misconduct. 63.11 Section 63.11 Energy NUCLEAR... MOUNTAIN, NEVADA General Provisions § 63.11 Deliberate misconduct. (a) Any licensee, applicant for a..., may not: (1) Engage in deliberate misconduct that causes or would have caused, if not detected,...

  16. 10 CFR 60.11 - Deliberate misconduct.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Deliberate misconduct. 60.11 Section 60.11 Energy NUCLEAR... Provisions § 60.11 Deliberate misconduct. (a) Any licensee, applicant for a license, employee of a licensee... misconduct that causes or would have caused, if not detected, a licensee or applicant to be in violation...

  17. 46 CFR 310.11 - Cadet uniforms.

    Science.gov (United States)

    2010-10-01

    ... for State, Territorial or Regional Maritime Academies and Colleges § 310.11 Cadet uniforms. Cadet uniforms shall be supplied at the school in accordance with the uniform regulations of the School. Those... 46 Shipping 8 2010-10-01 2010-10-01 false Cadet uniforms. 310.11 Section 310.11 Shipping...

  18. 7 CFR 11.22 - Functions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Functions. 11.22 Section 11.22 Agriculture Office of the Secretary of Agriculture NATIONAL APPEALS DIVISION Organization And Functions § 11.22 Functions... Director for Hearings and Administration. Responsible for all administrative functions of NAD,...

  19. 40 CFR 247.11 - Vehicular products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Vehicular products. 247.11 Section 247.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.11 Vehicular products. (a) Lubricating oils...

  20. 10 CFR 218.11 - Supply orders.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Supply orders. 218.11 Section 218.11 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.11 Supply orders. (a) A supply order shall require that the firm to which it is issued take actions specified therein relating...

  1. 7 CFR 3430.11 - Competition.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Competition. 3430.11 Section 3430.11 Agriculture...-GENERAL AWARD ADMINISTRATIVE PROVISIONS Pre-award: Solicitation and Application § 3430.11 Competition. (a) Standards for competition. Except as provided in paragraph (b) of this section, CSREES will enter...

  2. 40 CFR 610.11 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... data” means any information which is a quantitative measure of any aspect of the behavior of a retrofit... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Definitions. 610.11 Section 610.11... DEVICES Test Procedures and Evaluation Criteria General Provisions § 610.11 Definitions. (a) Except as...

  3. 49 CFR 1150.11 - Introduction.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Introduction. 1150.11 Section 1150.11 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT... Designated Operators § 1150.11 Introduction. A certificate of designated operator will be issued to...

  4. 14 CFR 147.11 - Ratings.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Ratings. 147.11 Section 147.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES AVIATION MAINTENANCE TECHNICIAN SCHOOLS Certification Requirements § 147.11 Ratings....

  5. 10 CFR 602.11 - Funding.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Funding. 602.11 Section 602.11 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS EPIDEMIOLOGY AND OTHER HEALTH STUDIES FINANCIAL ASSISTANCE PROGRAM § 602.11 Funding. (a) The project period during which DOE expects to provide support for an...

  6. 10 CFR 35.11 - License required.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false License required. 35.11 Section 35.11 Energy NUCLEAR REGULATORY COMMISSION MEDICAL USE OF BYPRODUCT MATERIAL General Information § 35.11 License required. (a) A... for medical use only in accordance with a specific license issued by the Commission or an...

  7. 49 CFR 397.11 - Fires.

    Science.gov (United States)

    2010-10-01

    ... PARKING RULES General § 397.11 Fires. (a) A motor vehicle containing hazardous materials must not be... safely pass the fire without stopping. (b) A motor vehicle containing hazardous materials must not be... 49 Transportation 5 2010-10-01 2010-10-01 false Fires. 397.11 Section 397.11 Transportation...

  8. 46 CFR 11.493 - Master (OSV).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Master (OSV). 11.493 Section 11.493 Shipping COAST GUARD... Professional Requirements for Deck Officers § 11.493 Master (OSV). (a) Except as provided by paragraph (b) of this section, to qualify for an endorsement as Master (OSV), an applicant shall present evidence...

  9. 29 CFR 2.11 - General principles.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true General principles. 2.11 Section 2.11 Labor Office of the Secretary of Labor GENERAL REGULATIONS Audiovisual Coverage of Administrative Hearings § 2.11 General principles. The following general principles will be observed in granting or denying requests for...

  10. 16 CFR 1115.11 - Imputed knowledge.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Imputed knowledge. 1115.11 Section 1115.11... PRODUCT HAZARD REPORTS General Interpretation § 1115.11 Imputed knowledge. (a) In evaluating whether or... care to ascertain the truth of complaints or other representations. This includes the knowledge a...

  11. 49 CFR 179.400-11 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.400-11 Section 179.400-11...-11 Welding. (a) Except for closure of openings and a maximum of two circumferential closing joints in... subchapter). (d) Each welding procedure, welder, and fabricator must be approved. [Amdt. 179-32, 48 FR...

  12. 25 CFR 11.415 - Fraud.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Fraud. 11.415 Section 11.415 Indians BUREAU OF INDIAN... Criminal Offenses § 11.415 Fraud. A person who shall by willful misrepresentation or deceit, or by false... fraud, a misdemeanor. ...

  13. 25 CFR 11.1007 - Petition.

    Science.gov (United States)

    2010-04-01

    ... Juvenile Offender Procedure § 11.1007 Petition. (a) Proceedings under §§ 11.1000-11.1014 of this part shall... interests of the minor. The petition shall state: (1) The name, birth date, and residence of the minor; (2) The names and residences of the minor's parents, guardian or custodian; (3) A citation to the specific...

  14. 29 CFR 1604.11 - Sexual harassment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Sexual harassment. 1604.11 Section 1604.11 Labor... BECAUSE OF SEX § 1604.11 Sexual harassment. (a) Harassment on the basis of sex is a violation of section... physical conduct of a sexual nature constitute sexual harassment when (1) submission to such conduct...

  15. 27 CFR 11.4 - Jurisdictional limits.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Jurisdictional limits. 11.4 Section 11.4 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.4 Jurisdictional limits....

  16. 46 CFR 11.480 - Radar observer.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Radar observer. 11.480 Section 11.480 Shipping COAST... ENDORSEMENTS Professional Requirements for Deck Officers § 11.480 Radar observer. (a) This section contains the requirements that an applicant must meet to qualify as a radar observer. (Part 15 of this chapter specifies...

  17. 14 CFR 314.11 - Applications.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Applications. 314.11 Section 314.11... REGULATIONS EMPLOYEE PROTECTION PROGRAM Determination of Qualifying Dislocation § 314.11 Applications. (a) Who may file. An application may be filed by an employee who has been deprived of employment or adversely...

  18. 43 CFR 36.11 - Special access.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Special access. 36.11 Section 36.11 Public..., AND ACCESS INTO, CONSERVATION SYSTEM UNITS IN ALASKA § 36.11 Special access. (a) This section... this section. The use of aircraft for access to or from lands and waters within a national park...

  19. Commemorating 9/11 in the Classroom

    Science.gov (United States)

    Social Education, 2011

    2011-01-01

    The National September 11 Memorial & Museum will be officially dedicated this September on the 10th anniversary of the attacks of 2001. It provides educational resources that explore the ongoing impact of the September 11th attacks and the ways that volunteerism and art aid in healing, recovery, and rebuilding. The 9/11 Memorial Museum, to be…

  20. 7 CFR 1206.11 - Mangos.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Mangos. 1206.11 Section 1206.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION Mango Promotion, Research, and Information Order Definitions § 1206.11 Mangos. Mangos means...

  1. 29 CFR 1607.11 - Disparate treatment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Disparate treatment. 1607.11 Section 1607.11 Labor... EMPLOYEE SELECTION PROCEDURES (1978) General Principles § 1607.11 Disparate treatment. The principles of disparate or unequal treatment must be distinguished from the concepts of validation. A selection...

  2. 10 CFR 150.11 - Critical mass.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Critical mass. 150.11 Section 150.11 Energy NUCLEAR... OFFSHORE WATERS UNDER SECTION 274 Exemptions in Agreement States § 150.11 Critical mass. (a) For the purposes of this part, special nuclear material in quantities not sufficient to form a critical mass...

  3. 25 CFR 11.454 - Domestic violence.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Domestic violence. 11.454 Section 11.454 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAW AND ORDER COURTS OF INDIAN OFFENSES AND LAW AND ORDER CODE Criminal Offenses § 11.454 Domestic violence. (a) A person who commits domestic violence...

  4. 32 CFR 231.11 - Guidelines.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Guidelines. 231.11 Section 231.11 National... PROCEDURES GOVERNING BANKS, CREDIT UNIONS AND OTHER FINANCIAL INSTITUTIONS ON DOD INSTALLATIONS Guidelines for Application of the Privacy Act to Financial Institution Operations § 231.11 Guidelines. (a)...

  5. 12 CFR 412.11 - Payment guidelines.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Payment guidelines. 412.11 Section 412.11 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ACCEPTANCE OF PAYMENT FROM A NON-FEDERAL SOURCE FOR TRAVEL EXPENSES § 412.11 Payment guidelines. (a) Payments from a non-Federal source, other...

  6. 22 CFR 19.11 - Survivor benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 19.11 Section 19.11 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.11 Survivor benefits....

  7. 30 CFR 15.11 - Revocation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Revocation. 15.11 Section 15.11 Mineral... § 15.11 Revocation. (a) MSHA may revoke for cause an approval issued under this part if the explosive... revocation; and (2) Provide the approval-holder an opportunity to demonstrate or achieve compliance with...

  8. 30 CFR 14.11 - Revocation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Revocation. 14.11 Section 14.11 Mineral....11 Revocation. (a) MSHA may revoke for cause an approval issued under this Part if the conveyor belt... intention to revoke. The notice will— (1) Explain the reasons for the proposed revocation; and (2)...

  9. 32 CFR 553.11 - Procurement.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Procurement. 553.11 Section 553.11 National... CEMETERIES ARMY NATIONAL CEMETERIES § 553.11 Procurement. Cemetery supplies and services will be procured in accordance with the provisions of the Armed Services Procurement Regulation (ASPR) and the Army...

  10. 46 CFR 249.11 - Confidentiality.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Confidentiality. 249.11 Section 249.11 Shipping MARITIME... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.11 Confidentiality. (a) If the data submitted under this rule... for confidentiality at the time of any request for production of information under the FOIA by third...

  11. 42 CFR 59.11 - Confidentiality.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Confidentiality. 59.11 Section 59.11 Public Health... Project Grants for Family Planning Services § 59.11 Confidentiality. All information as to personal facts... confidentiality. Otherwise, information may be disclosed only in summary, statistical, or other form which does...

  12. 7 CFR 503.11 - Pets.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Pets. 503.11 Section 503.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL RESEARCH SERVICE, DEPARTMENT OF AGRICULTURE CONDUCT ON PLUM ISLAND ANIMAL DISEASE CENTER § 503.11 Pets. No pets or animals of any kind may be...

  13. 7 CFR 502.11 - Pets.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Pets. 502.11 Section 502.11 Agriculture Regulations of... CONDUCT ON BELTSVILLE AGRICULTURE RESEARCH CENTER PROPERTY, BELTSVILLE, MARYLAND § 502.11 Pets. Pets... vaccinations. Pets that are the property of employees residing on BARC must be up to date on their...

  14. 40 CFR 444.11 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Definitions. 444.11 Section 444.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS WASTE COMBUSTORS POINT SOURCE CATEGORY Commercial Hazardous Waste Combustor Subcategory § 444.11 Definitions....

  15. 7 CFR 1427.11 - Warehouse receipts.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Warehouse receipts. 1427.11 Section 1427.11... Deficiency Payments § 1427.11 Warehouse receipts. (a) Producers may obtain loans on eligible cotton represented by warehouse receipts only if the warehouse receipts meet the definition of a warehouse...

  16. 5 CFR 1655.11 - Loan acceptance.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Loan acceptance. 1655.11 Section 1655.11 Administrative Personnel FEDERAL RETIREMENT THRIFT INVESTMENT BOARD LOAN PROGRAM § 1655.11 Loan acceptance. The... pending loan agreement or in-service withdrawal request; (d) The amount of the requested loan is less than...

  17. 25 CFR 11.421 - Bad checks.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Bad checks. 11.421 Section 11.421 Indians BUREAU OF... Criminal Offenses § 11.421 Bad checks. (a) A person who issues or passes a check or similar sight order for..., and the issuer failed to make good within 10 days after receiving notice of that refusal....

  18. 12 CFR 23.11 - Lease term.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Lease term. 23.11 Section 23.11 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY LEASING CEBA Leases § 23.11 Lease term. A CEBA Lease must have an initial term of not less than 90 days. A national bank may acquire...

  19. 42 CFR 9.11 - Animal transport.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Animal transport. 9.11 Section 9.11 Public Health... CHIMPANZEES HELD IN THE FEDERALLY SUPPORTED SANCTUARY SYSTEM § 9.11 Animal transport. The transportation of... and Regulations and the International Air Transport Association (IATA) Live Animal Regulations...

  20. 40 CFR 11.3 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Responsibilities. 11.3 Section 11.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SECURITY CLASSIFICATION REGULATIONS PURSUANT TO EXECUTIVE ORDER 11652 § 11.3 Responsibilities. (a) Classification and...

  1. 36 CFR 261.11 - Sanitation.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sanitation. 261.11 Section 261.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PROHIBITIONS General Prohibitions § 261.11 Sanitation. The following are prohibited: (a) Depositing in any...

  2. 28 CFR 66.11 - State plans.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State plans. 66.11 Section 66.11 Judicial... AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 66.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations...

  3. 29 CFR 97.11 - State plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true State plans. 97.11 Section 97.11 Labor Office of the... LOCAL GOVERNMENTS Pre-Award Requirements § 97.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations implementing Executive Order...

  4. 34 CFR 80.11 - State plans.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false State plans. 80.11 Section 80.11 Education Office of... AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 80.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations...

  5. 49 CFR 18.11 - State plans.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false State plans. 18.11 Section 18.11 Transportation... AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 18.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations...

  6. 20 CFR 437.11 - State plans.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false State plans. 437.11 Section 437.11 Employees... AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 437.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations...

  7. 45 CFR 1157.11 - State plans.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false State plans. 1157.11 Section 1157.11 Public... AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 1157.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations...

  8. 45 CFR 602.11 - State plans.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false State plans. 602.11 Section 602.11 Public Welfare....11 State plans. (a) Scope. The statutes for some programs require States to submit plans before... Programs,” States are allowed to simplify, consolidate and substitute plans. This section contains...

  9. 45 CFR 1183.11 - State plans.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false State plans. 1183.11 Section 1183.11 Public... COOPERATIVE AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 1183.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under...

  10. 7 CFR 3016.11 - State plans.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false State plans. 3016.11 Section 3016.11 Agriculture... GOVERNMENTS Pre-Award Requirements § 3016.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under regulations implementing Executive Order 12372...

  11. 45 CFR 1174.11 - State plans.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false State plans. 1174.11 Section 1174.11 Public... COOPERATIVE AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Pre-Award Requirements § 1174.11 State plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants. Under...

  12. 40 CFR 440.11 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false 440.11 Section 440.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ORE MINING AND DRESSING POINT SOURCE CATEGORY Iron Ore Subcategory § 440.11...

  13. 7 CFR 985.11 - Salable oil.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Salable oil. 985.11 Section 985.11 Agriculture... HANDLING OF SPEARMINT OIL PRODUCED IN THE FAR WEST Order Regulating Handling Definitions § 985.11 Salable oil. Salable oil means that oil which is free to be handled....

  14. 5 CFR 1651.11 - Simultaneous death.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Simultaneous death. 1651.11 Section 1651.11 Administrative Personnel FEDERAL RETIREMENT THRIFT INVESTMENT BOARD DEATH BENEFITS § 1651.11 Simultaneous death. If a beneficiary dies at the same time as the participant, the beneficiary will be...

  15. 25 CFR 11.441 - Disorderly conduct.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Disorderly conduct. 11.441 Section 11.441 Indians BUREAU... ORDER CODE Criminal Offenses § 11.441 Disorderly conduct. (a) A person is guilty of disorderly conduct... or she persists in disorderly conduct after reasonable warning or request to desist. Otherwise...

  16. 45 CFR 1641.11 - Suspension.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Suspension. 1641.11 Section 1641.11 Public Welfare Regulations Relating to Public Welfare (Continued) LEGAL SERVICES CORPORATION DEBARMENT, SUSPENSION AND REMOVAL OF RECIPIENT AUDITORS Suspension § 1641.11 Suspension. (a) IPAs suspended from providing...

  17. 34 CFR 31.11 - Offset process.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Offset process. 31.11 Section 31.11 Education Office of the Secretary, Department of Education SALARY OFFSET FOR FEDERAL EMPLOYEES WHO ARE INDEBTED TO THE UNITED STATES UNDER PROGRAMS ADMINISTERED BY THE SECRETARY OF EDUCATION § 31.11 Offset process. (a)...

  18. 28 CFR 11.8 - Salary offset.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Salary offset. 11.8 Section 11.8 Judicial Administration DEPARTMENT OF JUSTICE DEBT COLLECTION Administration of Debt Collection § 11.8 Salary offset. (a) Notice requirements before offset. Deductions under the authority of 5 U.S.C. 5514 will not be...

  19. 7 CFR 11.21 - Organization.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Organization. 11.21 Section 11.21 Agriculture Office of the Secretary of Agriculture NATIONAL APPEALS DIVISION Organization And Functions § 11.21 Organization. NAD was established on October 13, 1994. Delegation of authority to the Director, NAD, appears...

  20. 15 CFR 9.11 - Annual report.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Annual report. 9.11 Section 9.11... FOR HOUSEHOLD APPLIANCES AND EQUIPMENT TO EFFECT ENERGY CONSERVATION § 9.11 Annual report. The Secretary will prepare an annual report of activities under the program, including an evaluation of...

  1. 42 CFR 73.11 - Security.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Security. 73.11 Section 73.11 Public Health PUBLIC... AND TOXINS § 73.11 Security. (a) An individual or entity required to register under this part must develop and implement a written security plan. The security plan must be sufficient to safeguard...

  2. 7 CFR 331.11 - Security.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Security. 331.11 Section 331.11 Agriculture..., DEPARTMENT OF AGRICULTURE POSSESSION, USE, AND TRANSFER OF SELECT AGENTS AND TOXINS § 331.11 Security. (a) An individual or entity required to register under this part must develop and implement a written security...

  3. 9 CFR 121.11 - Security.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Security. 121.11 Section 121.11... AGENTS AND TOXINS § 121.11 Security. (a) An individual or entity required to register under this part must develop and implement a written security plan. The security plan must be sufficient to...

  4. 25 CFR 11.408 - Indecent exposure.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Indecent exposure. 11.408 Section 11.408 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAW AND ORDER COURTS OF INDIAN OFFENSES AND LAW AND ORDER CODE Criminal Offenses § 11.408 Indecent exposure. A person commits a misdemeanor if he or she...

  5. 40 CFR 81.11 - Scope.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Scope. 81.11 Section 81.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) DESIGNATION OF AREAS FOR AIR QUALITY PLANNING PURPOSES Designation of Air Quality Control Regions § 81.11 Scope....

  6. 45 CFR 1705.11 - Penalties.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Penalties. 1705.11 Section 1705.11 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE PRIVACY REGULATIONS § 1705.11 Penalties. Title 18 U.S.C. 1001, Crimes and Criminal Procedures, makes it...

  7. 7 CFR 987.11 - Trade demand.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Trade demand. 987.11 Section 987.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... RIVERSIDE COUNTY, CALIFORNIA Order Regulating Handling Definitions § 987.11 Trade demand. Trade demand means...

  8. 9 CFR 11.3 - Scar rule.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals... WELFARE HORSE PROTECTION REGULATIONS § 11.3 Scar rule. The scar rule applies to all horses born on or after October 1, 1975. Horses subject to this rule that do not meet the following scar rule...

  9. 14 CFR 35.11 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false 35.11 Section 35.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: PROPELLERS Design and Construction § 35.11...

  10. 17 CFR 1.11 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false 1.11 Section 1.11 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION GENERAL REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Minimum Financial and Related Reporting Requirements § 1.11 ...

  11. 40 CFR 258.11 - Floodplains.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Floodplains. 258.11 Section 258.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.11 Floodplains. (a) Owners or operators of new...

  12. 45 CFR 5b.11 - Exempt systems.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...

  13. 10 CFR 4.11 - General prohibition.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false General prohibition. 4.11 Section 4.11 Energy NUCLEAR... and Title IV of the Energy Reorganization Act of 1974 Discrimination Prohibited § 4.11 General... excluded from participation in, be denied the benefits of, or be otherwise subjected to...

  14. 46 CFR 160.171-11 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.171-11 Section 160.171-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-11 Performance. (a) Buoyancy....

  15. 46 CFR 160.176-11 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.176-11 Section 160.176-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-11 Performance. (a)...

  16. 15 CFR 8b.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.11 Section 8b.11 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Practices § 8b.11 Discrimination prohibited. (a) General. (1) No qualified handicapped individual shall, on...

  17. 45 CFR 84.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Discrimination prohibited. 84.11 Section 84.11... § 84.11 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this...

  18. 21 CFR 11.50 - Signature manifestations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Signature manifestations. 11.50 Section 11.50 Food... RECORDS; ELECTRONIC SIGNATURES Electronic Records § 11.50 Signature manifestations. (a) Signed electronic...: (1) The printed name of the signer; (2) The date and time when the signature was executed; and...

  19. 25 CFR 43.11 - Informal proceedings.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Informal proceedings. 43.11 Section 43.11 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION MAINTENANCE AND CONTROL OF STUDENT RECORDS IN BUREAU SCHOOLS § 43.11 Informal proceedings. Educational institutions may attempt to resolve...

  20. 25 CFR 11.606 - Dissolution proceedings.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Dissolution proceedings. 11.606 Section 11.606 Indians... ORDER CODE Domestic Relations § 11.606 Dissolution proceedings. (a) Either or both parties to the marriage may initiate dissolution proceedings. (b) If a proceeding is commenced by one of the parties,...

  1. 25 CFR 11.605 - Dissolution.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Dissolution. 11.605 Section 11.605 Indians BUREAU OF... Domestic Relations § 11.605 Dissolution. (a) The Court of Indian Offenses shall enter a decree of dissolution of marriage if: (1) The court finds that the marriage is irretrievably broken, if the finding is...

  2. 22 CFR 143.11 - Standards.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 143.11 Section 143.11 Foreign... RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination § 143.11 Standards. The standards each agency uses to determine whether an age distinction or age-related term is prohibited are...

  3. 49 CFR 91.11 - Standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Standards. 91.11 Section 91.11 Transportation Office of the Secretary of Transportation INTERNATIONAL AIR TRANSPORTATION FAIR COMPETITIVE PRACTICES § 91.11 Standards. (a) To minimize the burden of implementing this part on the United States, on...

  4. 22 CFR 218.11 - Standards.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 218.11 Section 218.11 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination § 218.11 Standards. The standards each agency uses to determine whether an age distinction or age-related term...

  5. 29 CFR 1911.11 - Other standards.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Other standards. 1911.11 Section 1911.11 Labor Regulations...) RULES OF PROCEDURE FOR PROMULGATING, MODIFYING, OR REVOKING OCCUPATIONAL SAFETY OR HEALTH STANDARDS Commencement of Rulemaking § 1911.11 Other standards. The Assistant Secretary may promulgate, modify, or...

  6. 25 CFR 11.407 - Sexual assault.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Sexual assault. 11.407 Section 11.407 Indians BUREAU OF... Criminal Offenses § 11.407 Sexual assault. (a) A person who has sexual contact with another person not his or her spouse, or causes such other person to have sexual contact with him or her, is guilty of...

  7. 16 CFR 309.11 - Certification.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Certification. 309.11 Section 309.11... Manufacturers of Electric Vehicle Fuel Dispensing Systems § 309.11 Certification. (a) For non-liquid alternative.... This letter of certification will be good until you transfer non-liquid alternative vehicle fuel...

  8. 30 CFR 48.11 - Hazard training.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Hazard training. 48.11 Section 48.11 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR EDUCATION AND TRAINING TRAINING AND RETRAINING OF MINERS Training and Retraining of Underground Miners § 48.11 Hazard training. (a)...

  9. 腰椎间盘退变与COL9A2基因单核苷酸多态性的相关性%Correlation between lumbar disc degeneration and COL9A2 gene single nucleotide polymorphisms

    Institute of Scientific and Technical Information of China (English)

    陈涛; 黎观保; 梁科友; 贾世青

    2013-01-01

    BACKGROUND: Studies have shown that lumbar disc degeneration is closely related to genes. OBJECTIVE: To explore the relationship between COL9A2 gene single nucleotide polymorphisms (rsl2722877, rs3737820 and rs209914) and lumbar disc degeneration. METHODS: 280 patients with lumbar degenerative disc disease were selected, and 268 age- and sex-matched patients without lumbar degenerative disc disease were selected as control group. Al the patients came from Guangxi Zhuang Autonomous Region. The blood samples were col ected from the patients with lumbar degenerative disc disease and without lumbar degenerative disc disease to extract the genomic DNA and to design PCR primers and TaqMan probe for the rsl2722877 rs3737820 and rs209914 sites of COL9A2 gene. The al ele frequency and genotype frequency were analyzed with SPSS17.0 software. RESULTS AND CONCLUSION: The differences of genotype and the al ele frequency distribution of rsl2722877 rs3737820 and rs209914 sites were statistical y significant (P < 0.05). The COL9A2 gene single nucleotide polymorphisms rsl2722877, rs3737820 and rs209914 were closely related with susceptibility of lumbar degenerative disc disease in Guangxi Zhuang population.%  背景:有研究证实,腰椎间盘退变与基因有密切关系。目的:探讨 COL9A2基因单核苷酸多态性(rsl2722877、rs3737820和 rs209914)与腰椎间盘退变性疾病的关系。方法:腰椎间盘退变性疾病患者280例,年龄、性别匹配的268例非腰椎间盘退变性疾病患者作为正常对照组,均来自广西壮族。收集腰椎间盘退变性疾病患者、非腰椎间盘退变性疾病患者的血液样本,提取基因组 DNA,设计针对 COL9A2基因 rsl2722877、rs3737820和 rs209914位点的 PCR 引物、TaqMan 探针,利用 TaqMan 探针技术对 rsl2722877、rs3737820和 rs209914位点进行 PCR 荧光分型。采用 SPSS17.0软件进行等位基因频率及基因型频率分析。结果与结论:rsl2722877

  10. Cadherin-11 endocytosis through binding to clathrin promotes cadherin-11-mediated migration in prostate cancer cells.

    Science.gov (United States)

    Satcher, Robert L; Pan, Tianhong; Bilen, Mehmet A; Li, Xiaoxia; Lee, Yu-Chen; Ortiz, Angelica; Kowalczyk, Andrew P; Yu-Lee, Li-Yuan; Lin, Sue-Hwa

    2015-12-15

    Cadherin-11 (Cad11) cell adhesion molecule plays a role in prostate cancer cell migration. Because disassembly of adhesion complexes through endocytosis of adhesion proteins has been shown to play a role in cell migration, we examined whether Cad11 endocytosis plays a role in Cad11-mediated migration. The mechanism by which Cad11 is internalized is unknown. Using a GST pulldown assay, we found that clathrin binds to the Cad11 cytoplasmic domain but not to that of E-cadherin. Using deletion analysis, we identified a unique sequence motif, VFEEE, in the Cad11 membrane proximal region (amino acid residues 11-15) that binds to clathrin. Endocytosis assays using K(+)-depletion buffer showed that Cad11 internalization is clathrin dependent. Proximity ligation assays showed that Cad11 colocalizes with clathrin, and immunofluorescence assays showed that Cad11 localizes in vesicles that stain for the early endosomal marker Rab5. Deletion of the VFEEE sequence from the Cad11 cytoplasmic domain (Cad11-cla-Δ5) leads to inhibition of Cad11 internalization and reduces Cad11-mediated cell migration in C4-2B and PC3-mm2 prostate cancer cells. These observations suggest that clathrin-mediated internalization of Cad11 regulates surface trafficking of Cad11 and that dynamic turnover of Cad11 regulates the migratory function of Cad11 in prostate cancer cells.

  11. The new duty of care for nuclear power plant operators in Sec. 9a subpara. 2a AtG; Zur neuen Sorgepflicht der Kraftwerksbetreiber gem. paragraph 9a Abs. 2a AtG

    Energy Technology Data Exchange (ETDEWEB)

    Posser, Herbert [Freshfields Bruckhaus Deringer LLP, Duesseldorf (Germany)

    2014-07-15

    The new stipulation in Sec. 9a subpara. 2a AtG - pursuant to which operators of nuclear power plants are no longer entitled to use the interim storage facility in Gorleben for radioactive waste stemming from the reprocessing plants in Sellafield and La Hague, but have to establish further capacities in their own facilities for spent nuclear fuels at the site of the power plants - is illegal under constitutional law. It imposes an unproportional burden on the plant operators as well as on GNS, and infringes property rights without pursuing a legitimate purpose. (orig.)

  12. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  13. Phosphodiesterase 11A (PDE11A), Enriched in Ventral Hippocampus Neurons, is Required for Consolidation of Social but not Nonsocial Memories in Mice.

    Science.gov (United States)

    Hegde, Shweta; Capell, Will R; Ibrahim, Baher A; Klett, Jennifer; Patel, Neema S; Sougiannis, Alexander T; Kelly, Michy P

    2016-11-01

    The capacity to form long-lasting social memories is critical to our health and survival. cAMP signaling in the ventral hippocampal formation (VHIPP) appears to be required for social memory formation, but the phosphodiesterase (PDE) involved remains unknown. Previously, we showed that PDE11A, which degrades cAMP and cGMP, is preferentially expressed in CA1 and subiculum of the VHIPP. Here, we determine whether PDE11A is expressed in neurons where it could directly influence synaptic plasticity and whether expression is required for the consolidation and/or retrieval of social memories. In CA1, and possibly CA2, PDE11A4 is expressed throughout neuronal cell bodies, dendrites (stratum radiatum), and axons (fimbria), but not astrocytes. Unlike PDE2A, PDE9A, or PDE10A, PDE11A4 expression begins very low at postnatal day 7 (P7) and dramatically increases until P28, at which time it stabilizes to young adult levels. This expression pattern is consistent with the fact that PDE11A is required for social long-term memory (LTM) formation during adolescence and adulthood. Male and female PDE11 knockout (KO) mice show normal short-term memory (STM) for social odor recognition (SOR) and social transmission of food preference (STFP), but no LTM 24 h post training. Importantly, PDE11A KO mice show normal LTM for nonsocial odor recognition. Deletion of PDE11A may impair memory consolidation by impairing requisite protein translation in the VHIPP. Relative to WT littermates, PDE11A KO mice show reduced expression of RSK2 and lowered phosphorylation of S6 (pS6-235/236). Together, these data suggest PDE11A is selectively required for the proper consolidation of recognition and associative social memories.

  14. A rare case of trisomy 11q23.3-11q25 and trisomy 22q11.1-22q11.21.

    Science.gov (United States)

    Zou, P-S; Li, H-F; Chen, L-S; Ma, M; Chen, X-H; Xue, D; Cao, D-H

    2016-05-09

    Partial duplication of the long arm of chromosome 11 and the partial trisomy of 22q are uncommon karyotypic abnormalities. Here, we report the case of a 6-year-old girl who showed partial trisomy of 11q and 22q, as a result of a maternal balanced reciprocal translocation (11;22), and exhibited dysmorphic features, severe intellectual disability, brain malformations, and speech delay related to this unique chromosomal abnormality. Array comparative genomic hybridization (array CGH) revealed a gain in copy number on the long arm of chromosome 11, spanning at least 18.22 Mb. Additionally, there was a gain in copy number on the long arm of chromosome 22, spanning at least 3.46 Mb. FISH analysis using a chromosome 11 short arm telomere probe (11p14.2), a chromosome 11 long arm telomere probe (11q24.3), and a chromosome 22 long arm telomere probe (22q13.33) confirmed the origin of the marker chromosome. It has been confirmed by the State Key Laboratory of Medical Genetics of China that this is the first reported instance of the karyotype 47,XX, +der(22)t(11;22)(q23.3;q11.1)mat in the world. Our study reports an additional case that can be used to further characterize and delineate the clinical ramifications of partial trisomy of 11q and 22q.

  15. Two novel mutations of SCN9A (Nav1.7) are associated with partial congenital insensitivity to pain.

    Science.gov (United States)

    Staud, Roland; Price, Donald D; Janicke, David; Andrade, Edgard; Hadjipanayis, Angela G; Eaton, Will T; Kaplan, Lee; Wallace, Margaret R

    2011-03-01

    Insensitivity to pain is a rare disorder that is commonly associated with Hereditary Sensory and Autonomic Neuropathies (HSAN I-V) resulting often in autonomic dysfunction and premature death. Very few individuals have been reported with pain insensitivity lacking such autonomic neuropathies. We performed genetic, neurologic, psychological, and psychophysical evaluations in such an individual (OMIM 243000) and her first degree relatives. Sequence analysis of genomic DNA revealed two novel SCN9A mutations in this index case (IC). One was a non-conservative missense mutation (C1719R) in exon 26 present only in the IC and one parent. Further sequence analysis of the child's DNA revealed a 1-bp splice donor deletion in intron 17 which was also present in the other parent and one sibling. Detailed psychophysical testing was used to phenotypically characterize the IC, her family members, and 10 matched normal controls. Similar to family members and controls the IC showed normal somatosensory functioning for non-nociceptive mechanoreception and warmth. However, she demonstrated diminished ability to detect cool temperatures combined with profound deficits in heat and mechanical nociception. Congenital insensitivity to pain in our IC was associated with two novel SCN9A mutations which most likely resulted in a Nav1.7 channelopathy. However, in contrast to individuals with other SCN9A mutations, the observed pain insensitivity was relative and not absolute, which may be consistent with hypomorphic effects of one or both mutations. The ability to sense at least some danger signals may be advantageous and ameliorate the otherwise increased morbidity and mortality of some individuals with congenital insensitivity to pain.

  16. Mutations in sodium-channel gene SCN9A cause a spectrum of human genetic pain disorders

    OpenAIRE

    Drenth, J.P.H.; Waxman, S G

    2007-01-01

    The voltage-gated sodium-channel type IX alpha subunit, known as Na(v)1.7 and encoded by the gene SCN9A, is located in peripheral neurons and plays an important role in action potential production in these cells. Recent genetic studies have identified Na(v)1.7 dysfunction in three different human pain disorders. Gain-of-function missense mutations in Na(v)1.7 have been shown to cause primary erythermalgia and paroxysmal extreme pain disorder, while nonsense mutations in Na(v)1.7 result in los...

  17. A SCN9A gene-encoded dorsal root ganglia sodium channel polymorphism associated with severe fibromyalgia

    OpenAIRE

    Vargas-Alarcon Gilberto; Alvarez-Leon Edith; Fragoso Jose-Manuel; Vargas Angelica; Martinez Aline; Vallejo Maite; Martinez-Lavin Manuel

    2012-01-01

    Abstract Background A consistent line of investigation suggests that autonomic nervous system dysfunction may explain the multi-system features of fibromyalgia (FM); and that FM is a sympathetically maintained neuropathic pain syndrome. Dorsal root ganglia (DRG) are key sympathetic-nociceptive short-circuit sites. Sodium channels located in DRG (particularly Nav1.7) act as molecular gatekeepers for pain detection. Nav1.7 is encoded in gene SCN9A of chromosome 2q24.3 and is predominantly expre...

  18. Absence of 11-keto reduction of cortisone and 11-ketotestosterone in the model organism zebrafish.

    Science.gov (United States)

    Tsachaki, Maria; Meyer, Arne; Weger, Benjamin; Kratschmar, Denise V; Tokarz, Janina; Adamski, Jerzy; Belting, Heinz-Georg; Affolter, Markus; Dickmeis, Thomas; Odermatt, Alex

    2017-02-01

    Zebrafish are widely used as model organism. Their suitability for endocrine studies, drug screening and toxicity assessements depends on the extent of conservation of specific genes and biochemical pathways between zebrafish and human. Glucocorticoids consist of inactive 11-keto (cortisone and 11-dehydrocorticosterone) and active 11β-hydroxyl forms (cortisol and corticosterone). In mammals, two 11β-hydroxysteroid dehydrogenases (11β-HSD1 and 11β-HSD2) interconvert active and inactive glucocorticoids, allowing tissue-specific regulation of glucocorticoid action. Furthermore, 11β-HSDs are involved in the metabolism of 11-oxy androgens. As zebrafish and other teleost fish lack a direct homologue of 11β-HSD1, we investigated whether they can reduce 11-ketosteroids. We compared glucocorticoid and androgen metabolism between human and zebrafish using recombinant enzymes, microsomal preparations and zebrafish larvae. Our results provide strong evidence for the absence of 11-ketosteroid reduction in zebrafish. Neither human 11β-HSD3 nor the two zebrafish 11β-HSD3 homologues, previously hypothesized to reduce 11-ketosteroids, converted cortisone and 11-ketotestosterone (11KT) to their 11β-hydroxyl forms. Furthermore, zebrafish microsomes were unable to reduce 11-ketosteroids, and exposure of larvae to cortisone or the synthetic analogue prednisone did not affect glucocorticoid-dependent gene expression. Additionally, a dual-role of 11β-HSD2 by inactivating glucocorticoids and generating the main fish androgen 11KT was supported. Thus, due to the lack of 11-ketosteroid reduction, zebrafish and other teleost fish exhibit a limited tissue-specific regulation of glucocorticoid action, and their androgen production pathway is characterized by sustained 11KT production. These findings are of particular significance when using zebrafish as a model to study endocrine functions, stress responses and effects of pharmaceuticals. © 2017 Society for Endocrinology.

  19. Structure of the bifunctional inhibitor of trypsin and alpha-amylase from ragi seeds at 2.9 A resolution.

    Science.gov (United States)

    Gourinath, S; Srinivasan, A; Singh, T P

    1999-01-01

    The crystal structure of a bifunctional inhibitor of alpha-amylase and trypsin from the seeds of ragi (Indian finger millet, Eleusine coracana Gaertneri) has been determined by an X-ray diffraction method. The inhibitor consists of 122 amino acids with five disulfide bridges and belongs to the plant alpha-amylase/trypsin-inhibitor family. This is the first crystal structure determination of a member of this family. The protein, purified from the seeds of ragi, has a molecular mass of 13300 Da with a pI of 10.3. Crystals were grown by a microdialysis method using ammonium sulfate as precipitant. The improved purification protocol and the modified crystallization conditions enabled reproducible growth of the crystals. The cell parameters are a = 41. 2, b = 47.4, c = 55.9 A. The intensity data were collected to 2.9 A resolution, and the crystal structure was determined using the molecular-replacement method. The structure was refined using the X-PLOR and CCP4 program packages to a conventional R factor of 21%. The structure contains four alpha-helices between residues 19-29, 37-51, 56-65 and 90-95, and two short antiparallel beta-strands between residues 67-70 and 73-75.

  20. Industrial Exhibition “11th Germany at CERN“

    CERN Multimedia

    FP Department

    2011-01-01

    Administration Building (Bldg. 60/61) Tuesday 25 January: 11a.m. - 5.30 p.m. Wednesday 26 January: 9 a.m. - 5 p.m. The Federal Ministry of Education and Research (BMBF), together with CERN, will hold the Industrial Exhibition “11th Germany at CERN”. Some 30 German companies will present their latest products/technologies related to the field of particle physics and their services to the scientists and buyers of CERN, establish contacts and find out about future purchasing opportunities. On 25 January, Dr. B. Vierkorn-Rudolph of the Federal Ministry of Education and Research and CERN Director-General, Prof. R. D. Heuer, will open the exhibition, followed by a tour of the stands. The main subjects are: electrical engineering, electronics, informatics, mechanical engineering, vacuum & low temperature technologies, instrumentation and safety. CERN staff wishing to obtain information concerning the programme, the exhibitors and their profiles or to get in contact with exhibitors are ...

  1. Industrial Exhibition “11th Germany at CERN“

    CERN Multimedia

    FP Department

    2010-01-01

    Administration Building (Bldg. 60/61) Tuesday 25 January: 11a.m. - 5.30 p.m. Wednesday 26 January: 9 a.m. - 5 p.m. The Federal Ministry of Education and Research (BMBF), together with CERN, will hold the Industrial Exhibition “11th Germany at CERN”. Some 30 German companies will present their latest products/technologies related to the field of particle physics and their services to the scientists and buyers of CERN, establish contacts and find out about future purchasing opportunities. On 25 January, Dr. B. Vierkorn-Rudolph of the Federal Ministry of Education and Research and CERN Director-General, Prof. R. D. Heuer, will open the exhibition, followed by a tour of the stands. The main subjects are: electrical engineering, electronics, informatics, mechanical engineering, vacuum & low temperature technologies, instrumentation and safety. CERN staff wishing to obtain information concerning the programme, the exhibitors and their profiles or to get in contact with exhibitors are r...

  2. A designer hyper interleukin 11 (H11 is a biologically active cytokine

    Directory of Open Access Journals (Sweden)

    Dams-Kozlowska Hanna

    2012-03-01

    Full Text Available Abstract Background Interleukin 11 (IL-11 is a pleiotropic cytokine with anti-apoptotic, anti-inflammatory and hematopoietic potential. The IL-11 activity is determined by the expression of the IL-11R receptor alpha (IL-11Rα and the signal transducing subunit β (gp130 on the cell membrane. A recombinant soluble form of the IL-11Rα (sIL-11Rα in combination with IL-11 acts as an agonist on cells expressing the gp130 molecule. We constructed a designer cytokine Hyper IL-11 (H11, which is exclusively composed of naturally existing components. It contains the full length sIL-11Rα connected with the mature IL-11 protein using their natural sequences only. Such a construct has two major advantages: (i its components are as close as possible to the natural forms of both proteins and (ii it lacks an artificial linker what should avoid induction of antibody production. Results The H11 construct was generated, the protein was produced in a baculovirus expression system and was then purified by using ion exchange chromatography. The H11 protein displayed activity in three independent bioassays, (i it induced acute phase proteins production in HepG2 cells expressing IL-11, IL-11Rα and gp130, (ii it stimulated the proliferation of B9 cells (cells expressing IL-11Rα and gp130 and (iii proliferation of Baf/3-gp130 cells (cells not expressing IL-11 and IL-11Rα but gp130. Moreover, the preliminary data indicated that H11 was functionally distinct from Hyper-IL-6, a molecule which utilizes the same homodimer of signal transducing receptor (gp130. Conclusions The biologically active H11 may be potentially useful for treatment of thrombocytopenia, infertility, multiple sclerosis, cardiovascular diseases or inflammatory disorders.

  3. The F11 receptor (F11R/JAM-A) in atherothrombosis: overexpression of F11R in atherosclerotic plaques.

    Science.gov (United States)

    Babinska, Anna; Azari, Bani M; Salifu, Moro O; Liu, Ruijie; Jiang, Xian-Cheng; Sobocka, Malgorzata B; Boo, Dorothy; Al Khoury, George; Deitch, Jonathan S; Marmur, Jonathan D; Ehrlich, Yigal H; Kornecki, Elizabeth

    2007-02-01

    F11R is the gene name for an adhesion protein, called the F11-receptor, aka JAM-A, which under normal physiological conditions is expressed constitutively on the surface of platelets and localized within tight junctions of endothelial cells (EC). Previous studies of the interactions between human platelets and EC suggested that F11R/JAM-A plays a crucial role in inflammatory thrombosis and atherosclerosis. The study reported here obtained in-vivo confirmation of this conclusion by investigating F11R/JAM-A protein and mRNA in patients with aortic and peripheral vascular disease and in an animal model of atherosclerosis. Molecular and immunofluorescence determinations revealed very high levels of F11R/JAM-A mRNA and F11R/JAM-A protein in atherosclerotic plaques of cardiovascular patients. Similar results were obtained with 12-week-old atherosclerosis-prone apoE-/- mice, an age in which atherosclerotic plaques are well established. Enhanced expression of the F11R/JAM-A message in cultured EC from human aortic and venous vessels was observed following exposure of the cells to cytokines. Determinations of platelet adhesion to cultured EC inflamed by combined cytokine treatment in the presence of F11R/JAM-A - antagonists provided data indicating that de novo expression of F11R/JAM-A on the luminal surface of inflamed EC has an important role in the conversion of EC to a thrombogenic surface. Further studies of these interactions under flow conditions and under in-vivo settings could provide a final proof of a causal role for F11R/JAM-A in the initiation of thrombosis. Based on our in-vitro and in-vivo studies to date, we propose that therapeutic drugs which antagonize the function of F11R/JAM-A should be tested as novel means for the prevention and treatment of atherosclerosis, heart attacks and stroke.

  4. 26 CFR 11.412(c)-11 - Election with respect to bonds.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Election with respect to bonds. 11.412(c)-11 Section 11.412(c)-11 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT...

  5. Effects of Designer Hyper-Interleukin 11 (H11 on Hematopoiesis in Myelosuppressed Mice.

    Directory of Open Access Journals (Sweden)

    Hanna Dams-Kozlowska

    Full Text Available The incidence of cancer is constantly increasing. Chemo/radiotherapy is one of major methods of treating cancer. Although adverse chemo/radiotherapy events, such as anemia and neutropenia, can be successfully cured, thrombocytopenia is still problematic. We constructed the Hyper-IL11 (H11 cytokine by linking soluble interleukin 11 receptor alpha (sIL-11Ralpha with IL-11. In vivo H11 activity was examined in myelosuppressed mice. Myelosuppression was induced by either i sublethal irradiation and carboplatin administration or ii sublethal irradiation. A dose of 100 μg/kg of H11 or IL-11 was administered subcutaneously for 7 days. IL-11 and H11 accelerated leukocyte, hematocrit and platelet recovery. The effect on the attenuation of thrombocytopenia was significant. Moreover, both cytokines increased the cellularity and numbers of megakaryocyte, erythroid, and granulocyte/macrophage progenitors in the bone morrow and spleen compared with the control. Although H11 was administered at a molar concentration that was three times lower, its effects were comparable with or better than those of IL-11; thus, the activity of H11 was superior to that of IL-11. Because no toxicity was observed after the intravenous administration of H11, this hyper-cytokine may be potentially useful for treatment of thrombocytopenia and other IL-11-dependent disorders.

  6. ATRA Signaling Regulates the Expression of COL9A1 through BMP2-WNT4-RUNX1 Pathway in Antler Chondrocytes.

    Science.gov (United States)

    Zhang, Hong-Liang; Guo, Bin; Yang, Zhan-Qing; Duan, Cui-Cui; Geng, Shuang; Wang, Kai; Yu, Hai-Fan; Yue, Zhan-Peng

    2017-09-01

    Although all-trans retinoic acid (ATRA) is involved in the regulation of cartilage growth and development, its regulatory mechanisms remain unknown. Here, we showed that ATRA could induce the expression of COL9A1 in antler chondrocytes. Silencing of cellular retinoic acid binding protein 2 (CRABP2) could impede the ATRA-induced upregulation of COL9A1, whereas overexpression of CRABP2 presented the opposite effect. RARα agonist Am80 induced the expression of COL9A1, whereas treatment with RARα antagonist Ro 41-5253 or RXRα small-interfering RNA (siRNA) caused an obvious blockage of ATRA on COL9A1. In antler chondrocytes, CYP26A1 and CYP26B1 weakened the sensitivity of ATRA to COL9A1. Simultaneously, Bone morphogenetic protein 2 (BMP2) and WNT4 mediated the regulation of ATRA on COL9A1 expression. Knockdown of WNT4 could abrogate the inhibitory effect of BMP2 overexpression on COL9A1. Conversely, constitutive expression of WNT4 reversed the upregulation of COL9A1 elicited by BMP2 siRNA. Together these data indicated that WNT4 might act downstream of BMP2 to mediate the effect of ATRA on COL9A1 expression. Further analysis evidenced that attenuation of runt-related transcription factor 1 (RUNX1) could prevent the stimulation of ATRA on COL9A1 expression, while exogenous rRUNX1 further enhanced this effectiveness. Moreover, RUNX1 might serve as an intermediate to mediate the regulation of BMP2 and WNT4 on COL9A1 expression. Collectively, ATRA signaling might regulate the expression of COL9A1 through BMP2-WNT4-RUNX1 pathway. © 2017 Wiley Periodicals, Inc.

  7. 12 CFR 791.11 - Open meetings.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Open meetings. 791.11 Section 791.11 Banks and... OBSERVATION OF NCUA BOARD MEETINGS Public Observation of NCUA Board Meetings Under the Sunshine Act § 791.11 Open meetings. Except as provided in § 791.12(a), any portion of any meeting of the Board shall be...

  8. 25 CFR 11.1104 - Shelter care.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Shelter care. 11.1104 Section 11.1104 Indians BUREAU OF... Minor-in-Need-of-Care Procedure § 11.1104 Shelter care. (a) A minor alleged to be a minor-in-need-of-care may be detained, pending a court hearing, in the following places: (1) A foster care...

  9. 46 CFR 160.174-11 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.174-11 Section 160.174-11 Shipping...: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Thermal Protective Aids § 160.174-11 Performance. (a) Thermal... between −30 °C (−22 °F) and +65 C (149 °F). (d) In water performance. The thermal protective aid must...

  10. 7 CFR 201.11a - Hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The...

  11. 15 CFR 700.11 - Priority ratings.

    Science.gov (United States)

    2010-01-01

    ... OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE NATIONAL SECURITY INDUSTRIAL BASE REGULATIONS DEFENSE PRIORITIES AND ALLOCATIONS SYSTEM Industrial Priorities § 700.11 Priority ratings. (a) Levels of...

  12. 28 CFR 542.11 - Responsibility.

    Science.gov (United States)

    2010-07-01

    ... REMEDY Administrative Remedy Program § 542.11 Responsibility. (a) The Community Corrections Manager (CCM... the Administrative Remedy Program at the Community Corrections Center (CCC), institution, regional...

  13. Lysine methyltransferase G9a is not required for DNMT3A/3B anchoring to methylated nucleosomes and maintenance of DNA methylation in somatic cells

    Directory of Open Access Journals (Sweden)

    Sharma Shikhar

    2012-01-01

    Full Text Available Abstract Background DNA methylation, histone modifications and nucleosome occupancy act in concert for regulation of gene expression patterns in mammalian cells. Recently, G9a, a H3K9 methyltransferase, has been shown to play a role in establishment of DNA methylation at embryonic gene targets in ES cells through recruitment of de novo DNMT3A/3B enzymes. However, whether G9a plays a similar role in maintenance of DNA methylation in somatic cells is still unclear. Results Here we show that G9a is not essential for maintenance of DNA methylation in somatic cells. Knockdown of G9a has no measurable effect on DNA methylation levels at G9a-target loci. DNMT3A/3B remain stably anchored to nucleosomes containing methylated DNA even in the absence of G9a, ensuring faithful propagation of methylated states in cooperation with DNMT1 through somatic divisions. Moreover, G9a also associates with nucleosomes in a DNMT3A/3B and DNA methylation-independent manner. However, G9a knockdown synergizes with pharmacologic inhibition of DNMTs resulting in increased hypomethylation and inhibition of cell proliferation. Conclusions Taken together, these data suggest that G9a is not involved in maintenance of DNA methylation in somatic cells but might play a role in re-initiation of de novo methylation after treatment with hypomethylating drugs, thus serving as a potential target for combinatorial treatments strategies involving DNMTs inhibitors.

  14. Voltage-gated sodium channel expressed in cultured human smooth muscle cells: involvement of SCN9A.

    Science.gov (United States)

    Jo, Taisuke; Nagata, Taiji; Iida, Haruko; Imuta, Hiroyuki; Iwasawa, Kuniaki; Ma, Ji; Hara, Kei; Omata, Masao; Nagai, Ryozo; Takizawa, Hajime; Nagase, Takahide; Nakajima, Toshiaki

    2004-06-04

    Voltage-gated Na(+) channel (I(Na)) is expressed under culture conditions in human smooth muscle cells (hSMCs) such as coronary myocytes. The aim of this study is to clarify the physiological, pharmacological and molecular characteristics of I(Na) expressed in cultured hSMCs obtained from bronchus, main pulmonary and coronary artery. I(Na), was recorded in these hSMCs and inhibited by tetrodotoxin (TTX) with an IC(50) value of approximately 10 nM. Reverse transcriptase/polymerase chain reaction (RT-PCR) analysis of mRNA showed the prominent expression of transcripts for SCN9A, which was consistent with the results of real-time quantitative RT-PCR. These results provide novel evidence that TTX-sensitive Na(+) channel expressed in cultured hSMCs is mainly composed of Na(v)1.7.

  15. Mutations in sodium-channel gene SCN9A cause a spectrum of human genetic pain disorders.

    Science.gov (United States)

    Drenth, Joost P H; Waxman, Stephen G

    2007-12-01

    The voltage-gated sodium-channel type IX alpha subunit, known as Na(v)1.7 and encoded by the gene SCN9A, is located in peripheral neurons and plays an important role in action potential production in these cells. Recent genetic studies have identified Na(v)1.7 dysfunction in three different human pain disorders. Gain-of-function missense mutations in Na(v)1.7 have been shown to cause primary erythermalgia and paroxysmal extreme pain disorder, while nonsense mutations in Na(v)1.7 result in loss of Na(v)1.7 function and a condition known as channelopathy-associated insensitivity to pain, a rare disorder in which affected individuals are unable to feel physical pain. This review highlights these recent developments and discusses the critical role of Na(v)1.7 in pain sensation in humans.

  16. Assembly of gold nanoparticles with H10TTPR(3a, 4, 5, 8, 9, 9a, 10, 11-octa-hydro-2H,3H-1,6,7,12-tetrathia-perylene) as the rigid cross-linker

    Institute of Scientific and Technical Information of China (English)

    SHAO Xiangfeng; WANG Tongxin; ZHANG Deqing; XU Wei; ZHU Daoben

    2004-01-01

    Gold nanoparticles were assembled with the rigid cross-linker, H10TTPR. The assembly process was studied with the UV-vis spectroscopy and TEM. By adjusting the amount of H10TTPR added to the gold nanoparticle solution, the aggregate form of gold nanoparticles could be controlled.

  17. Pathogenesis of Pancreatitis in Chickens after Experimental Infection with 9a5b Newcastle Disease Virus Mutant Isolate.

    Science.gov (United States)

    El-Bahrawy, A; Zaid, A; Sunden, Y; Sakurai, M; Ito, H; Ito, T; Morita, T

    2015-11-01

    The aim of this study was to investigate the effect of Newcastle disease virus (NDV) on the chicken pancreas. A virulent 9a5b mutant NDV isolate was inoculated intranasally into 32-day-old specific pathogen-free white Leghorn chickens. The pancreas was examined grossly and fixed for histopathological, immunohistochemical and electron microscopical investigations. Inflammatory changes were observed in the peripancreatic tissue at the early stage of infection (12 h post infection) and became more prevalent towards the end of the experiment. Multifocal areas of necrotizing inflammation were detected in the exocrine portion of the pancreas by 5 days post infection (dpi) and became more severe at 10 dpi. The endocrine islets were generally preserved, but slight degenerative changes were observed at 10 dpi. Immunohistochemically, NDV-nucleoprotein (NDV-NP) signals were detected in the peripancreatic tissues (associated with macrophages and other lymphoid cells) by 1 dpi. In the exocrine portion of the pancreas, NDV-NP signals were detected at 5 dpi and increased in intensity and distribution by 10 dpi. NDV particles were confirmed in the cytoplasm of exocrine acinar cells by transmission electron microscopy. CD3-positive cells were observed in the peripancreatic tissues earlier than in the pancreatic tissue. Moreover, in comparison with control chickens, insulin immunoexpression was unchanged, except on the last day of the experiment, when it was slightly reduced. The 9a5b NDV infection induced an inflammatory reaction and viral replication in the peripancreatic tissues earlier than in the pancreatic tissue. Furthermore, necrosis affected mainly the exocrine portion of the pancreas, while the endocrine portion was generally unaffected.

  18. CLSI EP9-A3在血液分析仪比对中的应用

    Institute of Scientific and Technical Information of China (English)

    石文; 戴永辉; 邱峰; 罗福东; 陈林; 马骥; 卢燕君; 林莉; 徐宁

    2016-01-01

    目的 探讨美国临床和实验室标准化协会(CLSI) EP9-A3文件在血液分析仪比对中的应用价值.方法 根据CLSI EP9-A3文件,用Sysmex XE-5000血液分析仪(XE-5000,参比系统X)和Sysmex XN-1000血液分析仪(XN-1000,待评系统Y)分别测定40份血标本,对WBC、RBC、Hb、PLT结果通过ESD法(extreme studentized deviate)进行离群值检验,选用最佳回归模型拟合回归方程,并计算各参数的95%置信区间(confidence interval,CI)和医学决定水平处的偏移,以≤1/2 TEa(国家临床检验中心室间质评允许总误差)为可接受标准.结果 通过ESD法确认离群值,排除离群值并补充相近浓度标本后来发现离群值点.Hb、PLT差值具有恒定CV变化,采用加权最小二乘法(weighted least squares,WLS)回归分析;WBC、RBC差值为混合变化,采用Passing-Bablok回归分析;将医学决定水平分别代入回归方程,其偏移均小于可接受标准.结论 XE-5000和XN-1000血液分析仪检测WBC、RBC、Hb、PLT结果具有可比性.

  19. 37 CFR 251.11 - Open meetings.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Open meetings. 251.11 Section... Copyright Arbitration Royalty Panel Meetings § 251.11 Open meetings. (a) All meetings of a Copyright Arbitration Royalty Panel shall be open to the public, with the exception of meetings that are listed in §...

  20. 7 CFR 1212.11 - Importer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Importer. 1212.11 Section 1212.11 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HONEY PACKERS AND IMPORTERS RESEARCH, PROMOTION, CONSUMER EDUCATION AND INDUSTRY INFORMATION ORDER Honey Packers and Importers Research,...

  1. 36 CFR 331.11 - Special events.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Special events. 331.11..., KENTUCKY AND INDIANA § 331.11 Special events. (a) Special events including, but not limited to, water... charged any fee by the sponsor of such permitted event unless the District Engineer has approved...

  2. 44 CFR 68.11 - Determination.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Determination. 68.11 Section... § 68.11 Determination. The board shall render its written decision within 45 days after the conclusion... Administrator for review and approval. The Administrator shall make the final base flood elevation determination...

  3. 22 CFR 142.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 142.11 Section 142... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Employment Practices § 142.11 Discrimination... discrimination in employment under any program or activity receiving Federal financial assistance. (2) A...

  4. 25 CFR 11.1115 - Information collection.

    Science.gov (United States)

    2010-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAW AND ORDER COURTS OF INDIAN OFFENSES AND LAW AND... collected to obtain a marriage license (§ 11.600) and a divorce decree (§ 11.606) from the Courts of Indian Offenses, and will be used by the courts to issue a marriage license or divorce decree. Response to...

  5. 11 CFR 9004.1 - Major parties.

    Science.gov (United States)

    2010-01-01

    ... Consumer Price Index in the manner described in 11 CFR 110.17(a). ... ENTITLEMENT OF ELIGIBLE CANDIDATES TO PAYMENTS; USE OF PAYMENTS § 9004.1 Major parties. The eligible candidates of each major party in a Presidential election shall be entitled to equal payments under 11...

  6. 28 CFR 11.2 - Pilot program.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Pilot program. 11.2 Section 11.2 Judicial... Pilot program. The Assistant Attorney General for Administration, in consultation with the Executive Office for United States Attorneys, shall designate the districts that will participate in the...

  7. 19 CFR 11.2 - Manufactured tobacco.

    Science.gov (United States)

    2010-04-01

    ... of the estimated duty on the manufactured tobacco covered thereby, the port director may permit... 19 Customs Duties 1 2010-04-01 2010-04-01 false Manufactured tobacco. 11.2 Section 11.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  8. 36 CFR 294.11 - Definition.

    Science.gov (United States)

    2010-07-01

    ... State Petitions for Inventoried Roadless Area Management § 294.11 Definition. Inventoried roadless areas... subsequent update or revision of those maps through the land management planning process. ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Definition. 294.11...

  9. 23 CFR 1.11 - Engineering services.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Engineering services. 1.11 Section 1.11 Highways FEDERAL... Engineering services. (a) Federal participation. Costs of engineering services performed by the State highway... to specific projects. (b) Governmental engineering organizations. The State highway department may...

  10. 11 CFR 100.142 - Bank loans.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Bank loans. 100.142 Section 100.142 Federal... Expenditures § 100.142 Bank loans. (a) General provisions. Repayment of a loan of money to a candidate or a... basis that assures repayment. (f) This section shall not apply to loans described in 11 CFR 100.83...

  11. 30 CFR 18.11 - Approval plate.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Approval plate. 18.11 Section 18.11 Mineral... plate. (a)(1) The notice of approval will be accompanied by a photograph of an approval plate, bearing... number shall be added to the original approval number on the approval plate. (Example: Original approval...

  12. 36 CFR 293.11 - Water rights.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Water rights. 293.11 Section...-PRIMITIVE AREAS § 293.11 Water rights. Nothing in the regulations in this part constitutes an expressed or implied claim or denial on the part of the Department of Agriculture as to exemption from State water laws....

  13. 30 CFR 795.11 - Assistance funding.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Assistance funding. 795.11 Section 795.11 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR SMALL... funding. (a) Use of funds. Funds specifically authorized for this program shall be used to provide...

  14. 34 CFR 604.11 - Planning requirements.

    Science.gov (United States)

    2010-07-01

    ... institutions of higher education—including community colleges, proprietary institutions, and independent colleges and universities—other providers of postsecondary education services, students, and the general... 34 Education 3 2010-07-01 2010-07-01 false Planning requirements. 604.11 Section 604.11 Education...

  15. 25 CFR 11.1002 - Custody.

    Science.gov (United States)

    2010-04-01

    ... Juvenile Offender Procedure § 11.1002 Custody. A minor may be taken into custody by a law enforcement officer if: (a) The officer observes the minor committing a delinquent act; or (b) The officer has... adult, and that the minor has committed the delinquent act; or (c) A warrant pursuant to § 11.1001 has...

  16. 41 CFR 50-203.11 - Review.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Review. 50-203.11 Section...-Healey Public Contracts Act § 50-203.11 Review. (a) Within twenty (20) days after service of the decision... administrative law judge an original and four copies of a petition for review of the decision. The petition...

  17. 11 CFR 9428.4 - Contents.

    Science.gov (United States)

    2012-01-01

    ... voter identification number, the state's Privacy Act notice required at 11 CFR 9428.6(c) shall be... 11 Federal Elections 1 2012-01-01 2012-01-01 false Contents. 9428.4 Section 9428.4 Federal....) National Mail Voter Registration Form § 9428.4 Contents. (a) Information about the applicant. The...

  18. 11 CFR 8.4 - Contents.

    Science.gov (United States)

    2009-01-01

    ... voter identification number, the state's Privacy Act notice required at 11 CFR 8.6(c) shall be reprinted... 11 Federal Elections 1 2009-01-01 2009-01-01 false Contents. 8.4 Section 8.4 Federal Elections... Voter Registration Form § 8.4 Contents. (a) Information about the applicant. The application shall...

  19. 12 CFR 1780.11 - Computing time.

    Science.gov (United States)

    2010-01-01

    ... the prescribed period for the responsive filing. (3) If service was made by electronic media... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Computing time. 1780.11 Section 1780.11 Banks and Banking OFFICE OF FEDERAL HOUSING ENTERPRISE OVERSIGHT, DEPARTMENT OF HOUSING AND URBAN...

  20. 36 CFR 28.11 - Nonconforming uses.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Nonconforming uses. 28.11 Section 28.11 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR FIRE... insurance practices), destroyed or rendered a hazard, whether by fire, natural disaster, abandonment or...

  1. 44 CFR 12.11 - Public notice.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Public notice. 12.11 Section 12.11 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND... and purpose of the committee, should be published in the Federal Register at least 15 days prior...

  2. 7 CFR 953.11 - District.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false District. 953.11 Section 953.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements.... District No. 3. James City and Nansemond Counties and the cities of Chesapeake and Virginia Beach in...

  3. 32 CFR 727.11 - Supervision.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Supervision. 727.11 Section 727.11 National... Supervision. The Judge Advocate General will exercise supervision over all legal assistance activities in the Department of the Navy. Subject to the supervision of the Judge Advocate General, officers in charge of...

  4. 9 CFR 145.11 - Supervision.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Supervision. 145.11 Section 145.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Supervision. (a) The Official State Agency may designate qualified persons as Authorized Agents to do...

  5. The Post 9/11 English Teacher

    Science.gov (United States)

    English Journal, 2005

    2005-01-01

    An English teacher offers his thoughts on what they could learn about their role in the post 9/11-world and suggests reflecting on the events of the incident as professionals. The 9/11 Commission Report defines an important role for education and recommends US funding to improve public education, vocational education, and halving adult illiteracy…

  6. 9 CFR 4.11 - Stipulations.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Stipulations. 4.11 Section 4.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE RULES OF PRACTICE GOVERNING PROCEEDINGS UNDER THE ANIMAL WELFARE ACT Supplemental Rules...

  7. 5 CFR 1690.11 - Plan year.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Plan year. 1690.11 Section 1690.11... Plan year. The Thrift Savings Plan's plan year is established on a calendar-year basis for all purposes, except where another applicable provision of law requires that a fiscal year or other basis be used. As...

  8. 40 CFR 130.11 - Program management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Program management. 130.11 Section 130... PLANNING AND MANAGEMENT § 130.11 Program management. (a) State agencies may apply for grants under sections 106, 205(j) and 205(g) to carry out water quality planning and management activities....

  9. 43 CFR 29.11 - Investment.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Investment. 29.11 Section 29.11 Public... Investment. (a) The monies accumulated in the Fund shall be prudently invested in the following types of... investment advisor or custodian to the Fund, or their affiliates may be purchased or held by the Fund....

  10. 40 CFR 405.11 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Specialized definitions. 405.11 Section 405.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... process. It can be calculated by multiplying the fats, proteins and carbohydrates by factors of 0.890,...

  11. 26 CFR 1.61-11 - Pensions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Pensions. 1.61-11 Section 1.61-11 Internal... Pensions. (a) In general. Pensions and retirement allowances paid either by the Government or by private... the cost of a pension and was not taxable on his employer's contributions, the full amount of the...

  12. 50 CFR 300.11 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Definitions. 300.11 Section 300.11 Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS... exploitation of living marine resources as a harvesting vessel, mothership, or any other support...

  13. 14 CFR 1273.11 - State plans.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false State plans. 1273.11 Section 1273.11... plans. (a) Scope. The statutes for some programs require States to submit plans before receiving grants...,” States are allowed to simplify, consolidate and substitute plans. This section contains additional...

  14. Meeting March 11 / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2010-01-01

    Leedus tähistatakse 11. märtsil 2010 iseseisvuse taastamise 20. aastapäeva. Vilniusesse saabuvatest külalistest, kelle seas on ka Eesti president Toomas Hendrik Ilves. Töövisiit Vilniusesse 11.03.2010

  15. Performance evaluation of PL-11 platelet analyzer

    Institute of Scientific and Technical Information of China (English)

    张有涛

    2013-01-01

    Objective To evaluate and report the performance of PL-11 platelet analyzer. Methods Intravenous blood sam-ples anticoagulated with EDTA-K2 and sodium citrate were tested by the PL-11 platelet analyzer to evaluate the intra-assay and interassay coefficient of variation(CV),

  16. 28 CFR 11.9 - Administrative offset.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Administrative offset. 11.9 Section 11.9... Administrative offset. (a) Collection. The organization head may collect a claim pursuant to 31 U.S.C. 3716 from... administrative offset of monies other than salaries payable by the government. Collection by...

  17. 45 CFR 650.11 - Utilization reports.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Utilization reports. 650.11 Section 650.11 Public... Utilization reports. Paragraph (h) of the standard Patent Rights clause set forth in § 650.4 obliges grantees “to submit on request periodic reports no more frequently than annually on the utilization of a...

  18. 16 CFR 312.11 - Rulemaking review.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Rulemaking review. 312.11 Section 312.11 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER SPECIFIC ACTS OF CONGRESS CHILDREN'S ONLINE... information relating to children, children's ability to obtain access to information of their choice...

  19. 49 CFR 11.114 - Cooperative research.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Cooperative research. 11.114 Section 11.114... research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects, each institution is responsible...

  20. 7 CFR 920.11 - Handle.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Handle. 920.11 Section 920.11 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE KIWIFRUIT GROWN IN CALIFORNIA...

  1. 42 CFR 136a.11 - Services available.

    Science.gov (United States)

    2010-10-01

    ..., public health nursing and preventive care including immunizations, and health examination of special... same health services in each area served. The services provided to any particular Indian community will... 42 Public Health 1 2010-10-01 2010-10-01 false Services available. 136a.11 Section 136a.11...

  2. 42 CFR 136.11 - Services available.

    Science.gov (United States)

    2010-10-01

    ..., public health nursing and preventive care (including immunizations), and health examination of special... same health services in each area served. The services provided to any particular Indian community will... 42 Public Health 1 2010-10-01 2010-10-01 false Services available. 136.11 Section 136.11...

  3. 14 CFR 21.11 - Applicability.

    Science.gov (United States)

    2010-01-01

    ...) Procedural requirements for the issue of type certificates for aircraft, aircraft engines, and propellers... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Applicability. 21.11 Section 21.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT...

  4. 24 CFR 3500.11 - Mailing.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Mailing. 3500.11 Section 3500.11 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN...

  5. 5 CFR 2430.11 - Further proceedings.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Further proceedings. 2430.11 Section 2430.11 Administrative Personnel FEDERAL LABOR RELATIONS AUTHORITY, GENERAL COUNSEL OF THE FEDERAL LABOR... scheduling oral argument, additional written submissions, or an evidentiary hearing, shall specify the...

  6. 48 CFR 536.570-11 - Heat.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Heat. 536.570-11 Section... OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Contract Clauses 536.570-11 Heat. Insert the clause at 552.236-80, Heat, in solicitations and contracts if construction, dismantling...

  7. 48 CFR 11.203 - Customer satisfaction.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Customer satisfaction. 11... PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 11.203 Customer satisfaction. Acquisition organizations shall communicate with customers to determine how well the requirements document...

  8. 40 CFR 11.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... information or material designated under the Atomic Energy Act of 1954, as amended, as “Restricted Data,” or “Formerly Restricted Data” which, additionally, is subject to the provisions of the Act and regulations of... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Purpose. 11.1 Section 11.1 Protection...

  9. 7 CFR 246.11 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... and physical activity habits, and in the prevention of nutrition-related problems through optimal use... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 246.11 Section 246.11 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE...

  10. 15 CFR 286.11 - Listings.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Listings. 286.11 Section 286.11 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... of the NIST recognition program. (c) The lists are made available to the public through various media...

  11. 11 CFR 9006.2 - Filing dates.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Filing dates. 9006.2 Section 9006.2 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN FUND: GENERAL ELECTION FINANCING REPORTS AND RECORDKEEPING § 9006.2 Filing dates. The reports required to be filed under 11 CFR...

  12. 18 CFR 11.7 - Effective date.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Effective date. 11.7... Dams § 11.7 Effective date. All annual charges imposed under this subpart will be computed beginning on the effective date of the license unless some other date is fixed in the license....

  13. 48 CFR 31.205-11 - Depreciation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Depreciation. 31.205-11....205-11 Depreciation. (a) Depreciation on a contractor's plant, equipment, and other capital facilities... method of depreciation or the class life asset depreciation range system is used, the residual value...

  14. 44 CFR 75.11 - Standards.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Standards. 75.11 Section 75... PROPERTIES UNDER SELF-INSURANCE PLAN Standards for Exemption § 75.11 Standards. (a) In order to be exempt... hazards which are covered under the Standard Flood Insurance Policy. (3) Provide coverage to...

  15. 46 CFR 11.901 - General provisions.

    Science.gov (United States)

    2010-10-01

    ... horsepower restrictions. (c) Except as provided in §§ 11.202 and 10.227, each applicant for an STCW... competence as set out under the appropriate STCW Regulations (incorporated by reference in § 11.102): (1... meet the appropriate performance standards set out in Section A-I/12 of the STCW Code....

  16. SUPPLEMENTAL ANALYSES FOR SOLVENT HOLD TANK SAMPLES MCU-11-314, MCU-11-315, MCU-11-316, MCU-11-317, MCU-11-318 AND MCU-11-319

    Energy Technology Data Exchange (ETDEWEB)

    Peters, T.; Washington, A; . Fondeur, F.; Fink, S.

    2011-09-29

    Savannah River National Laboratory (SRNL) periodically analyses solvent samples from Modular Caustic-Side Solvent Extraction Unit (MCU) in support of continuing operations. A quarterly analysis of the solvent is required to maintain solvent composition within specifications. Analytical results of the analyses of Solvent Hold Tank (SHT) samples MCU-11-314, MCU-11-315, MCU-11-316, MCU-11-317, MCU-11-318 and MCU-11-319 have been previously reported. MCU has experienced a modest decline in cesium removal efficiency while processing the current feed, 'Macrobatch 3'. While the target decontamination factor (DF) is 200, the fiscal year 2011 DF average is 161. The results of the prior solvent analysis report did not identify a specific factor that would correlate with the poor cesium decontamination beyond a low concentration of the suppressor, trioctylamine. New analyses of the quarterly sample are reported in this document, as well as a cross-check of {sup 137}Cs measurements for SRNL and F/H lab. Furthermore, in an attempt to discover the reason for the decline in DF at MCU, SRNL was tasked with analyzing numerous Caustic Wash Tank (CWT) and chemical feed samples.

  17. Identification and Characterization of CYP9A40 from the Tobacco Cutworm Moth (Spodoptera litura), a Cytochrome P450 Gene Induced by Plant Allelochemicals and Insecticides

    Science.gov (United States)

    Wang, Rui-Long; Staehelin, Christian; Xia, Qing-Qing; Su, Yi-Juan; Zeng, Ren-Sen

    2015-01-01

    Cytochrome P450 monooxygenases (P450s) of insects play crucial roles in the metabolism of endogenous and dietary compounds. Tobacco cutworm moth (Spodoptera litura), an important agricultural pest, causes severe yield losses in many crops. In this study, we identified CYP9A40, a novel P450 gene of S. litura, and investigated its expression profile and potential role in detoxification of plant allelochemicals and insecticides. The cDNA contains an open reading frame encoding 529 amino acid residues. CYP9A40 transcripts were found to be accumulated during various development stages of S. litura and were highest in fifth and sixth instar larvae. CYP9A40 was mainly expressed in the midgut and fat body. Larval consumption of xenobiotics, namely plant allelochemicals (quercetin and cinnamic acid) and insecticides (deltamethrin and methoxyfenozide) induced accumulation of CYP9A40 transcripts in the midgut and fat body. Injection of dsCYP9A40 (silencing of CYP9A40 by RNA interference) significantly increased the susceptibility of S. litura larvae to the tested plant allelochemicals and insecticides. These results indicate that CYP9A40 expression in S. litura is related to consumption of xenobiotics and suggest that CYP9A40 is involved in detoxification of these compounds. PMID:26393579

  18. Identification and Characterization of CYP9A40 from the Tobacco Cutworm Moth (Spodoptera litura), a Cytochrome P450 Gene Induced by Plant Allelochemicals and Insecticides.

    Science.gov (United States)

    Wang, Rui-Long; Staehelin, Christian; Xia, Qing-Qing; Su, Yi-Juan; Zeng, Ren-Sen

    2015-09-18

    Cytochrome P450 monooxygenases (P450s) of insects play crucial roles in the metabolism of endogenous and dietary compounds. Tobacco cutworm moth (Spodoptera litura), an important agricultural pest, causes severe yield losses in many crops. In this study, we identified CYP9A40, a novel P450 gene of S. litura, and investigated its expression profile and potential role in detoxification of plant allelochemicals and insecticides. The cDNA contains an open reading frame encoding 529 amino acid residues. CYP9A40 transcripts were found to be accumulated during various development stages of S. litura and were highest in fifth and sixth instar larvae. CYP9A40 was mainly expressed in the midgut and fat body. Larval consumption of xenobiotics, namely plant allelochemicals (quercetin and cinnamic acid) and insecticides (deltamethrin and methoxyfenozide) induced accumulation of CYP9A40 transcripts in the midgut and fat body. Injection of dsCYP9A40 (silencing of CYP9A40 by RNA interference) significantly increased the susceptibility of S. litura larvae to the tested plant allelochemicals and insecticides. These results indicate that CYP9A40 expression in S. litura is related to consumption of xenobiotics and suggest that CYP9A40 is involved in detoxification of these compounds.

  19. Identification and Characterization of CYP9A40 from the Tobacco Cutworm Moth (Spodoptera litura, a Cytochrome P450 Gene Induced by Plant Allelochemicals and Insecticides

    Directory of Open Access Journals (Sweden)

    Rui-Long Wang

    2015-09-01

    Full Text Available Cytochrome P450 monooxygenases (P450s of insects play crucial roles in the metabolism of endogenous and dietary compounds. Tobacco cutworm moth (Spodoptera litura, an important agricultural pest, causes severe yield losses in many crops. In this study, we identified CYP9A40, a novel P450 gene of S. litura, and investigated its expression profile and potential role in detoxification of plant allelochemicals and insecticides. The cDNA contains an open reading frame encoding 529 amino acid residues. CYP9A40 transcripts were found to be accumulated during various development stages of S. litura and were highest in fifth and sixth instar larvae. CYP9A40 was mainly expressed in the midgut and fat body. Larval consumption of xenobiotics, namely plant allelochemicals (quercetin and cinnamic acid and insecticides (deltamethrin and methoxyfenozide induced accumulation of CYP9A40 transcripts in the midgut and fat body. Injection of dsCYP9A40 (silencing of CYP9A40 by RNA interference significantly increased the susceptibility of S. litura larvae to the tested plant allelochemicals and insecticides. These results indicate that CYP9A40 expression in S. litura is related to consumption of xenobiotics and suggest that CYP9A40 is involved in detoxification of these compounds.

  20. 应用CLSI-EP9-A2文件评价两种总胆固醇试剂%Apply CLSI-EP9-A2 to Evaluate Two kinds of Total Cholesterol Reagent

    Institute of Scientific and Technical Information of China (English)

    袁美玲; 鞠少卿; 倪红兵

    2008-01-01

    目的 探讨在生化分析仪上使用非配套试剂替代配套试剂检测血清总胆固醇的可行性.方法 按照CLSI-EP9-A2文件提供的方法,每天取临床标本8份,分别用两种试剂测定样本总胆固醇,共测定5天,记录检测结果,并对两种试荆进行偏差评估.结果 采用两种试剂测定的胆固醇结果的相关系数为0.999,截距a=0.030,斜率b=0.995,无方法内、间的离群点,测定结果的偏差在允许误差范围内.结论 经过方法对比及偏差评估确定在本实验室使用非配套试剂替代配套试剂是可行的.

  1. A loss-of-function mutation in the SLC9A6 gene causes X-linked mental retardation resembling Angelman syndrome.

    Science.gov (United States)

    Takahashi, Yumi; Hosoki, Kana; Matsushita, Masafumi; Funatsuka, Makoto; Saito, Kayoko; Kanazawa, Hiroshi; Goto, Yu-Ichi; Saitoh, Shinji

    2011-12-01

    SLC9A6 mutations have been reported in families in whom X-linked mental retardation (XMR) mimics Angelman syndrome (AS). However, the relative importance of SLC9A6 mutations in patients with an AS-like phenotype or XMR has not been fully investigated. Here, the involvement of SLC9A6 mutations in 22 males initially suspected to have AS but found on genetic testing not to have AS (AS-like cohort), and 104 male patients with XMR (XMR cohort), was investigated. A novel SLC9A6 mutation (c.441delG, p.S147fs) was identified in one patient in the AS-like cohort, but no mutation was identified in XMR cohort, suggesting mutations in SLC9A6 are not a major cause of the AS-like phenotype or XMR. The patient with the SLC9A6 mutation showed the typical AS phenotype, further demonstrating the similarity between patients with AS and those with SLC9A6 mutations. To clarify the effect of the SLC9A6 mutation, we performed RT-PCR and Western blot analysis on lymphoblastoid cells from the patient. Expression of the mutated transcript was significantly reduced, but was restored by cycloheximide treatment, indicating the presence of nonsense mediated mRNA decay. Western blot analysis demonstrated absence of the normal NHE6 protein encoded for by SLC9A6. Taken together, these findings indicate a loss-of-function mutation in SLC9A6 caused the phenotype in our patient. Copyright © 2011 Wiley-Liss, Inc.

  2. 26 CFR 11.401(a)-11 - Qualified joint and survivor annuities.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 § 11.401(a)-11 Qualified joint and survivor annuities. (a) In general—(1) General rule...

  3. TCP over IEEE 802.11

    Directory of Open Access Journals (Sweden)

    P. Chenna Reddy

    2009-01-01

    Full Text Available IEEE 802.11 is a widely used wireless LAN standard for medium access control. TCP is a prominent transport protocol originally designed for wired networks. TCP treats packet loss as congestion and reduces the data rate. In wireless networks packets are lost not only due to congestion but also due to various other reasons. Hence there is need for making TCP adaptable to wireless networks. Various parameters of TCP and IEEE 802.11 can be set to appropriate values to achieve optimum performance results. In this paper optimum values for various parameters of IEEE 802.11 are determined. Network simulator NS2 is used for simulation.

  4. A novel SCN9A mutation responsible for primary erythromelalgia and is resistant to the treatment of sodium channel blockers.

    Science.gov (United States)

    Wu, Min-Tzu; Huang, Po-Yuan; Yen, Chen-Tung; Chen, Chih-Cheng; Lee, Ming-Jen

    2013-01-01

    Primary erythromelalgia (PE) is an autosomal dominant neurological disorder characterized by severe burning pain and erythema in the extremities upon heat stimuli or exercise. Mutations in human SCN9A gene, encoding the α-subunit of the voltage-gated sodium channel, Na(v)1.7, were found to be responsible for PE. Three missense mutations of SCN9A gene have recently been identified in Taiwanese patients including a familial (I136V) and two sporadic mutations (I848T, V1316A). V1316A is a novel mutation and has not been characterized yet. Topologically, I136V is located in DI/S1 segment and both I848T and V1316A are located in S4-S5 linker region of DII and DIII domains, respectively. To characterize the elelctrophysiological manifestations, the channel conductance with whole-cell patch clamp was recorded on the over-expressed Chinese hamster overy cells. As compared with wild type, the mutant channels showed a significant hyperpolarizing shift in voltage dependent activation and a depolarizing shift in steady-state fast inactivation. The recovery time from channel inactivation is faster in the mutant than in the wild type channels. Since warmth can trigger and exacerbate symptoms, we then examine the influence of tempearture on the sodium channel conduction. At 35°C, I136V and V1316A mutant channels exhibit a further hyperpolarizing shift at activation as compared with wild type channel, even though wild type channel also produced a significant hyperpolarizing shift compared to that of 25°C. High temperature caused a significant depolarizing shift in steady-state fast inactivation in all three mutant channels. These findings may confer to the hyperexcitability of sensory neurons, especially at high temperature. In order to identifying an effective treatment, we tested the IC₅₀ values of selective sodium channel blockers, lidocaine and mexiletine. The IC₅₀ for mexiletine is lower for I848T mutant channel as compared to that of the wild type and other two

  5. A novel SCN9A mutation responsible for primary erythromelalgia and is resistant to the treatment of sodium channel blockers.

    Directory of Open Access Journals (Sweden)

    Min-Tzu Wu

    Full Text Available Primary erythromelalgia (PE is an autosomal dominant neurological disorder characterized by severe burning pain and erythema in the extremities upon heat stimuli or exercise. Mutations in human SCN9A gene, encoding the α-subunit of the voltage-gated sodium channel, Na(v1.7, were found to be responsible for PE. Three missense mutations of SCN9A gene have recently been identified in Taiwanese patients including a familial (I136V and two sporadic mutations (I848T, V1316A. V1316A is a novel mutation and has not been characterized yet. Topologically, I136V is located in DI/S1 segment and both I848T and V1316A are located in S4-S5 linker region of DII and DIII domains, respectively. To characterize the elelctrophysiological manifestations, the channel conductance with whole-cell patch clamp was recorded on the over-expressed Chinese hamster overy cells. As compared with wild type, the mutant channels showed a significant hyperpolarizing shift in voltage dependent activation and a depolarizing shift in steady-state fast inactivation. The recovery time from channel inactivation is faster in the mutant than in the wild type channels. Since warmth can trigger and exacerbate symptoms, we then examine the influence of tempearture on the sodium channel conduction. At 35°C, I136V and V1316A mutant channels exhibit a further hyperpolarizing shift at activation as compared with wild type channel, even though wild type channel also produced a significant hyperpolarizing shift compared to that of 25°C. High temperature caused a significant depolarizing shift in steady-state fast inactivation in all three mutant channels. These findings may confer to the hyperexcitability of sensory neurons, especially at high temperature. In order to identifying an effective treatment, we tested the IC₅₀ values of selective sodium channel blockers, lidocaine and mexiletine. The IC₅₀ for mexiletine is lower for I848T mutant channel as compared to that of the wild type

  6. USEEIO v1.1 - Matrices

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset provides the basic building blocks for the USEEIO v1.1 model and life cycle results per $1 (2013 USD) demand for all goods and services in the model in...

  7. Cancer Diagnosis: 11 Tips for Coping

    Science.gov (United States)

    ... have cancer is a difficult experience. After your cancer diagnosis, you may feel anxious, afraid or overwhelmed and ... Here are 11 suggestions for coping with a cancer diagnosis. Try to obtain as much basic, useful information ...

  8. 25 CFR 11.1001 - Warrant.

    Science.gov (United States)

    2010-04-01

    ... Juvenile Offender Procedure § 11.1001 Warrant. The children's court may issue a warrant directing that a minor be taken into custody if the court finds there is probable cause to believe the minor committed...

  9. 25 CFR 11.1011 - Dispositional hearing.

    Science.gov (United States)

    2010-04-01

    ... ORDER CODE Juvenile Offender Procedure § 11.1011 Dispositional hearing. (a) A dispositional hearing... prepared by the minor and his or her attorney, if any. (e) The dispositional order constitutes a final...

  10. 24 CFR 320.11 - Insurance coverage.

    Science.gov (United States)

    2010-04-01

    ...) GOVERNMENT NATIONAL MORTGAGE ASSOCIATION, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT GUARANTY OF MORTGAGE-BACKED SECURITIES Pass-Through Type Securities § 320.11 Insurance coverage. The issuer shall maintain...

  11. 9/11 and Global Strategic Stability

    Institute of Scientific and Technical Information of China (English)

    Tang Yongsheng

    2011-01-01

    In the past ten years since 9/11, terrorism has become a growing threat to .international security, and to people's lives and property. Increasing incidents of terrorism have underlined the fundamental structural flaws in the international system,

  12. 11 Things to Know about Cerebral Palsy

    Science.gov (United States)

    ... processing SSI file 11 Things to Know about Cerebral Palsy Language: English Español (Spanish) Recommend on Facebook Tweet Share Compartir Cerebral palsy (CP) is the most common motor disability in ...

  13. 21 CFR 1002.11 - Supplemental reports.

    Science.gov (United States)

    2010-04-01

    ...) RADIOLOGICAL HEALTH RECORDS AND REPORTS Required Manufacturers' Reports for Listed Electronic Products § 1002.11 Supplemental reports. Prior to the introduction into commerce of a new or modified model within a...

  14. 7 CFR 930.11 - Handler.

    Science.gov (United States)

    2010-01-01

    ... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE TART CHERRIES GROWN IN THE STATES OF... Definitions § 930.11 Handler. Handler means any person who first handles cherries or causes cherries to...

  15. 40 CFR 459.11 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... AND STANDARDS PHOTOGRAPHIC POINT SOURCE CATEGORY Photographic Processing Subcategory § 459.11... subpart. (b) The term “product” shall mean articles developed or printed by photographic processes,...

  16. Physics at the FQMT'11 conference

    NARCIS (Netherlands)

    Špička, V.; Nieuwenhuizen, T.M.; Keefe, P.D.

    2012-01-01

    This paper deals with the recent state of the art of the following topics presented at the FQMT’11 conference: foundations of quantum physics, quantum measurement; nonequilibrium quantum statistical physics; quantum thermodynamics; quantum measurement, entanglement and coherence; dissipation,

  17. 7 CFR 3431.11 - Application.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION, AND EXTENSION SERVICE, DEPARTMENT OF AGRICULTURE VETERINARY MEDICINE LOAN REPAYMENT PROGRAM Administration of the Veterinary Medicine Loan Repayment Program § 3431.11 Application. Individuals who meet the eligibility...

  18. Reduction of CTRP9, a novel anti-platelet adipokine, contributes to abnormal platelet activity in diabetic animals.

    Science.gov (United States)

    Wang, Wenqing; Lau, Wayne Bond; Wang, Yajing; Ma, Xinliang; Li, Rong

    2016-01-11

    Platelet hyper-reactivity is a crucial cause of accelerated atherosclerosis increasing risk of thrombotic vascular events in diabetic patients. The mechanisms leading to abnormal platelet activity during diabetes are complex and not fully defined. The current study attempted to clarify the role of CTRP9, a novel adiponectin paralog, in enhanced platelet activity and determined whether CTRP9 may inhibit platelet activity. Adult male C57BL/6 J mice were randomized to receive high-fat diet (HFD) or normal diet (ND). 8 weeks after HFD, animals were sacrificed, and both plasma CTRP9 and platelet aggregation were determined. HFD-fed animals increased weight gain significantly, and became hyperglycemic and hyperinsulinemic 8 weeks post-HFD. Compared to ND animals, HFD animals exhibited significantly decreased plasma CTRP9 concentration and increased platelet response to ADP, evidenced by augmented aggregation amplitude, steeper aggregation slope, larger area under the curve, and shorter lag time (P animals. Taken together, our results suggest reduced plasma CTRP9 concentration during diabetes plays a causative role in platelet hyper-activity, contributing to platelet-induced cardiovascular damage during this pathologic condition. Enhancing CTRP9 production and/or exogenous supplementation of CTRP9 may protect against diabetic cardiovascular injury via inhibition of abnormal platelet activity.

  19. Psychometric Testing of the Personal Internet Gaming Disorder Evaluation-9: A New Measure Designed to Assess Internet Gaming Disorder.

    Science.gov (United States)

    Pearcy, Benjamin T D; Roberts, Lynne D; McEvoy, Peter M

    2016-05-01

    Internet Gaming Disorder (IGD) is in the early stages of recognition as a disorder, following its inclusion in the Diagnostic and Statistical Manual for Mental Disorders (DSM-5; American Psychiatric Association(1)) as a condition for further study. Existing measures of Internet gaming pathology are limited in their ability to measure IGD as defined in the DSM-5. We present the initial development and validation of a new measure derived from the proposed DSM-5 criteria for IGD, the Personal Internet Gaming Disorder Evaluation-9 (PIE-9). A student sample (n = 119) and a community sample (n = 285), sourced through a variety of online gaming forums, completed an online survey comprising the new measure, existing measures of IGD, and a range of health and demographic questions. Exploratory and confirmatory factor analysis supported a single factor structure for the 9-item PIE-9. Internal consistency (α = 0.89) and test-retest reliability (intraclass correlation [ICC] = 0.77) were high. Convergent validity was demonstrated with similar gaming addiction measures. Predictive validity was established through significant differences in distress and disability between those who met the criteria for IGD and those who did not. The distress and disability associated with meeting IGD criteria fell within the range of other common DSM-5 disorders. Preliminary testing of the PIE-9 has demonstrated that it is an efficient and straightforward measure for use in further research of IGD, and as a potential screening measure in clinical practice.

  20. Common variation at 1q24.1 (ALDH9A1 is a potential risk factor for renal cancer.

    Directory of Open Access Journals (Sweden)

    Marc Y R Henrion

    Full Text Available So far six susceptibility loci for renal cell carcinoma (RCC have been discovered by genome-wide association studies (GWAS. To identify additional RCC common risk loci, we performed a meta-analysis of published GWAS (totalling 2,215 cases and 8,566 controls of Western-European background with imputation using 1000 Genomes Project and UK10K Project data as reference panels and followed up the most significant association signals [22 single nucleotide polymorphisms (SNPs and 3 indels in eight genomic regions] in 383 cases and 2,189 controls from The Cancer Genome Atlas (TCGA. A combined analysis identified a promising susceptibility locus mapping to 1q24.1 marked by the imputed SNP rs3845536 (Pcombined =2.30x10-8. Specifically, the signal maps to intron 4 of the ALDH9A1 gene (aldehyde dehydrogenase 9 family, member A1. We further evaluated this potential signal in 2,461 cases and 5,081 controls from the International Agency for Research on Cancer (IARC GWAS of RCC cases and controls from multiple European regions. In contrast to earlier findings no association was shown in the IARC series (P=0.94; Pcombined =2.73x10-5. While variation at 1q24.1 represents a potential risk locus for RCC, future replication analyses are required to substantiate our observation.

  1. Reverse Genetic Analysis of Transcription FactorOsHox9, a Member of Homeobox Family, in Rice

    Institute of Scientific and Technical Information of China (English)

    AI Li-ping; SHEN Ao; GAO Zhi-chao; LI Zheng-long; SUN Qiong-lin; LI Ying-ying; LUAN Wei-jiang

    2014-01-01

    Homeobox transcription factors participate in the growth and development of plants by regulating cell differentiation, morphogenesis and environmental signal response. To reveal the functions of these transcription factors in rice, we constructed the RNAi vectors ofOsHox9, a member of homeobox family, and analyzed the function ofOsHox9 using reverse genetics. The plant height and tillering number of RNAi transgenic plants decreased compared with those of wild-type plants. Reverse transcription-polymerase chain reaction analysis showed thatOsHox9 expression reduced in the transgenic plants with phenotypic variance, whereas that in the transgenic plants without phenotypic variance was similar to that in the wild-type plants. This result suggests that the phenotypes of the transgenic plants were caused by RNAi effects. The tissue-specificity ofOsHox9 expression indicated that it was expressed in different organs, with high expression in stem apical meristem and young panicles. Subcelular location ofOsHox9 demonstrated that it was localized on the cell membrane.

  2. Identification of T-cell epitopes of Lol p 9, a major allergen of ryegrass (Lolium perenne) pollen.

    Science.gov (United States)

    Blaher, B; Suphioglu, C; Knox, R B; Singh, M B; McCluskey, J; Rolland, J M

    1996-07-01

    T-cell recognition of Lol p 9, a major allergen of ryegrass pollen, was investigated by using a T-cell line and T-cell clones generated from the peripheral blood of an atopic donor. The T-cell line reacted with purified Lol p 9, as well as with crude ryegrass pollen extract, but failed to cross-react with Bermuda grass pollen extract. All of six T-cell clones generated from this line proliferated in response to Lol p 9. Epitope mapping was carried out with a panel of 34 overlapping synthetic peptides, which spanned the entire sequence of the Lol p 9 12R isoform. The T-cell line responded to two of the peptides, Lol p 9 (105-116) and Lol p 9 (193-204), whereas reactivity with one or other of these peptides was shown by five T-cell clones. These two peptides contained sequences consistent with motifs previously reported for major histocompatibility complex class II-restricted peptides. HLA antibody blocking studies showed that presentation of peptide Lol p 9 (105-116) to one T-cell clone was HLA-DR-restricted; this clone expressed a T helper cell phenotype (CD3+, CD4+) and the T-cell receptor alpha beta. The identification of immunodominant T-cell epitope(s) on allergens is essential for devising safer and more effective immunotherapy strategies, which can interrupt the chain of events leading to allergic disease.

  3. The Runx-PU.1 pathway preserves normal and AML/ETO9a leukemic stem cells.

    Science.gov (United States)

    Staber, Philipp B; Zhang, Pu; Ye, Min; Welner, Robert S; Levantini, Elena; Di Ruscio, Annalisa; Ebralidze, Alexander K; Bach, Christian; Zhang, Hong; Zhang, Junyan; Vanura, Katrina; Delwel, Ruud; Yang, Henry; Huang, Gang; Tenen, Daniel G

    2014-10-01

    Runx transcription factors contribute to hematopoiesis and are frequently implicated in hematologic malignancies. All three Runx isoforms are expressed at the earliest stages of hematopoiesis; however, their function in hematopoietic stem cells (HSCs) is not fully elucidated. Here, we show that Runx factors are essential in HSCs by driving the expression of the hematopoietic transcription factor PU.1. Mechanistically, by using a knockin mouse model in which all three Runx binding sites in the -14kb enhancer of PU.1 are disrupted, we observed failure to form chromosomal interactions between the PU.1 enhancer and its proximal promoter. Consequently, decreased PU.1 levels resulted in diminished long-term HSC function through HSC exhaustion, which could be rescued by reintroducing a PU.1 transgene. Similarly, in a mouse model of AML/ETO9a leukemia, disrupting the Runx binding sites resulted in decreased PU.1 levels. Leukemia onset was delayed, and limiting dilution transplantation experiments demonstrated functional loss of leukemia-initiating cells. This is surprising, because low PU.1 levels have been considered a hallmark of AML/ETO leukemia, as indicated in mouse models and as shown here in samples from leukemic patients. Our data demonstrate that Runx-dependent PU.1 chromatin interaction and transcription of PU.1 are essential for both normal and leukemia stem cells.

  4. The application of CLSI-EP9-A2 standards in two kinds urea reagents%CLSI-EP9-A2标准在两种不同尿素试剂间的应用

    Institute of Scientific and Technical Information of China (English)

    葛仁美

    2010-01-01

    目的 通过对两种不同尿素试剂进行方法学比对分析,探讨各试剂测定血清尿素是否具有可比性.方法 依据美国临床和实验室标准研究所(CLSI)EP9-A2文件要求,每天随机从临床样本中抽取8份不同尿素浓度的血清样本,分别用两种试剂进行尿素的测定,共测定5天,记录检测结果,将结果进行相关回归分析.根据直线方程计算在医学决定水平处的预期偏倚(c)和预期偏倚的95%可信区间,并判断偏倚是否可以接受.结果 两种试剂对血清尿素测定结果的相关系数(r)=0.998,截距(a)=0.048,斜率(b)=0.987,回归方程:Y=0.987X+0.048.无方法内、间的离群点,两者结果具有可比性.结论 当用两种或两种以上以上试剂检测同一检验项目时,应进行方法比对和偏倚评估,判断其临床可接受性能,以保证检验结果的可比性.

  5. 46 CFR 11.202 - STCW endorsements.

    Science.gov (United States)

    2010-10-01

    ... abilities: (1) Personal survival techniques as set out in table A-VI/1-1 of the STCW Code (incorporated by... (incorporated by reference, see § 11.102). (3) Elementary first aid as set out in table A-VI/1-3 of the STCW... principles of bridge-resource management enumerated in Section B-VIII/2 of the STCW Code. (f)...

  6. 11 CFR 100.82 - Bank loans.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Bank loans. 100.82 Section 100.82 Federal... Contributions § 100.82 Bank loans. (a) General provisions. A loan of money to a political committee or a... prohibitions of 11 CFR 110.4, 110.20, part 114 and part 115; or (2) The lending institution making the loan...

  7. Inhibition of G9a/GLP Complex Promotes Long-Term Potentiation and Synaptic Tagging/Capture in Hippocampal CA1 Pyramidal Neurons.

    Science.gov (United States)

    Sharma, Mahima; Razali, Nuralyah Bte; Sajikumar, Sreedharan

    2016-06-01

    Epigenetic regulations play an important role in regulating the learning and memory processes. G9a/G9a-like protein (GLP) lysine dimethyltransferase complex controls a prominent histone H3 lysine9 dimethylation (H3K9me2) that results in transcriptional silencing of the chromatin. Here, we report that the inhibition of G9a/GLP complex by either of the substrate competitive inhibitors UNC 0638 or BIX 01294 reinforces protein synthesis-independent long-term potentiation (early-LTP) to protein synthesis-dependent long-term potentiation (late-LTP). The reinforcement effect was observed if the inhibitors were present during the induction of early-LTP and in addition when G9a/GLP complex inhibition was carried out by priming of synapses within an interval of 30 min before or after the induction of early-LTP. Surprisingly, the reinforced LTP by G9a/GLP complex inhibition was able to associate with a weak plasticity event from nearby independent synaptic populations, resulting in synaptic tagging/capture (STC). We have identified brain-derived neurotrophic factor (BDNF) as a critical plasticity protein that maintains G9a/GLP complex inhibition-mediated LTP facilitation and its STC. Our study reveals an epigenetic mechanism for promoting plasticity and associativity by G9a/GLP complex inhibition, and it may engender a promising epigenetic target for enhancing memory in neural networks.

  8. Differential effects of Kv11.1 activators on Kv11.1a, Kv11.1b and Kv11.1a/Kv11.1b channels

    DEFF Research Database (Denmark)

    Larsen, A P; Bentzen, Bo Hjorth; Grunnet, M

    2010-01-01

    K(v)11.1 channels are involved in regulating cellular excitability in various tissues including brain, heart and smooth muscle. In these tissues, at least two isoforms, K(v)11.1a and K(v)11.1b, with different kinetics, are expressed. K(v)11.1 activators are potential therapeutic agents, but their......, but their effects have only been tested on the K(v)11.1a isoform. In this study, the effects of two different K(v)11.1 activators, NS1643 and RPR260243, were characterized on K(v)11.1a and K(v)11.1b channels....

  9. EPICS release 3.11 specific documentation -- EPICS release notes for 3.11

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-01-19

    EPICS release 3.11 is now ready for user testing. A person who wants to set up a simplified application environment to boot an IOC and create databases using R3.11 should follow the directions in Appendix B, page 27, of the EPICS Source/Release Control Manual, Sept. 20, 1993. The R3.11 EPICS path at ANL/APS is /net/phebos/epics/R3.11 so the command to get the new release is /net/phebos/epics/R3.11/Unix/share/bin/getrel /net/phebos/epics/R3.11. An existing R3.8 short form report can be copied to this new directory and used to create a database. ANL/APS is currently testing an Application Developers Source/Release control system. It is not yet ready for general distribution. Attached are the EPICS R3.11 release notes.

  10. Crystallization, dehydration and experimental phasing of WbdD, a bifunctional kinase and methyltransferase from Escherichia coli O9a

    Energy Technology Data Exchange (ETDEWEB)

    Hagelueken, Gregor; Huang, Hexian [The University of St Andrews, North Haugh, St Andrews KY16 9ST, Scotland (United Kingdom); Harlos, Karl [University of Oxford, Roosevelt Drive, Oxford OX3 7BN (United Kingdom); Clarke, Bradley R.; Whitfield, Chris [University of Guelph, Ontario N1G 2W1 (Canada); Naismith, James H., E-mail: naismith@st-and.ac.uk [The University of St Andrews, North Haugh, St Andrews KY16 9ST, Scotland (United Kingdom)

    2012-10-01

    The optimization of WbdD crystals using a novel dehydration protocol and experimental phasing at 3.5 Å resolution by cross-crystal averaging followed by molecular replacement of electron density into a non-isomorphous 3.0 Å resolution native data set are reported. WbdD is a bifunctional kinase/methyltransferase that is responsible for regulation of lipopolysaccharide O antigen polysaccharide chain length in Escherichia coli serotype O9a. Solving the crystal structure of this protein proved to be a challenge because the available crystals belonging to space group I23 only diffracted to low resolution (>95% of the crystals diffracted to resolution lower than 4 Å and most only to 8 Å) and were non-isomorphous, with changes in unit-cell dimensions of greater than 10%. Data from a serendipitously found single native crystal that diffracted to 3.0 Å resolution were non-isomorphous with a lower (3.5 Å) resolution selenomethionine data set. Here, a strategy for improving poor (3.5 Å resolution) initial phases by density modification and cross-crystal averaging with an additional 4.2 Å resolution data set to build a crude model of WbdD is desribed. Using this crude model as a mask to cut out the 3.5 Å resolution electron density yielded a successful molecular-replacement solution of the 3.0 Å resolution data set. The resulting map was used to build a complete model of WbdD. The hydration status of individual crystals appears to underpin the variable diffraction quality of WbdD crystals. After the initial structure had been solved, methods to control the hydration status of WbdD were developed and it was thus possible to routinely obtain high-resolution diffraction (to better than 2.5 Å resolution). This novel and facile crystal-dehydration protocol may be useful for similar challenging situations.

  11. Crystallization, dehydration and experimental phasing of WbdD, a bifunctional kinase and methyltransferase from Escherichia coli O9a.

    Science.gov (United States)

    Hagelueken, Gregor; Huang, Hexian; Harlos, Karl; Clarke, Bradley R; Whitfield, Chris; Naismith, James H

    2012-10-01

    WbdD is a bifunctional kinase/methyltransferase that is responsible for regulation of lipopolysaccharide O antigen polysaccharide chain length in Escherichia coli serotype O9a. Solving the crystal structure of this protein proved to be a challenge because the available crystals belonging to space group I23 only diffracted to low resolution (>95% of the crystals diffracted to resolution lower than 4 Å and most only to 8 Å) and were non-isomorphous, with changes in unit-cell dimensions of greater than 10%. Data from a serendipitously found single native crystal that diffracted to 3.0 Å resolution were non-isomorphous with a lower (3.5 Å) resolution selenomethionine data set. Here, a strategy for improving poor (3.5 Å resolution) initial phases by density modification and cross-crystal averaging with an additional 4.2 Å resolution data set to build a crude model of WbdD is desribed. Using this crude model as a mask to cut out the 3.5 Å resolution electron density yielded a successful molecular-replacement solution of the 3.0 Å resolution data set. The resulting map was used to build a complete model of WbdD. The hydration status of individual crystals appears to underpin the variable diffraction quality of WbdD crystals. After the initial structure had been solved, methods to control the hydration status of WbdD were developed and it was thus possible to routinely obtain high-resolution diffraction (to better than 2.5 Å resolution). This novel and facile crystal-dehydration protocol may be useful for similar challenging situations.

  12. Crystallization, dehydration and experimental phasing of WbdD, a bifunctional kinase and methyltransferase from Escherichia coli O9a

    Science.gov (United States)

    Hagelueken, Gregor; Huang, Hexian; Harlos, Karl; Clarke, Bradley R.; Whitfield, Chris; Naismith, James H.

    2012-01-01

    WbdD is a bifunctional kinase/methyltransferase that is responsible for regulation of lipopolysaccharide O antigen polysaccharide chain length in Escherichia coli serotype O9a. Solving the crystal structure of this protein proved to be a challenge because the available crystals belonging to space group I23 only diffracted to low resolution (>95% of the crystals diffracted to resolution lower than 4 Å and most only to 8 Å) and were non-isomorphous, with changes in unit-cell dimensions of greater than 10%. Data from a serendipitously found single native crystal that diffracted to 3.0 Å resolution were non-isomorphous with a lower (3.5 Å) resolution selenomethionine data set. Here, a strategy for improving poor (3.5 Å resolution) initial phases by density modification and cross-crystal averaging with an additional 4.2 Å resolution data set to build a crude model of WbdD is desribed. Using this crude model as a mask to cut out the 3.5 Å resolution electron density yielded a successful molecular-replacement solution of the 3.0 Å resolution data set. The resulting map was used to build a complete model of WbdD. The hydration status of individual crystals appears to underpin the variable diffraction quality of WbdD crystals. After the initial structure had been solved, methods to control the hydration status of WbdD were developed and it was thus possible to routinely obtain high-resolution diffraction (to better than 2.5 Å resolution). This novel and facile crystal-dehydration protocol may be useful for similar challenging situations. PMID:22993091

  13. Crystallographic study of Glu58Ala RNase T1 x 2'-guanosine monophosphate at 1.9-A resolution.

    Science.gov (United States)

    Pletinckx, J; Steyaert, J; Zegers, I; Choe, H W; Heinemann, U; Wyns, L

    1994-02-22

    Glu58 is known to participate in phosphodiester transesterification catalyzed by the enzyme RNase T1. For Glu58 RNase T1, an altered mechanism has been proposed in which His40 replaces Glu58 as the base catalyst [Steyaert, J., Hallenga, K., Wyns, L., & Stanssens, P. (1990) Biochemistry 29, 9064-9072]. Glu58Ala Rnase T1 has been cocrystallized with guanosine 2'-monophosphate (2'-GMP). The crystals are of space group P2(1), with one molecule per asymmetric unit (a = 32.44 A, b = 49.64 A, c = 26.09 A, beta = 99.17 degrees). The three-dimensional structure of the enzyme was determined to a nominal resolution of 1.9 A, yielding a crystallographic R factor of 0.178 for all X-ray data. Comparison of this structure with wild-type structures leads to the following conclusions. The minor changes apparent in the tertiary structure can be explained by either the mutation of Glu58 or by the change in the space group. In the active site, the extra space available through the mutation of Glu58 is occupied by the phosphate group (after a reorientation) and by a solvent molecule replacing a carboxylate oxygen of Glu58. This solvent molecule is a candidate for participation in the altered mechanism of this mutant enzyme. Following up on a study of conserved water sites in RNase T1 crystallized in space group P2(1)2(1)2(1) [Malin, R., Zielenkiewicz, P., & Saenger, W. (1991) J. Mol. Biol. 266, 4848-4852], we investigated the hydration structure for four different packing modes of RNase T1.(ABSTRACT TRUNCATED AT 250 WORDS)

  14. Tri-State Synfuels Project Review: Volume 9A. Subcontract information. [Proposed Henderson, Kentucky coal to gasoline plant; water supply and civil engineering subcontracts

    Energy Technology Data Exchange (ETDEWEB)

    1982-06-01

    Volume 9A considers subcontract work done at the site involving hydrogeological studies with respect to water supply and geotechnical work with respect to the building foundations necessary based on boreholes drilled and the lithology of the area. (LTN)

  15. CERN takes off at Lift11

    CERN Multimedia

    Katarina Anthony

    2011-01-01

    CERN was especially featured at the Lift11 conference, held in Geneva early this month. Tara Shears delivered a keynote speech at the event, while Paul Oortman Gerlings (DGS-SEE) and Erik van der Bij (BE-CO) – winners of the Bulletin’s Lift11 competition – organised the CERN workshop.   Paul Oortman Gerlings takes questions at CERN's Lift11 workshop. Lift11 was an opportunity for CERN to reach today’s innovators and developers. “The event was filled with people eager to learn new ideas, who were not afraid to ask questions,” says Tara Shears, physicist from the LHCb Collaboration who presented an update on the status of the LHC. “People were amazed by what goes on inside CERN, by our science, our facilities – even by the way we carry out our day-to-day work. It is a branch of fundamental research that really seems to inspire everyone.” A small Lift11 group had the chance to take a tour of CERN, ...

  16. G9a/GLP histone lysine dimethyltransferase complex activity in the hippocampus and the entorhinal cortex is required for gene activation and silencing during memory consolidation.

    Science.gov (United States)

    Gupta-Agarwal, Swati; Franklin, Aimee V; Deramus, Thomas; Wheelock, Muriah; Davis, Robin L; McMahon, Lori L; Lubin, Farah D

    2012-04-18

    Learning triggers alterations in gene transcription in brain regions such as the hippocampus and the entorhinal cortex (EC) that are necessary for long-term memory (LTM) formation. Here, we identify an essential role for the G9a/G9a-like protein (GLP) lysine dimethyltransferase complex and the histone H3 lysine 9 dimethylation (H3K9me2) marks it catalyzes, in the transcriptional regulation of genes in area CA1 of the rat hippocampus and the EC during memory consolidation. Contextual fear learning increased global levels of H3K9me2 in area CA1 and the EC, with observable changes at the Zif268, DNMT3a, BDNF exon IV, and cFOS gene promoters, which occurred in concert with mRNA expression. Inhibition of G9a/GLP in the EC, but not in the hippocampus, enhanced contextual fear conditioning relative to control animals. The inhibition of G9a/GLP in the EC induced several histone modifications that include not only methylation but also acetylation. Surprisingly, we found that downregulation of G9a/GLP activity in the EC enhanced H3K9me2 in area CA1, resulting in transcriptional silencing of the non-memory permissive gene COMT in the hippocampus. In addition, synaptic plasticity studies at two distinct EC-CA1 cellular pathways revealed that G9a/GLP activity is critical for hippocampus-dependent long-term potentiation initiated in the EC via the perforant pathway, but not the temporoammonic pathway. Together, these data demonstrate that G9a/GLP differentially regulates gene transcription in the hippocampus and the EC during memory consolidation. Furthermore, these findings support the possibility of a role for G9a/GLP in the regulation of cellular and molecular cross talk between these two brain regions during LTM formation.

  17. miR-34a Modulates Angiotensin II-Induced Myocardial Hypertrophy by Direct Inhibition of ATG9A Expression and Autophagic Activity

    Science.gov (United States)

    Huang, He; Ye, Jing; Pan, Wei; Zhong, Yun; Cheng, Chuanfang; You, Xiangyu; Liu, Benrong; Xiong, Longgen; Liu, Shiming

    2014-01-01

    Cardiac hypertrophy is characterized by thickening myocardium and decreasing in heart chamber volume in response to mechanical or pathological stress, but the underlying molecular mechanisms remain to be defined. This study investigated altered miRNA expression and autophagic activity in pathogenesis of cardiac hypertrophy. A rat model of myocardial hypertrophy was used and confirmed by heart morphology, induction of cardiomyocyte autophagy, altered expression of autophagy-related ATG9A, LC3 II/I and p62 proteins, and decrease in miR-34a expression. The in vitro data showed that in hypertrophic cardiomyocytes induced by Ang II, miR-34a expression was downregulated, whereas ATG9A expression was up-regulated. Moreover, miR-34a was able to bind to ATG9A 3′-UTR, but not to the mutated 3′-UTR and inhibited ATG9A protein expression and autophagic activity. The latter was evaluated by autophagy-related LC3 II/I and p62 levels, TEM, and flow cytometry in rat cardiomyocytes. In addition, ATG9A expression induced either by treatment of rat cardiomyocytes with Ang II or ATG9A cDNA transfection upregulated autophagic activity and cardiomyocyte hypertrophy in both morphology and expression of hypertrophy-related genes (i.e., ANP and β-MHC), whereas knockdown of ATG9A expression downregulated autophagic activity and cardiomyocyte hypertrophy. However, miR-34a antagonized Ang II-stimulated myocardial hypertrophy, whereas inhibition of miR-34a expression aggravated Ang II-stimulated myocardial hypertrophy (such as cardiomyocyte hypertrophy-related ANP and β-MHC expression and cardiomyocyte morphology). This study indicates that miR-34a plays a role in regulation of Ang II-induced cardiomyocyte hypertrophy by inhibition of ATG9A expression and autophagic activity. PMID:24728149

  18. Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.

    Science.gov (United States)

    Tachibana, Makoto; Ueda, Jun; Fukuda, Mikiko; Takeda, Naoki; Ohta, Tsutomu; Iwanari, Hiroko; Sakihama, Toshiko; Kodama, Tatsuhiko; Hamakubo, Takao; Shinkai, Yoichi

    2005-04-01

    Histone H3 Lys 9 (H3-K9) methylation is a crucial epigenetic mark for transcriptional silencing. G9a is the major mammalian H3-K9 methyltransferase that targets euchromatic regions and is essential for murine embryogenesis. There is a single G9a-related methyltransferase in mammals, called GLP/Eu-HMTase1. Here we show that GLP is also important for H3-K9 methylation of mouse euchromatin. GLP-deficiency led to embryonic lethality, a severe reduction of H3-K9 mono- and dimethylation, the induction of Mage-a gene expression, and HP1 relocalization in embryonic stem cells, all of which were phenotypes of G9a-deficiency. Furthermore, we show that G9a and GLP formed a stoichiometric heteromeric complex in a wide variety of cell types. Biochemical analyses revealed that formation of the G9a/GLP complex was dependent on their enzymatic SET domains. Taken together, our new findings revealed that G9a and GLP cooperatively exert H3-K9 methyltransferase function in vivo, likely through the formation of higher-order heteromeric complexes.

  19. Physical and linkage mapping of the human and murine genes for the [alpha]1 chain of type IX collagen (COL9A1)

    Energy Technology Data Exchange (ETDEWEB)

    Warman, M.L. (Harvard Medical School, Boston, MA (United States) Children' s Hospital/Harvard Medical School, Boston, MA (United States)); Tiller, G.E.; Polumbo, P.A. (Vanderbilt Univ. Medical Center, Nashville, TN (United States)); Seldin, M.F.; Rochelle, J.M. (Duke Univ. Medical Center, Durham, NC (United States)); Knoll, J.H.M.; Cheng, Sou De (Children' s Hospital/Harvard Medical School, Boston, MA (United States)); Olsen, B.R. (Harvard Medical School, Boston, MA (United States))

    1993-09-01

    The IX collagen, a member of the FACIT family of extracellular matrix proteins, is a heterotrimer composed of three genetically distinct [alpha] chains. The cDNAs for the human and mouse [alpha]1(IX) chains have been cloned. In this paper the authors confirm the mapping of the human COL9A1 gene to chromosome 6q12-q13 by fluorescence in situ hybridization utilizing two genomic clones which also contain short tandem repeat polymorphisms. They also report the characterization of these repeats and their incorporation into the chromosome 6 linkage map. The COL9A1 locus shows no recombination with the marker D6Z1 (Z = 27.61 at [theta] = 0) and identifies the most likely locus order of KRAS1P-[D6Z1-COL9A1]-D6S30. In addition, using an interspecific backcross panel, they have mapped murine Col9a1 to mouse chromosome 1. Together with other comparative mapping results, these data suggest that the pericentric region of human chromosome 6 is homologous to the most proximal segment of mouse chromosome 1. These data may facilitate linkage studies with COL9A1 (or col9a1) as a candidate gene for hereditary chondrodysplasias and osteoarthritis. 35 refs., 2 figs., 2 tabs.

  20. HYDRAULIC CONDUCTIVITY OF SALTSTONE FORMULATED USING 1Q11, 2Q11 AND 3Q11 TANK 50 SLURRY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Reigel, M.; Nichols, R.

    2012-06-27

    As part of the Saltstone formulation work requested by Waste Solidification Engineering (WSE), Savannah River National Laboratory (SRNL) was tasked with preparing Saltstone samples for fresh property analysis and hydraulic conductivity measurements using actual Tank 50 salt solution rather than simulated salt solution. Samples of low level waste salt solution collected from Tank 50H during the first, second, and third quarters of 2011 were used to formulate the Saltstone samples. The salt solution was mixed with premix (45 wt % slag, 45 wt % fly ash, and 10 wt % cement), in a ratio consistent with facility operating conditions during the quarter of interest. The fresh properties (gel, set, bleed) of each mix were evaluated and compared to the recommended acceptance criteria for the Saltstone Production Facility. ASTM D5084-03, Method C was used to measure the hydraulic conductivity of the Saltstone samples. The hydraulic conductivity of Saltstone samples prepared from 1Q11 and 2Q11 samples of Tank 50H is 4.2E-9 cm/sec and 2.6E-9 cm/sec, respectively. Two additional 2Q11 and one 3Q11 sample were not successfully tested due to the inability to achieve stable readings during saturation and testing. The hydraulic conductivity of the samples made from Tank 50H salt solution compare well to samples prepared with simulated salt solution and cured under similar conditions (1.4E-9 - 4.9E-8 cm/sec).

  1. 'FIFA 11 for Health' for Europe. II:

    DEFF Research Database (Denmark)

    Ørntoft, Christina Øyangen; Fuller, Colin W; Larsen, Malte Nejst;

    2016-01-01

    Objectives To evaluate whether a modified ‘FIFA 11 for Health’ programme for non-communicable diseases had effects on body composition, blood pressure and physical fitness of Danish schoolchildren aged 10–12 years. Design A cluster-randomised controlled study with 7 intervention and 2 control...... schools. Participants 546 Danish 5th grade municipal schoolchildren allocated to an intervention group (IG; n=402: 11.1±0.4 (±SD) years, 150.1±7.0 cm, 41.3±8.4 kg) and a control group (CG; n=144: 11.0±0.5 years, 151.2±7.8 cm, 41.3±9.0 kg). Intervention As part of the physical education (PE) curriculum, IG...

  2. 'FIFA 11 for Health' for Europe. 1

    DEFF Research Database (Denmark)

    Fuller, Colin W; Ørntoft, Christina Øyangen; Larsen, Malte Nejst;

    2016-01-01

    age 11.1 (±0.4) years from five city and four country-side schools, 402 undertook the 'FIFA 11 for Health' programme and 144 acted as controls. As part of each school's PE curriculum, seven intervention schools received a 45 min Play Football period (football skills and 3 vs 3 games) and a 45 min Play...... Fair period (health issues and football drills) on a weekly-basis for 11 weeks. Control participants continued with their regular school PE activities. Participants completed preintervention and postintervention health knowledge and well-being questionnaires. RESULTS: Overall, health knowledge increase...... was significantly (pphysical activity, nutrition, hygiene and well-being. The social dimension of the well...

  3. Tl2Mo9Se11

    Directory of Open Access Journals (Sweden)

    Patrick Gougeon

    2010-08-01

    Full Text Available The structure of Tl2Mo9Se11, dithallium nonamolybdenum undecaselenide, is isotypic with Tl2Mo9S11 [Potel et al. (1980. Acta Cryst. B36, 1319–1322]. The structural set-up is characterized by a mixture of Mo6Sei8Sea6 and Mo12Sei14Sea6 cluster units in a 1:1 ratio. Both components are interconnected through interunit Mo—Se bonds. The cluster units are centered at Wyckoff positions 3a and 3b (point-group symmetry overline{3}.. The two TlI atoms are situated in the voids of the three-dimensional arrangement. Two of the five independent Se atoms and the Tl atoms lie on sites with 3. symmetry (Wyckoff site 6c.

  4. Blogging 9/11 and Memory Discourse

    Directory of Open Access Journals (Sweden)

    Maria Cristina Paganoni

    2011-09-01

    This article highlights a few of the salient discursive and linguistic patterns that recur in the 9/11 narratives that have multiplied online on several dedicated websites and investigates the evolution of 9/11 cultural memory practices, torn between the discourse of the unrepresentable and the imperative to remember. It claims that blogging 9/11, immediately after the attacks and over the years, well illustrates how the logic of memory and its interpretation of the past follow different criteria from history writing. It shows how memorialization practices, dictated by the fear of forgetting the vanishing present, contribute to that excess of memory that lies at the core of the instability and mutual competition of sources retrieved on the Internet and that might ultimately lead to a rethinking of what is the contribution of collective memory to historiography.

  5. Noncanonical Wnt11 signaling and cardiomyogenic differentiation.

    Science.gov (United States)

    Flaherty, Michael P; Dawn, Buddhadeb

    2008-10-01

    Although the molecular details remain unclear, Wnt signaling via both canonical and noncanonical pathways is integral to cardiac specification and morphogenesis. A growing body of evidence also suggests substantial overlap between these supposedly discrete pathways in cell- and context-dependent manners. The ability of Wnt11 to induce cardiomyogenesis both during embryonic development and in adult cells makes it an attractive candidate for preprogramming cells for cardiac repair. This review primarily discusses various aspects of noncanonical Wnt signaling in cardiogenesis with particular emphasis on Wnt11.

  6. 'FIFA 11 for Health' for Europe. II:

    DEFF Research Database (Denmark)

    Ørntoft, Christina Øyangen; Fuller, Colin W; Larsen, Malte Nejst

    2016-01-01

    Objectives To evaluate whether a modified ‘FIFA 11 for Health’ programme for non-communicable diseases had effects on body composition, blood pressure and physical fitness of Danish schoolchildren aged 10–12 years. Design A cluster-randomised controlled study with 7 intervention and 2 control...... carried out 2 weekly 45 min ‘FIFA 11 for Health’ sessions focusing on health issues, football skills and 3v3 games. CG continued regular school PE activities. Measurements of body composition, blood pressure at rest, Yo-Yo intermittent recovery level 1 children’s test (YYIR1C), balance, jump and sprint...

  7. Oracle Goldengate 11g complete cookbook

    CERN Document Server

    Gupta, Ankur

    2013-01-01

    Oracle Goldengate 11g Complete Cookbook follows the Cookbook style. Each recipe provides step by step instructions with various examples and scripts. This book provides the necessary information to successfully complete most of the possible administration tasks.Oracle Goldengate 11g Complete Cookbook is aimed at Database Administrators, Architects, and Middleware Administrators who are keen to know more about Oracle Goldengate. Whether you are handling Goldengate environments on a day-to-day basis, or using it just for migration, this book provides the necessary information required to success

  8. Optical absorption spectra of Ag-11 isomers

    DEFF Research Database (Denmark)

    Martinez, Jose Ignacio; Fernandez, E. M.

    2009-01-01

    The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground-stale confi......The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground...

  9. EPICS release 3.11.6 specific documentation -- Release notes for EPICS 3.11.6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-06-07

    These notes cover the following: (1) directions for switching to production APS release R3.11.6; (2) unbundling of channel access clients; (3) access security; (4) channel access additions; synchronous time support; and (5) description of major differences between R3.11.3 and R3.11.6 Also included is a list of new and/or updated documentation for the program.

  10. Wnt5a regulates ventral midbrain morphogenesis and the development of A9-A10 dopaminergic cells in vivo.

    Science.gov (United States)

    Andersson, Emma R; Prakash, Nilima; Cajanek, Lukas; Minina, Eleonora; Bryja, Vitezslav; Bryjova, Lenka; Yamaguchi, Terry P; Hall, Anita C; Wurst, Wolfgang; Arenas, Ernest

    2008-01-01

    Wnt5a is a morphogen that activates the Wnt/planar cell polarity (PCP) pathway and serves multiple functions during development. PCP signaling controls the orientation of cells within an epithelial plane as well as convergent extension (CE) movements. Wnt5a was previously reported to promote differentiation of A9-10 dopaminergic (DA) precursors in vitro. However, the signaling mechanism in DA cells and the function of Wnt5a during midbrain development in vivo remains unclear. We hereby report that Wnt5a activated the GTPase Rac1 in DA cells and that Rac1 inhibitors blocked the Wnt5a-induced DA neuron differentiation of ventral midbrain (VM) precursor cultures, linking Wnt5a-induced differentiation with a known effector of Wnt/PCP signaling. In vivo, Wnt5a was expressed throughout the VM at embryonic day (E)9.5, and was restricted to the VM floor and basal plate by E11.5-E13.5. Analysis of Wnt5a-/- mice revealed a transient increase in progenitor proliferation at E11.5, and a precociously induced NR4A2+ (Nurr1) precursor pool at E12.5. The excess NR4A2+ precursors remained undifferentiated until E14.5, when a transient 25% increase in DA neurons was detected. Wnt5a-/- mice also displayed a defect in (mid)brain morphogenesis, including an impairment in midbrain elongation and a rounded ventricular cavity. Interestingly, these alterations affected mostly cells in the DA lineage. The ventral Sonic hedgehog-expressing domain was broadened and flattened, a typical CE phenotype, and the domains occupied by Ngn2+ DA progenitors, NR4A2+ DA precursors and TH+ DA neurons were rostrocaudally reduced and laterally expanded. In summary, we hereby describe a Wnt5a regulation of Wnt/PCP signaling in the DA lineage and provide evidence for multiple functions of Wnt5a in the VM in vivo, including the regulation of VM morphogenesis, DA progenitor cell division, and differentiation of NR4A2+ DA precursors.

  11. Wnt5a regulates ventral midbrain morphogenesis and the development of A9-A10 dopaminergic cells in vivo.

    Directory of Open Access Journals (Sweden)

    Emma R Andersson

    Full Text Available Wnt5a is a morphogen that activates the Wnt/planar cell polarity (PCP pathway and serves multiple functions during development. PCP signaling controls the orientation of cells within an epithelial plane as well as convergent extension (CE movements. Wnt5a was previously reported to promote differentiation of A9-10 dopaminergic (DA precursors in vitro. However, the signaling mechanism in DA cells and the function of Wnt5a during midbrain development in vivo remains unclear. We hereby report that Wnt5a activated the GTPase Rac1 in DA cells and that Rac1 inhibitors blocked the Wnt5a-induced DA neuron differentiation of ventral midbrain (VM precursor cultures, linking Wnt5a-induced differentiation with a known effector of Wnt/PCP signaling. In vivo, Wnt5a was expressed throughout the VM at embryonic day (E9.5, and was restricted to the VM floor and basal plate by E11.5-E13.5. Analysis of Wnt5a-/- mice revealed a transient increase in progenitor proliferation at E11.5, and a precociously induced NR4A2+ (Nurr1 precursor pool at E12.5. The excess NR4A2+ precursors remained undifferentiated until E14.5, when a transient 25% increase in DA neurons was detected. Wnt5a-/- mice also displayed a defect in (midbrain morphogenesis, including an impairment in midbrain elongation and a rounded ventricular cavity. Interestingly, these alterations affected mostly cells in the DA lineage. The ventral Sonic hedgehog-expressing domain was broadened and flattened, a typical CE phenotype, and the domains occupied by Ngn2+ DA progenitors, NR4A2+ DA precursors and TH+ DA neurons were rostrocaudally reduced and laterally expanded. In summary, we hereby describe a Wnt5a regulation of Wnt/PCP signaling in the DA lineage and provide evidence for multiple functions of Wnt5a in the VM in vivo, including the regulation of VM morphogenesis, DA progenitor cell division, and differentiation of NR4A2+ DA precursors.

  12. Carbon-11 labelling of an inhibitor of acetylcholinesterase: [[sup 11]C]physostigmine

    Energy Technology Data Exchange (ETDEWEB)

    Bonnot-Lours, S.; Crouzel, C.; Prenant, C.; Hinnen, F. (CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot)

    1993-01-01

    Physostigmine, an alkaloid from calabar bean is a strong inhibitor of acetylcholinesterase and has been used clinically in the treatment of glaucoma, atropine intoxication, myasthenia gravis and more recently, in experimental trials in Alzheimer's disease. In order to study the AChE activity in the brain by positron emission tomography, we have undertaken the labelling of physostigmine with carbon-11. The synthesis involves the reaction of [[sup 11]C]methylisocyanate with eseroline. [[sup 11]C]Methylisocyanate was obtained by heating [[sup 11]C]acetylchloride with tetrabutylammonium azide in toluene. The synthesis of [[sup 11]C]CH[sub 3]COC1 involves the carbonation of methylmagnesium bromide in THF with cyclotron produced [[sup 11]C]carbon dioxide and the addition of phthaloyl dichloride. The [[sup 11]C]methylisocyanate is distilled into a solution of eseroline in ether with a small piece of sodium. After 10 minutes at 25[sup o]C, the solution is purified by HPLC and the appropriate fraction collected. Starting with 55.5 GBq (1.5 Ci) of [[sup 11]C]carbon dioxide, 0.92-1.48 GBq (25-40 mCi) of [[sup 11]C]Physostigmine are obtained 57 minutes after EOB. (author).

  13. Expression of PEG11 and PEG11AS transcripts in normal and callipyge sheep

    Directory of Open Access Journals (Sweden)

    Moody Diane E

    2004-08-01

    Full Text Available Abstract Background The callipyge mutation is located within an imprinted gene cluster on ovine chromosome 18. The callipyge trait exhibits polar overdominant inheritance due to the fact that only heterozygotes inheriting a mutant paternal allele (paternal heterozygotes have a phenotype of muscle hypertrophy, reduced fat and a more compact skeleton. The mutation is a single A to G transition in an intergenic region that results in the increased expression of several genes within the imprinted cluster without changing their parent-of-origin allele-specific expression. Results There was a significant effect of genotype (p DLK1, PEG11, and MEG8 in the muscles of lambs with the callipyge allele. DLK1 and PEG11 transcript levels were elevated in the hypertrophied muscles of paternal heterozygous animals relative to animals of the other three genotypes. The PEG11 locus produces a single 6.5 kb transcript and two smaller antisense strand transcripts, referred to as PEG11AS, in skeletal muscle. PEG11AS transcripts were detectable over a 5.5 kb region beginning 1.2 kb upstream of the PEG11 start codon and spanning the entire open reading frame. Analysis of PEG11 expression by quantitative PCR shows a 200-fold induction in the hypertrophied muscles of paternal heterozygous animals and a 13-fold induction in homozygous callipyge animals. PEG11 transcripts were 14-fold more abundant than PEG11AS transcripts in the gluteus medius of paternal heterozygous animals. PEG11AS transcripts were expressed at higher levels than PEG11 transcripts in the gluteus medius of animals of the other three genotypes. Conclusions The effect of the callipyge mutation has been to alter the expression of DLK1, GTL2, PEG11 and MEG8 in the hypertrophied skeletal muscles. Transcript abundance of DLK1 and PEG11 was highest in paternal heterozygous animals and exhibited polar overdominant gene expression patterns; therefore, both genes are candidates for causing skeletal muscle

  14. X-linked Christianson syndrome: heterozygous female Slc9a6 knockout mice develop mosaic neuropathological changes and related behavioral abnormalities

    Directory of Open Access Journals (Sweden)

    Jakub Sikora

    2016-01-01

    Full Text Available Christianson syndrome (CS is an X-linked neurodevelopmental and neurological disorder characterized in males by core symptoms that include non-verbal status, intellectual disability, epilepsy, truncal ataxia, postnatal microcephaly and hyperkinesis. CS is caused by mutations in the SLC9A6 gene, which encodes a multipass transmembrane sodium (potassium-hydrogen exchanger 6 (NHE6 protein, functional in early recycling endosomes. The extent and variability of the CS phenotype in female heterozygotes, who presumably express the wild-type and mutant SLC9A6 alleles mosaically as a result of X-chromosome inactivation (XCI, have not yet been systematically characterized. Slc9a6 knockout mice (Slc9a6 KO were generated by insertion of the bacterial lacZ/β-galactosidase (β-Gal reporter into exon 6 of the X-linked gene. Mutant Slc9a6 KO male mice have been shown to develop late endosomal/lysosomal dysfunction associated with glycolipid accumulation in selected neuronal populations and patterned degeneration of Purkinje cells (PCs. In heterozygous female Slc9a6 KO mice, β-Gal serves as a transcriptional/XCI reporter and thus facilitates testing of effects of mosaic expression of the mutant allele on penetrance of the abnormal phenotype. Using β-Gal, we demonstrated mosaic expression of the mutant Slc9a6 allele and mosaically distributed lysosomal glycolipid accumulation and PC pathology in the brains of heterozygous Slc9a6 KO female mice. At the behavioral level, we showed that heterozygous female mice suffer from visuospatial memory and motor coordination deficits similar to but less severe than those observed in X-chromosome hemizygous mutant males. Our studies in heterozygous Slc9a6 KO female mice provide important clues for understanding the likely phenotypic range of Christianson syndrome among females heterozygous for SLC9A6 mutations and might improve diagnostic practice and genetic counseling by helping to characterize this presumably

  15. 11 CFR 9407.3 - Open meetings.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Open meetings. 9407.3 Section 9407.3 Federal... meetings. (a) The Commissioners shall not jointly conduct, determine, or dispose of agency business other... every Commission meeting shall be open to public observation. (c) No additional right to participate...

  16. 14 CFR 381.11 - Refunds.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS SPECIAL EVENT TOURS § 381.11 Refunds. If promised admission to the primary event for which a Special Event Tour was organized is not furnished by the tour operator, at the tour price agreed to before departure (including any increases that the participant has accepted pursuant to § 381.13(a)), the...

  17. 22 CFR 217.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2) A...

  18. 25 CFR 11.400 - Assault.

    Science.gov (United States)

    2010-04-01

    ... Criminal Offenses § 11.400 Assault. (a) A person is guilty of assault if he or she: (1) Attempts to cause or purposely, knowingly or recklessly causes bodily injury to another; or (2) Negligently causes bodily injury to another with a deadly weapon; or (3) Attempts by physical menace to put another in fear...

  19. Postdisaster Psychological Intervention since 9/11

    Science.gov (United States)

    Watson, Patricia J.; Brymer, Melissa J.; Bonanno, George A.

    2011-01-01

    A wealth of research and experience after 9/11 has led to the development of evidence-based and evidence-informed guidelines and strategies to support the design and implementation of public mental health programs after terrorism and disaster. This article reviews advances that have been made in a variety of areas, including development of…

  20. 38 CFR 11.117 - Missing applications.

    Science.gov (United States)

    2010-07-01

    ....117 Section 11.117 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS LOANS BY BANKS ON AND PAYMENT OF ADJUSTED SERVICE CERTIFICATES Application for Payment of Adjusted Service... intention to claim the benefits of this Act, has been filed and the application cannot be found,...

  1. Specific and social phobias in ICD-11

    NARCIS (Netherlands)

    Emmelkamp, P.M.G.

    2012-01-01

    The purpose of this article is to discuss the current status of research with respect to specific phobias and social phobia as defined in the ICD-10 and DSM-IV, and to provide op- tions for their classification in the ICD-11. Both ICD-10 and DSM-IV identify three main classes of phobias: specific

  2. 25 CFR 11.1114 - Termination.

    Science.gov (United States)

    2010-04-01

    ... by the parents or guardian of the child. The petition shall state: (1) The name, birth date, and... functions; (iii) The parent(s) has subjected the minor to willful and repeated acts of sexual abuse; (iv... Minor-in-Need-of-Care Procedure § 11.1114 Termination. (a) Parental rights to a child may be...

  3. APOLLO 11 COMMANDER NEIL ARMSTRONG IN SIMULATOR

    Science.gov (United States)

    1969-01-01

    Apollo 11 commander Neil Armstrong is going through flight training in the lunar module simulator situated in the flight crew training building at KSC. Armstrong will pilot the lunar module to a moon landing on July 20, following launch from KSC on July 16.

  4. 11. septembri veidrad kohtuasjad / Christopher Bollyn

    Index Scriptorium Estoniae

    Bollyn, Christopher

    2007-01-01

    Autori väitel pole ükski 11. septembri terrorirünnaku ohvri hagi jõudnud kohtuistungini, kohtuvälise lahendini on jõudnud enamik umbes 6600 hagist. Terrorirünnakute väidetav korraldaja Khalid Sheik Mohammed on andnud ülestunnistusi, kuid nii mõnigi asjaolu lubab arvata, et neid ei maksa uskuda

  5. 40 CFR 434.11 - General definitions.

    Science.gov (United States)

    2010-07-01

    ... General Provisions § 434.11 General definitions. (a) The term “acid or ferruginous mine drainage” means mine drainage which, before any treatment, either has a pH of less than 6.0 or a total iron... post-mining areas. (c) The term “alkaline, mine drainage” means mine drainage which, before any...

  6. 36 CFR 61.11 - Information collection.

    Science.gov (United States)

    2010-07-01

    ... PROCEDURES FOR STATE, TRIBAL, AND LOCAL GOVERNMENT HISTORIC PRESERVATION PROGRAMS § 61.11 Information... with the exception of locational information concerning some properties that government historic.... 20240 and to the Office of Management and Budget, Office of Information and Regulatory...

  7. 44 CFR 11.76 - Claims procedures.

    Science.gov (United States)

    2010-10-01

    ... over to a shipping officer, supply officer, or contract packer indicating: (i) Name (or designation) and address of the shipping officer, supply officer, or contract packer indicating; (ii) Date the... applicable case enumerated in § 11.73(c)(8). (h) Money. Claims for loss of money deposited for safekeeping...

  8. 11 CFR 9038.1 - Audit.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Audit. 9038.1 Section 9038.1 Federal Elections... EXAMINATIONS AND AUDITS § 9038.1 Audit. (a) General. (1) The Commission will conduct an audit of the qualified... primary matching funds. The audit may be conducted at any time after the date of the...

  9. 7 CFR 1610.11 - Prepayments.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL TELEPHONE BANK, DEPARTMENT OF AGRICULTURE LOAN POLICIES § 1610.11 Prepayments. (a) Bank loans approved before November 1, 1993, may be prepaid in... prepay part or all of a Bank loan made on or after November 1, 1993, by paying the outstanding...

  10. USEEIOv1.1 - openLCA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a version of the full USEEIO v1.1 model in the openLCA schema serialized as JSON-LD that can be imported into openLCA software (www.openlca.org) v1.5 and...

  11. 49 CFR 585.11 - Scope.

    Science.gov (United States)

    2010-10-01

    ... OF TRANSPORTATION (CONTINUED) PHASE-IN REPORTING REQUIREMENTS Advanced Air Bag Phase-in Reporting Requirements § 585.11 Scope. This subpart establishes requirements for manufacturers of passenger cars and... air bag requirements of Standard No. 208, Occupant crash protection (49 CFR 571.208). ...

  12. 49 CFR 579.11 - Reporting responsibilities.

    Science.gov (United States)

    2010-10-01

    ... POTENTIAL DEFECTS Reporting of Safety Recalls and Other Safety Campaigns in Foreign Countries § 579.11... manufacturer determines to conduct a safety recall or other safety campaign in a foreign country covering a... other safety campaign must be conducted in its country with respect to a motor vehicle, item of...

  13. 30 CFR 884.11 - State eligibility.

    Science.gov (United States)

    2010-07-01

    ... ABANDONED MINE LAND RECLAMATION STATE RECLAMATION PLANS § 884.11 State eligibility. You, a State or Indian... for an approved State regulatory program by section 402(g)(8)(B) of SMCRA. The Navajo, Hopi, and Crow Indian tribes are exempt from the requirement for an approved regulatory program by section 405(k) of...

  14. Variant Humicola grisea CBH1.1

    Energy Technology Data Exchange (ETDEWEB)

    Goedegebuur, Frits; Gualfetti, Peter; Mitchinson, Colin; Larenas, Edmund

    2017-05-09

    Disclosed are variants of Humicola grisea CeI7A (CBH1.1), H. jecorina CBH1 variant or S. thermophilium CBH1, nucleic acids encoding the same and methods for producing the same. The variant cellulases have the amino acid sequence of a glycosyl hydrolase of family 7A wherein one or more amino acid residues are substituted.

  15. 7 CFR 1291.11 - Audit requirements.

    Science.gov (United States)

    2010-01-01

    ... PROGRAM-FARM BILL § 1291.11 Audit requirements. Each year that a State receives a grant under the SCBGP-FB, the State is required to conduct an audit of the expenditures of SCBGP-FB funds. If the Single Audit... audit of all SCBGP-FB funds no later than 60 days after the end date of the grant agreement. The...

  16. 36 CFR 1.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... § 1.1 Purpose. (a) The regulations in this chapter provide for the proper use, management, government... purposes of units of the National Park System: to conserve scenery, natural and historic objects, and wildlife, and to provide for the enjoyment of those resources in a manner that will leave them...

  17. 25 CFR 11.1010 - Adjudicatory hearing.

    Science.gov (United States)

    2010-04-01

    ... reasonable doubt, the children's court shall find the minor to be a juvenile offender and proceed to the dispositional hearing. (f) A finding that a minor is a juvenile offender constitutes a final order for purposes... ORDER CODE Juvenile Offender Procedure § 11.1010 Adjudicatory hearing. (a) The children's court shall...

  18. 25 CFR 11.1012 - Dispositional alternatives.

    Science.gov (United States)

    2010-04-01

    ... LAW AND ORDER CODE Juvenile Offender Procedure § 11.1012 Dispositional alternatives. (a) If a minor has been adjudged a juvenile offender, the children's court may make the following disposition: (1) Place the minor on probation subject to conditions set by the children's court; (2) Place the minor in...

  19. 25 CFR 11.1000 - Complaint.

    Science.gov (United States)

    2010-04-01

    ... Juvenile Offender Procedure § 11.1000 Complaint. A complaint must be filed by a law enforcement officer or... to the section(s) of this part which the minor is alleged to have violated; (c) The name, age, and address of the minor who is the subject of the complaint, if known; and (d) A plain and concise statement...

  20. 25 CFR 11.1005 - Preliminary inquiry.

    Science.gov (United States)

    2010-04-01

    ... ORDER CODE Juvenile Offender Procedure § 11.1005 Preliminary inquiry. (a) If a minor is placed in... purpose of determining: (1) Whether probable cause exist to believe the minor committed the alleged.... (b) If a minor has been released to the parents, guardian or custodian, the children's court shall...

  1. 25 CFR 11.1009 - Summons.

    Science.gov (United States)

    2010-04-01

    ... Juvenile Offender Procedure § 11.1009 Summons. (a) At least five working days prior to the adjudicatory hearing, the children's court shall issue summons to: (1) The minor; (2) The minor's parents, guardian or custodian; and (3) Any person the children's court or the minor believes necessary for the adjudication of...

  2. 25 CFR 11.905 - Jurisdiction.

    Science.gov (United States)

    2010-04-01

    ... following proceedings: (a) Proceedings in which a minor who resides in a community for which the court is established is alleged to be a juvenile offender, unless the children's court transfers jurisdiction to the Court of Indian Offenses pursuant to § 11.907 of this part. (b) Proceedings in which a minor who resides...

  3. Sibelius. Karelia Suite, Op. 11 / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Sibelius. Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi" DG 447 760-2GH (72 minutes: DDD)

  4. 11 CFR 6.170 - Compliance procedures.

    Science.gov (United States)

    2010-01-01

    ... procedures established in 29 CFR part 1613 pursuant to section 501 of the Rehabilitation Act of 1973 (29 U.S... Rehabilitation Act Officer receives a complaint that is not complete (See 11 CFR 6.101(c)), he or she will notify... Rehabilitation Act Officer will dismiss the complaint without prejudice. (3) If the Rehabilitation Act...

  5. 7 CFR 1205.11 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Procedures for Conduct of Sign-up Period Definitions § 1205.11 Administrator. The term Administrator means the Administrator of the Agricultural Marketing Service, or any officer or employee of USDA to...

  6. 29 CFR 785.11 - General.

    Science.gov (United States)

    2010-07-01

    ... to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL POLICY OR... Permittedâ to Work § 785.11 General. Work not requested but suffered or permitted is work time. For example, an employee may voluntarily continue to work at the end of the shift. He may be a pieceworker, he...

  7. 25 CFR 11.1200 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Child Protection and Domestic Violence Procedures § 11.1200 Definitions. For purposes of this subpart: Domestic violence means to inflict physical harm, bodily injury, or sexual assault, or the fear of imminent physical harm, bodily injury, or sexual assault on a family member. Family member means any of...

  8. 7 CFR 1219.11 - Handle.

    Science.gov (United States)

    2010-01-01

    ... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION, RESEARCH, AND INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.11 Handle. Handle means to pack, process, transport, purchase, or in any other way to place or cause Hass...

  9. 11 CFR 100.33 - Personal funds.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Personal funds. 100.33 Section 100.33 Federal....33 Personal funds. Personal funds of a candidate means the sum of all of the following: (a) Assets... which the candidate is the beneficiary; (6) Gifts of a personal nature that had been...

  10. 'FIFA 11 for Health' for Europe. 1

    DEFF Research Database (Denmark)

    Fuller, Colin W; Ørntoft, Christina Øyangen; Larsen, Malte Nejst;

    2016-01-01

    AIM: To modify the 'FIFA 11 for Health' programme to the European situation, and to assess its effects on health knowledge and well-being in Danish school children. METHOD: A two-cohort study with seven intervention and two control schools. Of the 546 Danish children (boys 269; girls 277) of mean...

  11. 'FIFA 11 for Health' for Europe. II:

    DEFF Research Database (Denmark)

    Ørntoft, Christina Øyangen; Fuller, Colin W; Larsen, Malte Nejst;

    2016-01-01

    Objectives To evaluate whether a modified ‘FIFA 11 for Health’ programme for non-communicable diseases had effects on body composition, blood pressure and physical fitness of Danish schoolchildren aged 10–12 years. Design A cluster-randomised controlled study with 7 intervention and 2 control sch...

  12. 37 CFR 11.24 - Reciprocal discipline.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Reciprocal discipline. 11.24... discipline. (a) Notification of OED Director. Within thirty days of being publicly censured, publicly... USPTO Director. The OED Director shall, in addition, without Committee on Discipline authorization,...

  13. Specific and social phobias in ICD-11

    NARCIS (Netherlands)

    Emmelkamp, P.M.G.

    2012-01-01

    The purpose of this article is to discuss the current status of research with respect to specific phobias and social phobia as defined in the ICD-10 and DSM-IV, and to provide op- tions for their classification in the ICD-11. Both ICD-10 and DSM-IV identify three main classes of phobias: specific ph

  14. 11 CFR 6.110 - Evaluation.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...

  15. 9 CFR 98.11 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Disease Exists § 98.11 Definitions. Animal and Plant Health Inspection Service. The Animal and Plant... Disease Diagnostic Laboratory. The Foreign Animal Disease Diagnostic Laboratory of the Animal and Plant Health Inspection Service. Herd of origin. The herd in which the donor dam is kept during the 60...

  16. 49 CFR 256.11 - Applications.

    Science.gov (United States)

    2010-10-01

    ... discussion of each organization's role; (4) A preliminary statement of work, and a detailed estimate of all... TRANSPORTATION FINANCIAL ASSISTANCE FOR RAILROAD PASSENGER TERMINALS Regulations Governing Applications for and Disbursement of Financial Assistance § 256.11 Applications. (a) Incorporation by reference in application...

  17. 33 CFR 66.01-11 - Lights.

    Science.gov (United States)

    2010-07-01

    ... the focal point of the lens. (5) Emit a color within the angle of 50% effective intensity with color... when plotted on the Standard Observer Diagram of the International Commission on Illumination (CIE). Table 66.01-11(5)—Coordinates of Chromaticity Color Coordinates of chromaticity x axis y axis White...

  18. Paving the Way for Apollo 11

    CERN Document Server

    Harland, David M

    2009-01-01

    In 'Paving the Way for Apollo 11' David Harland explains the lure of the Moon to classical philosophers, astronomers, and geologists, and how NASA set out to investigate the Moon in preparation for a manned lunar landing mission. It focuses particularly on the Lunar Orbiter and Surveyor missions.

  19. 36 CFR 800.11 - Documentation standards.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Documentation standards. 800... PROTECTION OF HISTORIC PROPERTIES The section 106 Process § 800.11 Documentation standards. (a) Adequacy of documentation. The agency official shall ensure that a determination, finding, or agreement under the...

  20. 11 CFR 9034.8 - Joint fundraising.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Joint fundraising. 9034.8 Section 9034.8... MATCHING FUND ENTITLEMENTS § 9034.8 Joint fundraising. (a) General. Nothing in this section shall supersede... engage in joint fundraising with other candidates, political committees or unregistered committees...

  1. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  2. ME1/1 Cathode Strip Chambers

    CERN Document Server

    Erchov, Yu V; Kamenev, Alexey; Karjavin, Vladimir; Khabarov, Serguei; Moissenz, P V; Moissenz, K P; Movchan, Sergey; Perelygin, Victor; Vassiliev, S E; Zarubin, Anatoli; Tchekhovski, V A

    2008-01-01

    The 76 innermost ME1/1 cathode strip chambers (CSC) of the CMS Experiment were designed and produced in Dubna. The chambers have been installed in the detector and commissioning has been completed. This paper describes the design of the CSCs, their main mechanical parameters and read-out electronics, and the results of tests with cosmic-ray muons.

  3. 30 CFR 707.11 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... FOR COAL EXTRACTION INCIDENT TO GOVERNMENT-FINANCED HIGHWAY OR OTHER CONSTRUCTION § 707.11 Applicability. (a) Coal extraction which is an incidental part of government-financed construction is exempt from the Act and this chapter. (b) Any person who conducts or intends to conduct coal extraction which...

  4. 15 CFR 719.11 - Subpoenas.

    Science.gov (United States)

    2010-01-01

    ... INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE CHEMICAL WEAPONS CONVENTION REGULATIONS ENFORCEMENT § 719.11 Subpoenas. (a) Issuance. Upon the application of any party, supported by a satisfactory showing that there... punishable by the court as a contempt thereof. (b) Service. Subpoenas issued by the ALJ may be served by...

  5. Lithuania celebrates March 11 / Rokas M. Tracevskis

    Index Scriptorium Estoniae

    Tracevskis, Rokas M.

    2011-01-01

    11. märtsil tähistati Leedus iseseisvuse taastamise 21. aastapäeva. President Dalia Grybauskaite oli sellel ajal Brüsselis, kus toimus Euroopa Liidu valitsusjuhtide ja riigipeade erakorraline kriisikohtumine Liibüa teemal. Vilniuses toimunud meeleavaldustest

  6. 11 CFR 2.8 - Annual report.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Annual report. 2.8 Section 2.8 Federal Elections FEDERAL ELECTION COMMISSION SUNSHINE REGULATIONS; MEETINGS § 2.8 Annual report. The Commission shall report annually to Congress regarding its compliance with the requirements of the Government...

  7. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  8. Chromosome 11q13 deletion syndrome

    Science.gov (United States)

    Kim, Yu-Seon; Kim, Gun-Ha; Byeon, Jung Hye; Eun, So-Hee

    2016-01-01

    Chromosome 11q13 deletion syndrome has been previously reported as either otodental syndrome or oculo-oto-dental syndrome. The otodental syndrome is characterized by dental abnormalities and high-frequency sensorineural hearing loss, and by ocular coloboma in some cases. The underlying genetic defect causing otodental syndrome is a hemizygous microdeletion involving the FGF3 gene on chromosome 11q13.3. Recently, a new form of severe deafness, microtia (small ear) and small teeth, without the appearance of eye abnormalities, was also reported. In this report, we describe a 1-year-old girl presenting with ptosis of the left upper eyelid, right auricular deformity, high-arched palate, delayed dentition, simian line on the right hand, microcephaly, and developmental delay. In this patient, we identified a deletion in the chromosome 11q13.2-q13.3 (2.75 Mb) region by using an array-comparative genomic hybridization analysis. The deletion in chromosome 11q13 results in a syndrome characterized by variable clinical manifestations. Some of these manifestations involve craniofacial dysmorphology and require a functional workup for hearing, ophthalmic examinations, and long-term dental care. PMID:28018436

  9. The Post-9/11 Risk Agenda.

    Science.gov (United States)

    Franke, Ann H.

    2002-01-01

    Seeks to place the post-9/11 risk agenda for colleges and universities in historical perspective by offering a refresher on some of the most serious perennial risks for U.S. higher education. Offers an eight-point road map of how to enhance boards' risk management efforts. (EV)

  10. Sibelius. Karelia Suite, Op. 11 / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Sibelius. Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi" DG 447 760-2GH (72 minutes: DDD)

  11. 11. septembri veidrad kohtuasjad / Christopher Bollyn

    Index Scriptorium Estoniae

    Bollyn, Christopher

    2007-01-01

    Autori väitel pole ükski 11. septembri terrorirünnaku ohvri hagi jõudnud kohtuistungini, kohtuvälise lahendini on jõudnud enamik umbes 6600 hagist. Terrorirünnakute väidetav korraldaja Khalid Sheik Mohammed on andnud ülestunnistusi, kuid nii mõnigi asjaolu lubab arvata, et neid ei maksa uskuda

  12. 7 CFR 799.11 - Expedited procedures.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE ENVIRONMENTAL PROTECTION ENVIRONMENTAL QUALITY AND RELATED ENVIRONMENTAL CONCERNS-COMPLIANCE WITH THE NATIONAL ENVIRONMENTAL POLICY ACT § 799.11 Expedited procedures. Where emergency circumstances... Environmental Quality, consult with CEQ and/or EPA about alternative arrangements (7 CFR 3100.35)....

  13. 28 CFR 55.11 - General.

    Science.gov (United States)

    2010-07-01

    ... Administration DEPARTMENT OF JUSTICE (CONTINUED) IMPLEMENTATION OF THE PROVISIONS OF THE VOTING RIGHTS ACT REGARDING LANGUAGE MINORITY GROUPS Determining the Exact Language § 55.11 General. The requirements of section 4(f)(4) or section 203(c) apply with respect to the languages of language minority groups....

  14. 24 CFR 3280.11 - Certification label.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS General § 3280.11 Certification... knowledge and belief that this manufactured home has been inspected in accordance with the requirements of... manufactured home construction and safety standards in effect on the date of manufacture. See date plate....

  15. 25 CFR 23.11 - Notice.

    Science.gov (United States)

    2010-04-01

    ..., Tennessee, Vermont, Virginia, West Virginia or any territory or possession of the United States, notices... in Nebraska, North Dakota, or South Dakota, notices shall be sent to the following address: Aberdeen... Custody Proceedings and Payment for Appointed Counsel in State Courts § 23.11 Notice. (a) In any...

  16. 36 CFR 64.11 - Project performance.

    Science.gov (United States)

    2010-07-01

    ... AND ALLOCATIONS FOR RECREATION AND CONSERVATION USE OF ABANDONED RAILROAD RIGHTS-OF-WAY § 64.11... qualified staff or fee appraiser prior to the initiation of negotiations. The Bureau reserves the right to.... Salaries and wages of employee chargeable to more than one cost objective will be supported by appropriate...

  17. 7 CFR 1767.11 - Purpose.

    Science.gov (United States)

    2010-01-01

    ..., business and affairs of the borrower in accordance with the methods and principles of accounting of this... (CONTINUED) ACCOUNTING REQUIREMENTS FOR RUS ELECTRIC BORROWERS Uniform System of Accounts § 1767.11 Purpose...A for electric borrowers and by providing accounting methodologies and procedures which...

  18. 28 CFR 81.11 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... Administration DEPARTMENT OF JUSTICE (CONTINUED) CHILD ABUSE AND CHILD PORNOGRAPHY REPORTING DESIGNATIONS AND PROCEDURES Child Pornography Reporting Designations and Procedures § 81.11 Purpose. The regulations in this... pornography that are forwarded from the National Center for Missing and Exploited Children under the...

  19. Cluster rotational bands in 11B

    Directory of Open Access Journals (Sweden)

    Danilov A.N.

    2016-01-01

    Full Text Available Differential cross-sections of 11B+α inelastic scattering at E(α =65 MeV leading to most of the known 11B states at excitation energies up to 14 MeV were measured [1]. The data analysis was done using Modified diffraction model (MDM [2] allowing determining radii of excited states. Radii of the states with excitation energies less than ∼ 7 MeV coincide with the radius of the ground state with an accuracy not less than 0.1 - 0.15 fm. This result is consistent with traditional view on shell structure of low-lying states in 11B. Most of the observed high-energy excited states are distributed among four rotational bands. Moments of inertia of band states are close to the moment of inertia of the Hoyle state of 12C. The calculated radii, related to these bands, are 0.7 - 1.0 fm larger than the radius of the ground state, and are close to the Hoyle state radius. These results are in agreement with existing predictions about various cluster structure of 11B at high excitation energies.

  20. 40 CFR 469.11 - Compliance dates.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Compliance dates. 469.11 Section 469... Compliance dates. The compliance deadline for the BAT fluoride limitation shall be as soon as possible as... determined by the permit writer, but in no event later than July 1, 1984. The compliance date for PSES...

  1. 11 CFR 7.28 - Hearing date.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Hearing date. 7.28 Section 7.28 Federal... for Administrative Enforcement Proceedings § 7.28 Hearing date. (a) Setting of date by examiner. The examiner shall set the hearing at a reasonable time, date, and place. (b) Considerations....

  2. Teaching India. Footnotes. Volume 11, Number 2

    Science.gov (United States)

    Kuehner, Trudy

    2006-01-01

    On March 11-12, 2006 the FPRI's Marvin Wachman Fund for International Education hosted 44 teachers from 16 states across the country for a weekend of discussion on teaching about India. Sessions included: (1) Why It's Important to Know about India (Ainslie T. Embree); (2) Early Indian History (Richard H. Davis); (3) Modern Indian History (Marc…

  3. A role of SCN9A in human epilepsies, as a cause of febrile seizures and as a potential modifier of Dravet syndrome.

    Science.gov (United States)

    Singh, Nanda A; Pappas, Chris; Dahle, E Jill; Claes, Lieve R F; Pruess, Timothy H; De Jonghe, Peter; Thompson, Joel; Dixon, Missy; Gurnett, Christina; Peiffer, Andy; White, H Steve; Filloux, Francis; Leppert, Mark F

    2009-09-01

    A follow-up study of a large Utah family with significant linkage to chromosome 2q24 led us to identify a new febrile seizure (FS) gene, SCN9A encoding Na(v)1.7. In 21 affected members, we uncovered a potential mutation in a highly conserved amino acid, p.N641Y, in the large cytoplasmic loop between transmembrane domains I and II that was absent from 586 ethnically matched population control chromosomes. To establish a functional role for this mutation in seizure susceptibility, we introduced the orthologous mutation into the murine Scn9a ortholog using targeted homologous recombination. Compared to wild-type mice, homozygous Scn9a(N641Y/N641Y) knockin mice exhibit significantly reduced thresholds to electrically induced clonic and tonic-clonic seizures, and increased corneal kindling acquisition rates. Together, these data strongly support the SCN9A p.N641Y mutation as disease-causing in this family. To confirm the role of SCN9A in FS, we analyzed a collection of 92 unrelated FS patients and identified additional highly conserved Na(v)1.7 missense variants in 5% of the patients. After one of these children with FS later developed Dravet syndrome (severe myoclonic epilepsy of infancy), we sequenced the SCN1A gene, a gene known to be associated with Dravet syndrome, and identified a heterozygous frameshift mutation. Subsequent analysis of 109 Dravet syndrome patients yielded nine Na(v)1.7 missense variants (8% of the patients), all in highly conserved amino acids. Six of these Dravet syndrome patients with SCN9A missense variants also harbored either missense or splice site SCN1A mutations and three had no SCN1A mutations. This study provides evidence for a role of SCN9A in human epilepsies, both as a cause of FS and as a partner with SCN1A mutations.

  4. A role of SCN9A in human epilepsies, as a cause of febrile seizures and as a potential modifier of Dravet syndrome.

    Directory of Open Access Journals (Sweden)

    Nanda A Singh

    2009-09-01

    Full Text Available A follow-up study of a large Utah family with significant linkage to chromosome 2q24 led us to identify a new febrile seizure (FS gene, SCN9A encoding Na(v1.7. In 21 affected members, we uncovered a potential mutation in a highly conserved amino acid, p.N641Y, in the large cytoplasmic loop between transmembrane domains I and II that was absent from 586 ethnically matched population control chromosomes. To establish a functional role for this mutation in seizure susceptibility, we introduced the orthologous mutation into the murine Scn9a ortholog using targeted homologous recombination. Compared to wild-type mice, homozygous Scn9a(N641Y/N641Y knockin mice exhibit significantly reduced thresholds to electrically induced clonic and tonic-clonic seizures, and increased corneal kindling acquisition rates. Together, these data strongly support the SCN9A p.N641Y mutation as disease-causing in this family. To confirm the role of SCN9A in FS, we analyzed a collection of 92 unrelated FS patients and identified additional highly conserved Na(v1.7 missense variants in 5% of the patients. After one of these children with FS later developed Dravet syndrome (severe myoclonic epilepsy of infancy, we sequenced the SCN1A gene, a gene known to be associated with Dravet syndrome, and identified a heterozygous frameshift mutation. Subsequent analysis of 109 Dravet syndrome patients yielded nine Na(v1.7 missense variants (8% of the patients, all in highly conserved amino acids. Six of these Dravet syndrome patients with SCN9A missense variants also harbored either missense or splice site SCN1A mutations and three had no SCN1A mutations. This study provides evidence for a role of SCN9A in human epilepsies, both as a cause of FS and as a partner with SCN1A mutations.

  5. Neuronal RING finger protein 11 (RNF11 regulates canonical NF-κB signaling

    Directory of Open Access Journals (Sweden)

    Pranski Elaine L

    2012-04-01

    Full Text Available Abstract Background The RING domain-containing protein RING finger protein 11 (RNF11 is a member of the A20 ubiquitin-editing protein complex and modulates peripheral NF-κB signaling. RNF11 is robustly expressed in neurons and colocalizes with a population of α-synuclein-positive Lewy bodies and neurites in Parkinson disease patients. The NF-κB pathway has an important role in the vertebrate nervous system, where the absence of NF-κB activity during development can result in learning and memory deficits, whereas chronic NF-κB activation is associated with persistent neuroinflammation. We examined the functional role of RNF11 with respect to canonical NF-κB signaling in neurons to gain understanding of the tight association of inflammatory pathways, including NF-κB, with the pathogenesis of neurodegenerative diseases. Methods and results Luciferase assays were employed to assess NF-κB activity under targeted short hairpin RNA (shRNA knockdown of RNF11 in human neuroblastoma cells and murine primary neurons, which suggested that RNF11 acts as a negative regulator of canonical neuronal NF-κB signaling. These results were further supported by analyses of p65 translocation to the nucleus following depletion of RNF11. Coimmunoprecipitation experiments indicated that RNF11 associates with members of the A20 ubiquitin-editing protein complex in neurons. Site-directed mutagenesis of the myristoylation domain, which is necessary for endosomal targeting of RNF11, altered the impact of RNF11 on NF-κB signaling and abrogated RNF11’s association with the A20 ubiquitin-editing protein complex. A partial effect on canonical NF-κB signaling and an association with the A20 ubiquitin-editing protein complex was observed with mutagenesis of the PPxY motif, a proline-rich region involved in Nedd4-like protein interactions. Last, shRNA-mediated reduction of RNF11 in neurons and neuronal cell lines elevated levels of monocyte chemoattractant protein 1 and

  6. Characterization of a Rab11 homologue, EoRab11a, in Euplotes octocarinatus.

    Science.gov (United States)

    Li, Jiangjiao; Nie, Yu; Dang, Xuhong; Liang, Aihua; Chai, Baofeng; Wang, Wei

    2009-03-01

    Rab GTPases are crucial in the regulation of intracellular vesicular trafficking. A novel Rab GTPase gene, EoRab11a (GenBank accession no. EF061065), was isolated and identified from Euplotes octocarinatus cells in this study. It contains an ORF of 696-bp nucleotides, encoding 231 amino acids with a calculated molecular weight of 26.8 kDa. Alignment of EoRab11a with other Rab11 proteins from other eukaryotes demonstrated that these proteins shared 53-61% identity at the amino acid level. The recombinant EoRab11a was expressed in Escherichia coli and purified by immobilized metal chelate affinity chromatography and iron chromatography. The GTPase activity of EoRab11a was 0.0024 min(-1) detected by HPLC at 30 degrees C. Three mutations were generated at amino acids Ser21 and Gly22 positions in the G1 domain of EoRab11a. All three mutants, S21P, S21G and G22R, increased the GTPase activity in vitro. Immunofluorescence microscopy results indicated that EoRab11a was localized on the phagosomal membrane during phagocytosis of E. octocarinatus. These data show that EoRab11a possesses GTP hydrolysis activity and may participate in vesicle transport events during phagocytosis of E. octocarinatus.

  7. Howland Island Site 11P 1/21/2004 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Howland Island, site 11P (00 47.926N, 176 37.223W), between 11 and 12 meters along a permanent transect.

  8. Chiral dynamics of the S11(1535) and S11(1650) resonances revisited

    CERN Document Server

    Bruns, Peter C; Meißner, U -G

    2010-01-01

    We analyze s-wave pion-nucleon scattering in a unitarized chiral effective Lagrangian including all dimension two contact terms. We find that both the S11(1535) and the S11(1650) are dynamically generated, but the S31(1620) is not. We further discuss the structure of these dynamically generated resonances.

  9. 11 CFR 104.11 - Continuous reporting of debts and obligations.

    Science.gov (United States)

    2010-01-01

    .... 104.11 Section 104.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REPORTS BY POLITICAL... and obligations owed by or to a political committee which remain outstanding shall be continuously... schedules together with a statement explaining the circumstances and conditions under which each debt...

  10. Resurgence of Neisseria meningitidis serogroup W ST-11 (cc11 in Madagascar, 2015–2016

    Directory of Open Access Journals (Sweden)

    Saïda Rasoanandrasana

    2017-02-01

    Full Text Available The resurgence of invasive meningococcal disease caused by Neisseria meningitidis serogroup W with sequence type ST-11 (cc11 was observed in Madagascar in 2015–2016. Three cases were investigated in this study. Molecular characterization of the strains suggests the local transmission of a single genotype that may have been circulating for years.

  11. Facile radiosynthesis of new carbon-11-labeled propanamide derivatives as selective androgen receptor modulator (SARM) radioligands for prostate cancer imaging.

    Science.gov (United States)

    Gao, Mingzhang; Wang, Min; Miller, Kathy D; Zheng, Qi-Huang

    2011-12-11

    The androgen receptor (AR) is an attractive target for the treatment and molecular imaging of prostate cancer. New carbon-11-labeled propanamide derivatives were first designed and synthesized as selective androgen receptor modulator (SARM) radioligands for prostate cancer imaging using the biomedical imaging technique positron emission tomography (PET). The target tracers, (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-2-hydroxy-3-(2-[(11)C]methoxyphenoxy)-2-methylpropanamide ([(11)C]8a), (S)-2-hydroxy-3-(2-[(11)C]methoxyphenoxy)-2-methyl-N-(4-nitro-3-(trifluoromethyl)phenyl)propanamide ([(11)C]8 e), (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-2-hydroxy-3-(4-[(11)C]methoxyphenoxy)-2-methylpropanamide ([(11)C]8c) and (S)-2-hydroxy-3-(4-[(11)C]methoxyphenoxy)-2-methyl-N-(4-nitro-3-(trifluoromethyl)phenyl)propanamide ([(11)C]8 g), were prepared by O-[(11)C]methylation of their corresponding precursors, (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-2-hydroxy-3-(2-hydroxyphenoxy)-2-methylpropanamide (9a), (S)-2-hydroxy-3-(2-hydroxyphenoxy)-2-methyl-N-(4-nitro-3-(trifluoromethyl)phenyl)propanamide (9b), (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-2-hydroxy-3-(4-hydroxyphenoxy)-2-methylpropanamide (9 c) and (S)-2-hydroxy-3-(4-hydroxyphenoxy)-2-methyl-N-(4-nitro-3-(trifluoromethyl)phenyl)propanamide (9 d), with [(11)C]CH(3)OTf under basic conditions and isolated by a simplified C-18 solid-phase extraction (SPE) method in 55 ± 5% (n = 5) radiochemical yields based on [(11)C]CO(2) and decay corrected to end of bombardment (EOB). The overall synthesis time from EOB was 23 min, the radiochemical purity was >99%, and the specific activity at end of synthesis (EOS) was 277.5 ± 92.5 GBq/μmol (n = 5). Copyright © 2011 Elsevier Inc. All rights reserved.

  12. Conductors and Newforms for (1,1)

    Indian Academy of Sciences (India)

    Joshua Lansky; A Raghuram

    2004-11-01

    Let be a non-Archimedean local field whose residue characteristic is odd. In this paper we develop a theory of newforms for (1,1)(), building on previous work on $SL_2(F)$. This theory is analogous to the results of Casselman for $GL_2(F)$ and Jacquet, Piatetski-Shapiro, and Shalika for $GL_n(F)$. To a representation π of (1,1)(), we attach an integer () called the conductor of , which depends only on the -packet containing . A newform is a vector in which is essentially fixed by a congruence subgroup of level ()$. We show that our newforms are always test vectors for some standard Whittaker functionals, and, in doing so, we give various explicit formulae for newforms.

  13. Ethiopian Emperor Attends Apollo 11 Briefing

    Science.gov (United States)

    1969-01-01

    During a Kennedy Space Center (KSC) briefing on the next day's Apollo 11 launch, Emperor Haile Selassie of Ethiopia (with raised hand) asks a question of Rocco A. Petrone, director of launch operations at KSC. To the right of the emperor is astronaut Gordon Cooper and to his left is Dr. Kurt Debus, director of KSC. The first manned lunar launch occurred at 9:32 am on July 16, 1969. The crew included astronauts Neil A. Armstrong, commander; Michael Collins, Command Module (CM) pilot; and Edwin E. Aldrin Jr., Lunar Module (LM) pilot. After 21/2 hours of collecting samples on the lunar surface, the crew safely splashed down into the Pacific Ocean on July 24, 1969. With the success of Apollo 11, the national objective to land men on the Moon and return them safely to Earth had been accomplished.

  14. New Canonical Variables for d=11 Supergravity

    CERN Document Server

    Melosch, S; Melosch, Stephan; Nicolai, Hermann

    1998-01-01

    A set of new canonical variables for $d=11$ supergravity is proposed which renders the supersymmetry variations and the supersymmetry constraint polynomial. The construction is based on the $SO(1,2)\\times SO(16)$ invariant reformulation of $d=11$ supergravity given in previous work, and has some similarities with Ashtekar's reformulation of Einstein's theory. The new bosonic variables fuse the gravitational degrees of freedom with those of the three-index photon $A_{MNP}$ in accordance with the hidden symmetries of the dimensionally reduced theory. Although $E_8$ is not a symmetry of the theory, the bosonic sector exhibits a remarkable $E_8$ structure, hinting at the existence of a novel type of ``exceptional geometry''.

  15. Painter 11 Creativity Digital Artist's Handbook

    CERN Document Server

    Sutton, Jeremy

    2009-01-01

    Jeremy Sutton is one of the world’s premier Painter artists (www.JeremySutton.com and www.PaintboxJ.com), and in this brand new edition of his best-selling Painter Creativity: Digital Artist’s Handbook, he shows you the methods and techniques he’s developed over the years to perfect his art and earn him the title of Corel Painter Master. This edition has been completely revamped to cover all of the new features in Corel Painter 11 and the Wacom Intuos4 pen-tablet, including: .. *The new Hard Media brushes .. *Complete visual summary of all brushes, new and old, in Painter 11 .. *Revised and up

  16. March 11, 2015 CDC Ebola Response Update

    Centers for Disease Control (CDC) Podcasts

    2015-03-11

    CDC’s Eric Dziuban explains key messages CDC developed with UNICEF and the World Health Organization (WHO) on safe school operations in Guinea, Liberia, and Sierra Leone. After being closed for months due to the Ebola outbreak, schools in these countries are reopening – an important step in helping children and their communities return to normal. The key messages offer a tool that each country’s government can use to develop their own approach on safely reopening schools.  Created: 3/11/2015 by Office of the Associate Director for Communication (OADC).   Date Released: 3/11/2015.

  17. [The development of the ICD-11].

    Science.gov (United States)

    2011-01-01

    The ICD-10 will have been used for approximately twenty years by the time the new revision of the ICD (ICD-11) is completed, and the revision process is being implemented. Accordingly, the WHO has organized groups of experts designated to deal with issues in each field, and the International Advisory Group for the Revision of ICD-10 Mental and Behavioral Disorders has been launched for the field of psychiatry. Regarding the revision, this group is responsible for ultimate decision-making in establishing a framework for the new version. We reported processes of the ICD-11 by the above mentioned group and its coordinating groups and working groups. In addition, we reported the WHO-WPA Survey which was distributed to 500 members of the Japanese Society for Psychiatry and Neurology.

  18. La3Si6N11

    Directory of Open Access Journals (Sweden)

    Hisanori Yamane

    2014-06-01

    Full Text Available Colorless transparent single crystals of trilanthanum hexasilicon undecanitrogen, La3Si6N11, were prepared at 0.85 MPa of N2 and 2273 K. The title compound is isotypic with Sm3Si6N11. Silicon-centered nitrogen tetrahedra form a three-dimensional network structure by sharing their corners. Layers of one type of SiN4 tetrahedra and slabs composed of the two different La3+ cations and the other type of SiN4 tetrahedra are alternately stacked along the c axis of the tetragonal unit cell. The site symmetries of the two La3+ cations are are ..m and 4.., respectively.

  19. The Geometry of D=11 Killing Spinors

    CERN Document Server

    Gauntlett, J P; Gauntlett, Jerome P.; Pakis, Stathis

    2003-01-01

    We propose a way to classify all supersymmetric configurations of D=11 supergravity using the G-structures defined by the Killing spinors. We show that the most general bosonic geometries admitting a Killing spinor have at least an SU(5) or an (Spin(7)\\ltimes R^8)x R structure, depending on whether the Killing vector constructed from the Killing spinor is timelike or null, respectively. In the former case we determine what kind of SU(5) structure is present and show that almost all of the form of the geometry is determined by the structure. We also deduce what further conditions must be imposed in order that the equations of motion are satisfied. We illustrate the formalism with some known solutions and also present some new solutions including a rotating generalisation of the resolved membrane solutions and generalisations of the recently constructed D=11 Godel solution.

  20. TH-A-9A-05: Initial Setup Accuracy Comparison Between Frame-Based and Frameless Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Tseng, T; Sheu, R; Todorov, B; Green, S; Blacksburg, S; Lo, Y [Mount Sinai Medical Center, New York, NY (United States)

    2014-06-15

    Purpose: To evaluate initial setup accuracy for stereotactic radiosurgery (SRS) between Brainlab frame-based and frameless immobilization system, also to discern the magnitude frameless system has on setup parameters. Methods: The correction shifts from the original setup were compared for total 157 SRS cranial treatments (69 frame-based vs. 88 frameless). All treatments were performed on a Novalis linac with ExacTrac positioning system. Localization box with isocenter overlay was used for initial setup and correction shift was determined by ExacTrac 6D auto-fusion to achieve submillimeter accuracy for treatment. For frameless treatments, mean time interval between simulation and treatment was 5.7 days (range 0–13). Pearson Chi-Square was used for univariate analysis. Results: The correctional radial shifts (mean±STD, median) for the frame and frameless system measured by ExacTrac were 1.2±1.2mm, 1.1mm and 3.1±3.3mm, 2.0mm, respectively. Treatments with frameless system had a radial shift >2mm more often than those with frames (51.1% vs. 2.9%; p<.0001). To achieve submillimeter accuracy, 85.5% frame-based treatments did not require shift and only 23.9% frameless treatment could succeed with initial setup. There was no statistical significant system offset observed in any direction for either system. For frameless treatments, those treated ≥ 3 days from simulation had statistically higher rates of radial shifts between 1–2mm and >2mm compared to patients treated in a shorter amount of time from simulation (34.3% and 56.7% vs. 28.6% and 33.3%, respectively; p=0.006). Conclusion: Although image-guided positioning system can also achieve submillimeter accuracy for frameless system, users should be cautious regarding the inherent uncertainty of its capability of immobilization. A proper quality assurance procedure for frameless mask manufacturing and a protocol for intra-fraction imaging verification will be crucial for frameless system. Time interval between