8 CFR 217.6 - Carrier agreements.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Carrier agreements. 217.6 Section 217.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217... may notify a carrier of the existence of a basis for termination of a carrier agreement under this...
48 CFR 217.7506 - Spare parts breakout program.
2010-10-01
..., DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout program. 217.7506 Section 217.7506 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...
Energy Technology Data Exchange (ETDEWEB)
Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.
2018-01-01
The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For Tl-217, Pb-217, Pa-217, and U-217 nuclei, only information on the ground state is available. Levels in Bi-217 are known only from isomer decay following fragmentation reaction and those in At-217 and Rn-217 only from the a decay of Fr-221 and Ra-221, respectively. High spin levels in Ra-217 are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme.This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.
2011-02-15
... inspection AD 97-17-04R1, and to allow automatic eddy current inspection per engine manual Section 72-33-31.... That AD currently requires revisions to the engine manufacturer's time limits section (TLS) to include... modifies the TLS of the manufacturer's engine manual and an air carrier's approved continuous airworthiness...
48 CFR 52.217-8 - Option To Extend Services.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option To Extend Services....217-8 Option To Extend Services. As prescribed in 17.208(f), insert a clause substantially the same as the following: Option To Extend Services (NOV 1999) The Government may require continued performance...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide...
Studies of α-spectra in 221Fr, 217At, 213Bi and 213Po decays
International Nuclear Information System (INIS)
Chumin, V.G.; Fominykh, V.I.; Furyaev, T.A.; Gromov, K.Ya.; Jabber, J.K.; Kalyapkin, K.V.; Kudrya, S.A.; Tsupko-Sitnikov, V.V.
1997-01-01
The alpha-recoil phenomenon is used to gain data on the weak components of the α-spectra of the nuclides from the 225 Ac equilibrium chain. It is established that there is no experimental basis for introducing the 450 keV level of 213 Bi in the 217 At decay and the 868 keV level of 209 Tl in the 213 Bi decay. Excitation of the 759 keV level in the 217 At decay is confirmed. The intensities of the 221 Fr, 217 At and 213 Bi β - -decay are measured
2010-04-01
... RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.1 Purpose. The purpose of this part is to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 217.1 Section 217.1 Foreign Relations... the basis of handicap in any program or activity within the United States receiving Federal financial...
7 CFR 1280.217 - Lamb purchases.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Lamb purchases. 1280.217 Section 1280.217 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE LAMB PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Assessments § 1280.217 Lamb purchases. (a...
49 CFR 238.217 - Side structure.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Side structure. 238.217 Section 238.217 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.217 Side structure. Each passenger car shall comply with the following: (a) Side posts and...
5 CFR 532.217 - Appropriated fund survey jobs.
2010-01-01
... Laundry Worker 1 Food Service Worker 2 Cook 8 (e) A lead agency must obtain prior approval of OPM to add a... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Appropriated fund survey jobs. 532.217 Section 532.217 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS...
22 CFR 217.23 - New construction.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...
48 CFR 252.217-7010 - Performance.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...
48 CFR 252.217-7009 - Default.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Default. 252.217-7009... Clauses 252.217-7009 Default. As prescribed in 217.7104(a), use the following clause: Default (DEC 1991... of default to the Contractor, terminate the whole or any part of a job order if the Contractor fails...
45 CFR 150.217 - Preliminary determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Preliminary determination. 150.217 Section 150.217... Are Failing To Substantially Enforce HIPAA Requirements § 150.217 Preliminary determination. If, at... designees). (b) Notifies the State of CMS's preliminary determination that the State has failed to...
22 CFR 217.4 - Discrimination prohibited.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.4 Section 217.4... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.4 Discrimination... participation in, be denied the benefits of, or otherwise be subjected to discrimination under any program or...
27 CFR 24.217 - Vinegar stock.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Vinegar stock. 24.217 Section 24.217 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.217 Vinegar stock. Vinegar...
48 CFR 217.7404-2 - Price ceiling.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...
48 CFR 252.217-7016 - Plant protection.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Plant protection. 252.217... Clauses 252.217-7016 Plant protection. As prescribed in 217.7104(a), use the following clause: Plant Protection (DEC 1991) (a) The Contractor shall provide, for the plant and work in process, reasonable...
2010-10-01
... general railroad system of transportation; or (2) Rapid transit operations in an urban area that are not... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 217.3 Section 217.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...
48 CFR 252.217-7001 - Surge option.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option (AUG 1992) (a) General. The Government has the option to— (1) Increase the quantity of supplies or...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...
48 CFR 217.7104 - Contract clauses.
2010-10-01
... and Health. (14) 252.217-7016, Plant Protection, as applicable. (b)(1) Incorporate in solicitations....217-7016, Plant Protection, in job orders where performance is to occur at the contractor's facility. ...
25 CFR 217.6 - Method of casting votes.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Method of casting votes. 217.6 Section 217.6 Indians.... § 217.6 Method of casting votes. Within 30 days after an issue and any analysis provided for in §§ 217.4... superintendent in writing of the number of votes cast for and against the proposed or alternative solutions. If...
48 CFR 252.217-7002 - Offering property for exchange.
2010-10-01
... exchange. 252.217-7002 Section 252.217-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.217-7002 Offering property for exchange. As prescribed in 217.7005, use the following provision: Offering Property for Exchange (DEC 1991) (a) The property described in item...
48 CFR 217.202 - Use of options.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of options. 217.202... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.202 Use of options. (1) See PGI 217.202 for guidance on the use of options. (2) See 234.005-1 for limitations on the...
22 CFR 217.21 - Discrimination prohibited.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or activity...
14 CFR 145.217 - Contract maintenance.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to an...
22 CFR 217.14 - Preemployment inquiries.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Preemployment inquiries. 217.14 Section 217.14 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... inquiries. (a) Except as provided in paragraphs (b) and (c) of this section, a recipient may not conduct a...
22 CFR 217.11 - Discrimination prohibited.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2) A...
36 CFR 2.17 - Aircraft and air delivery.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2.17 Section 2.17 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are...
33 CFR 136.217 - Compensation allowable.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.217 Compensation... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Compensation allowable. 136.217...
48 CFR 1252.217-72 - Performance.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1252.217-72... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum... to the fuel tank safety requirements of § 238.223 or § 238.423 of this chapter. The Director of the...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
48 CFR 1552.217-70 - Evaluation of contract options.
2010-10-01
... options. 1552.217-70 Section 1552.217-70 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION... 1552.217-70 Evaluation of contract options. As prescribed in 1517.208(a), insert the following solicitation provision in Requests for Proposals when the solicitation contains options. Evaluation of Contract...
48 CFR 52.217-3 - Evaluation Exclusive of Options.
2010-10-01
... Options. 52.217-3 Section 52.217-3 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....217-3 Evaluation Exclusive of Options. As prescribed in 17.208(a), insert a provision substantially the same as the following in solicitations when the solicitation includes an option clause and does...
47 CFR 25.217 - Default service rules.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Default service rules. 25.217 Section 25.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... licenses to operate a satellite system in a frequency band granted after a domestic frequency allocation...
49 CFR 1544.217 - Law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1544.217 Section 1544... AND COMMERCIAL OPERATORS Operations § 1544.217 Law enforcement personnel. (a) The following applies to... for law enforcement personnel meeting the qualifications and standards specified in §§ 1542.215 and...
20 CFR 217.25 - Who may cancel an application.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Who may cancel an application. 217.25 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.25 Who may cancel an application. An application may be cancelled by the claimant or a person described in § 217.17. If the claimant is deceased...
31 CFR 31.217 - Confidentiality of information.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality of information. 31.217 Section 31.217 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET... from a source other than the retained entity. (b) Prohibitions. The retained entity shall not: (1...
48 CFR 1252.217-75 - Lay days.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1252.217-75... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-75 Lay days. As prescribed at (TAR) 48 CFR 1217.7001(c) and (e), insert the following clause: Lay Days (OCT 1994) (a) Lay day...
48 CFR 217.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Exercise of options. 217..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.207 Exercise of options. (c) In addition to the requirements at FAR 17.207(c), exercise an option only after...
20 CFR 725.217 - Determination of dependency; surviving divorced spouse.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving divorced spouse. 725.217 Section 725.217 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.217 Determination of dependency; surviving divorced spouse. An individual who is the miner...
Gray, K A; Dutton, P L; Daldal, F
1994-01-25
Folding models suggest that the highly conserved histidine 217 of the cytochrome b subunit from the cytochrome bc1 complex is close to the quinone reductase (Qi) site. This histidine (bH217) in the cytochrome b polypeptide of the photosynthetic bacterium Rhodobacter capsulatus has been replaced with three other residues, aspartate (D), arginine (R), and leucine (L). bH217D and bH217R are able to grow photoheterotrophically and contain active cytochrome bc1 complexes (60% of wild-type activity), whereas the bH217L mutant is photosynthetically incompetent and contains a cytochrome bc1 complex that has only 10% of the wild-type activity. Single-turnover flash-activated electron transfer experiments show that cytochrome bH is reduced via the Qo site with near native rates in the mutant strains but that electron transfer between cytochrome bH and quinone bound at the Qi site is greatly slowed. These results are consistent with redox midpoint potential (Em) measurements of the cytochrome b subunit hemes and the Qi site quinone. The Em values of cyt bL and bH are approximately the same in the mutants and wild type, although the mutant strains have a larger relative concentration of what may be the high-potential form of cytochrome bH, called cytochrome b150. However, the redox properties of the semiquinone at the Qi site are altered significantly. The Qi site semiquinone stability constant of bH217R is 10 times higher than in the wild type, while in the other two strains (bH217D and bH217L) the stability constant is much lower than in the wild type. Thus H217 appears to have major effects on the redox properties of the quinone bound at the Qi site. These data are incorporated into a suggestion that H217 forms part of the binding pocket of the Qi site in a manner reminiscent of the interaction between quinone bound at the Qb site and H190 of the L subunit of the bacterial photosynthetic reaction center.
20 CFR 217.10 - Application filed after death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter. The...
48 CFR 3052.217-94 - Lay days (USCG).
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Lay days (USCG). 3052.217... CLAUSES Text of Provisions and Clauses 3052.217-94 Lay days (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Lay Days (DEC 2003) (a) Lay day time...
Pollution reduction technology program for class T4(JT8D) engines
Roberts, R.; Fiorentino, A. J.; Diehl, L. A.
1977-01-01
The technology required to develop commercial gas turbine engines with reduced exhaust emissions was demonstrated. Can-annular combustor systems for the JT8D engine family (EPA class T4) were investigated. The JT8D turbofan engine is an axial-flow, dual-spool, moderate-bypass-ratio design. It has a two-stage fan, a four-stage low-pressure compressor driven by a three-stage low-pressure turbine, and a seven-stage high-pressure compressor driven by a single-stage high-pressure turbine. A cross section of the JT8D-17 showing the mechanical configuration is given. Key specifications for this engine are listed.
20 CFR 217.26 - How to cancel an application.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How to cancel an application. 217.26 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.26 How to cancel an application. An application may be cancelled under the following conditions: (a) Before an annuity is awarded. The application...
Investigation of octupole deformations in the Fr217 nucleus by yrast spectroscopy
International Nuclear Information System (INIS)
Hulne, S.
1988-01-01
The spectroscopic characteristics of the yrast levels of Fr217 are determined. The level scheme up to a value of J = (39/2 + ) for angular momentum and parity is established. The production of the Fr217 nucleus in a heavy ion collision reaction was only possible by using a radioactive Pb210 target. The method for preparing the target is described. The Fr217 nucleus belongs to the category of nuclei showing octupole effects. Mass A = 217 seems to be the lower limit of the region where these effects occur [fr
48 CFR 52.217-6 - Option for Increased Quantity.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option for Increased....217-6 Option for Increased Quantity. As prescribed in 17.208(d), insert a clause substantially the same as the following: Option for Increased Quantity (MAR 1989) The Government may increase the...
33 CFR 148.217 - How can a State be designated as an adjacent coastal State?
2010-07-01
... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD... General § 148.217 How can a State be designated as an adjacent coastal State? (a) Adjacent coastal States... as an adjacent coastal State in the notice may request to be designated as one if the environmental...
JT8D and JT9D jet engine performance improvement program. Task 1: Feasibility analysis
Gaffin, W. O.; Webb, D. E.
1979-01-01
JT8D and JT9D component performance improvement concepts which have a high probability of incorporation into production engines were identified and ranked. An evaluation method based on airline payback period was developed for the purpose of identifying the most promising concepts. The method used available test data and analytical models along with conceptual/preliminary designs to predict the performance improvements, weight, installation characteristics, cost for new production and retrofit, maintenance cost, and qualitative characteristics of candidate concepts. These results were used to arrive at the concept payback period, which is the time required for an airline to recover the investment cost of concept implementation.
49 CFR 397.217 - Waiver processing.
2010-10-01
... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...
18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).
2010-04-01
... INTERPRETATIONS Statements of General Policy and Interpretations Under the Federal Power Act § 2.17 Price... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Price discrimination and anticompetitive effect (price squeeze issue). 2.17 Section 2.17 Conservation of Power and Water...
2010-07-01
... and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.217 Hold. The terms hold(s) and holding mean legal or beneficial ownership, whether direct or indirect, whether through fiduciaries, agents, or other means. ...
MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2
International Nuclear Information System (INIS)
Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming
2016-01-01
MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.
MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2
Energy Technology Data Exchange (ETDEWEB)
Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail: lizm_1001@sina.com
2016-02-26
MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.
9 CFR 93.217 - Import permit and declaration for poultry.
2010-01-01
... poultry. 93.217 Section 93.217 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...
2010-01-01
... passengers when traveling free or pursuant to token charges: (1) Directors, officers, employees, and others authorized by the air carrier operating the aircraft; (2) Directors, officers, employees, and others... remuneration. (This definition is for 14 CFR part 217 traffic reporting purposes and may differ from the...
42 CFR 413.217 - Items and services included in the ESRD prospective payment system.
2010-10-01
... payment system. 413.217 Section 413.217 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT....217 Items and services included in the ESRD prospective payment system. The following items and services are included in the ESRD prospective payment system effective January 1, 2011: (a) Renal dialysis...
2010-05-19
..., MAN- JT8D-2-06 and the Engine Manual Chapter/Section 72-33-21, Inspection 00. Definitions (i) For the... the technical contents of PW JT8D Maintenance Advisory Notice MAN-JT8D-2-06, dated November 20, 2006... Advisory Notice, MAN-JT8D-2-06 and the Engine Manual Chapter/Section 72-33-21, Inspection 00. (g) For...
miR-217 regulates ethanol-induced hepatic inflammation by disrupting sirtuin 1-lipin-1 signaling.
Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O; You, Min
2015-05-01
Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and in primary Kupffer cells. In macrophages, ethanol substantially exacerbated LPS-mediated induction of miR-217 and production of proinflammatory cytokines compared with LPS or ethanol alone. Consistently, ethanol administration to mice led to increases in miR-217 abundance and increased production of inflammatory cytokines in isolated primary Kupffer cells exposed to the combination of ethanol and LPS. miR-217 promoted combined ethanol and LPS-mediated inhibition of sirtuin 1 expression and activity in macrophages. Moreover, miR-217-mediated sirtuin 1 inhibition was accompanied by increased activities of two vital inflammatory regulators, NF-κB and the nuclear factor of activated T cells c4. Finally, adenovirus-mediated overexpression of miR-217 led to steatosis and inflammation in mice. These findings suggest that miR-217 is a pivotal regulator involved in ethanol-induced hepatic inflammation. Strategies to inhibit hepatic miR-217 could be a viable approach in attenuating alcoholic hepatitis. Copyright © 2015 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung; Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog; Lee, Yun Mi; Sohn, Eunjin; Kim, Jin Sook
2015-01-01
Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr −/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr −/− ) mice. In three-week-old male Vldlr −/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr −/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC 50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB
48 CFR 1552.217-74 - Option for increased quantity-cost-plus-award-fee contract.
2010-10-01
... quantity-cost-plus-award-fee contract. 1552.217-74 Section 1552.217-74 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.217-74 Option for increased quantity—cost-plus-award-fee contract. As prescribed in 1517.208(e), insert this contract clause in cost-plus-award-fee term contracts when...
48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.
2010-10-01
... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...
Energy Technology Data Exchange (ETDEWEB)
Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)
2015-01-02
Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.
48 CFR 1252.217-80 - Department of Labor Safety and Health Regulations for Ship Repairing.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Department of Labor Safety and Health Regulations for Ship Repairing. 1252.217-80 Section 1252.217-80 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-80...
49 CFR 1542.217 - Law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used... the criminal laws of the State and local jurisdictions in which the airport is located— (1) A crime...
28 CFR 2.17 - Original jurisdiction cases.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Original jurisdiction cases. 2.17 Section... Original jurisdiction cases. (a) Following any hearing conducted pursuant to these rules, the Regional Commissioner may designate that a case should be decided as an original jurisdiction case. If the Regional...
27 CFR 28.217 - Consignment, shipment, and delivery.
2010-04-01
... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.217 Consignment, shipment, and delivery. The consignment, shipment, and delivery of wines...
37 CFR 2.17 - Recognition for representation.
2010-07-01
..., registrant, or party (e.g., a corporate officer or general partner of a partnership). In the case of joint..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized Persons § 2.17 Recognition for representation. (a) Authority to practice in trademark cases. Only an...
22 CFR 217.42 - Admissions and recruitment.
2010-04-01
... activity in question and (ii) alternate tests or criteria that have a less disproportionate, adverse effect... effects of past discrimination pursuant to § 217.6(a) or when a recipient is taking voluntary action to... base prediction equations on first year grades, but shall conduct periodic validity studies against the...
12 CFR 217.101 - Premiums on deposits.
2010-01-01
... from paying interest on a demand deposit. Premiums, whether in the form of merchandise, credit, or cash... AGAINST THE PAYMENT OF INTEREST ON DEMAND DEPOSITS (REGULATION Q) Interpretations § 217.101 Premiums on... that is not, directly or indirectly, related to or dependent on the balance in a demand deposit account...
20 CFR 217.27 - Effect of cancellation.
2010-04-01
... ANNUITY OR LUMP SUM Cancellation of Application § 217.27 Effect of cancellation. When a person cancels an application the effect is the same as though an application was never filed. When an employee cancels his or her application, any application filed by the employee's spouse is also cancelled. However, a request...
48 CFR 217.7505 - Limitations on price increases.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Limitations on price... Acquisition of Replenishment Parts 217.7505 Limitations on price increases. This section provides implementing... award, on a sole source basis, a contract for any centrally managed replenishment part when the price of...
miR-217 Regulates Ethanol-Induced Hepatic Inflammation by Disrupting Sirtuin 1–Lipin-1 Signaling
Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O.; You, Min
2015-01-01
Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and ...
48 CFR 217.172 - Multiyear contracts for supplies.
2010-10-01
... law. For additional policies that apply only to multiyear contracts for weapon systems, see 217.173... requirements of law are met and there are no other statutory restrictions on using a multiyear contract for the... provisions in the contract do not include consideration of recurring manufacturing costs of the contractor...
48 CFR 52.217-5 - Evaluation of Options.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Options. 52....217-5 Evaluation of Options. As prescribed in 17.208(c), insert a provision substantially the same as the following: Evaluation of Options (JUL 1990) Except when it is determined in accordance with FAR 17...
12 CFR 217.1 - Authority, purpose, and scope.
2010-01-01
...(t) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12 CFR 20.4). [Reg... 217.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Reserve Act (12 U.S.C. 371a, 461, 505), section 7 of the International Banking Act of 1978 (12 U.S.C. 3105...
48 CFR 217.7103-3 - Solicitations for job orders.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitations for job... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103-3 Solicitations for job orders. (a) When a...
48 CFR 217.7103 - Master agreements and job orders.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Master agreements and job... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103 Master agreements and job orders. ...
49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?
2010-10-01
... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of this...
International Nuclear Information System (INIS)
Maier, K.H.; Decman, D.J.; Grawe, H.; Kluge, H.
1981-01-01
The g-factor measurements of the ground state and an isomeric level in 217 Ac using the DPAD method with α-decay are described in this work. The results of γ-ray g-factor measurements for the isomer and a tentative decay scheme produced by α-γ and γ-γ coincidence experiments are also presented. An analysis of the α-particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (orig.)
Production and identification of an isomeric state in 217Pa and the new isotope 218Pa
International Nuclear Information System (INIS)
Schmidt, K.H.; Faust, W.; Muenzenberg, G.; Ewald, H.; Guettner, K.; Clerc, H.G.; Lang, W.; Wohlfarth, H.; Pielenz, K.
1977-02-01
Evaporation residues produced in the reaction 40Ar(176 MeV) + 181Ta were separated from the primary beam by the velocity filter SHIP and detected by a ΔE-E counter telescope. The technique of delayed coincidences was applied to individually identify the reaction products implanted into a Si-surface barrier detector by their subsequent alpha decays. The previously unknown nucleus 218Pa was identified by its known daughter decays. 218Pa was found to decay with Esub(α) = (9.614 +- 0.015) MeV, T(1/2) = (140 +- 50) μs and probably also with Esub(α) = (9.535 +- 0.020) MeV, T(1/2) = (150 + 100 - 50) μs. The half-life of the 8.33 MeV alpha decay of 217Pa was determined to be (o.2 +- 0.4) ms. Anew isomer in 217 Pa was found which decays with Esub(α) = (10.16 +- 0.02) MeV and T(1/2) = (1.8 +- 0.5) ms. (orig./BJ) [de
DEFF Research Database (Denmark)
Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia
The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma...
RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR
Energy Technology Data Exchange (ETDEWEB)
Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)
2017-03-15
Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel
CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar
Directory of Open Access Journals (Sweden)
Plínio Itamar de Mello de Souza
2008-01-01
Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.
Zhao, Caibin; Jin, Lingxia; Ge, Hongguang; Guo, Xiaohua; Zhang, Qiang; Wang, Wenliang
2018-02-01
In this work, to develop efficient organic dye sensitisers, a series of novel donor-acceptor-π-acceptor metal-free dyes were designed based on the C217 dye by means of modifying different auxiliary acceptors, and their photovoltaic performances were theoretically investigated with systematic density functional theory calculations coupled with the incoherent charge-hopping model. Results showed that the designed dyes possess lower highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) levels as well as narrower HOMO-LUMO gaps compared to C217, which indicate their higher light-harvesting efficiency. In addition, using the (TiO2)38 cluster and bidentate bridging model, we predicted that the photoelectric conversion efficiency (PCE) for the C217 dye is as high as 9.92% under air mass (AM) 1.5 illumination (100 mW.cm-2), which is in good agreement with its experimental value (9.60%-9.90%). More interestingly, the cell sensitised by the dye 7 designed in this work exhibits a middle-sized open-circuit voltage of 0.737 V, large short-circuit photocurrent density of 21.16 mAˑcm-2 and a fill factor of 0.801, corresponding to a quite high PCE of 12.49%, denoting the dye 7 is a more promising sensitiser candidate than the C217, and is worth further experimental study.
48 CFR 1552.217-72 - Option to extend the term of the contract-cost-plus-award-fee contract.
2010-10-01
... of the contract-cost-plus-award-fee contract. 1552.217-72 Section 1552.217-72 Federal Acquisition...-award-fee contract. As prescribed in 1517.208(c), insert this contract clause in cost-plus-award-fee... Term of the Contract—Cost-Plus-Award-Fee Contract (APR 1984) (a) The Government has the option to...
Microstructure, magnetic properties and magnetic hardening in 2:17 Sm-Co magnets
International Nuclear Information System (INIS)
Tang, W.; Zhang, Y.; Hadjipanayis, G.C.
2002-01-01
A comprehensive and systematic study has been made on Sm(Co,Fe,M,L) z magnets (M=Cu or Ni, and L=Zr or Ti) to completely understand the effects of composition and processing on the microstructure and magnetic properties of magnets. Ti-containing magnets do not have a lamellar phase but exhibit only a cellular microstructure, resulting in a much lower coercivity (below 10 kOe). Ni-containing magnets exhibit a perfect cellular/lamellar microstructure, but without a large domain wall energy gradient at the interface of the 2:17 and 1:5 phases, leading to a low coercivity. Only in the magnets containing both Cu and Zr, a uniform and stable cellular/lamellar microstructure with a high domain wall energy gradient across the 1:5 phase is formed, resulting in high coercivity. These results indicate that the conditions for effective magnetic hardening are: (1) Formation of a cellular/lamellar microstructure, and (2) establishment of a domain wall energy gradient at the cell boundaries. Based on all of these experimental results, the magnetization reversal mechanism of 2:17 Sm-Co magnets can be explained by both the domain wall pinning and nucleation models. The nucleation mechanism holds at any temperature in the Cu-rich magnets, and only above the Curie temperature of the 1:5 phase in the alloys with the lower Cu content. In these cases, the 2:17 cells become magnetically decoupled. (orig.)
Buyong, N; Kok, J; Luchansky, JB
1998-01-01
Cheddar cheese was prepared with Lactococcus lactis subsp, lactis MM217, a starter culture which contains pMC117 coding for pediocin PA-1, About 75 liters of pasteurized milk (containing ca, 3.6% fat) was inoculated with strain MM217 (ca, 10(6) CFU per ml) and a mixture of three Listeria
2010-10-01
... Distinct Population Segment of Atlantic Salmon (Salmo salar). 226.217 Section 226.217 Wildlife and... Distinct Population Segment of Atlantic Salmon (Salmo salar). Critical habitat is designated to include all... the Gulf of Maine Distinct Population Segment of Atlantic Salmon (GOM DPS), except for those...
Maier, K H; Grawe, H; Kluge, H
1981-01-01
The g-factor measurements of the ground state and an isomeric level in /sup 217/Ac using the DPAD method with alpha -decay are described. The results of gamma -ray g-factor measurements for the isomer and a tentative decay scheme produced by alpha - gamma and gamma - gamma coincidence experiments are also presented. An analysis of the alpha - particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (13 refs).
Energy Technology Data Exchange (ETDEWEB)
Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly
2008-04-25
Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.
Kaur, Arshdeep; Kaushal, Pooja; Hemdeep; Gupta, Raj K.
2018-01-01
The decay of various compound nuclei formed via exotic neutron-rich 9Li projectile is studied within the dynamical cluster-decay model (DCM). Following the earlier work of one of us (RKG) and collaborators (M. Kaur et al. (2015) [1]), for an empirically fixed neck-length parameter ΔRemp, the only parameter in the DCM, at a given incident laboratory energy ELab, we are able to fit almost exactly the (total) fusion cross section σfus =∑x=16σxn for 9Li projectile on 208Pb and other targets, with σfus depending strongly on the target mass of the most abundant isotope and its (magic) shell structure. This result shows the predictable nature of the DCM. The neck-length parameter ΔRemp is fixed empirically for the decay of 217At* formed in 9Li + 208Pb reaction at a fixed laboratory energy ELab, and then the total fusion cross section σfus calculated for all other reactions using 9Li as a projectile on different targets. Apparently, this procedure could be used to predict σfus for 9Li-induced reactions where experimental data are not available. Furthermore, optimum choice of "cold" target-projectile combinations, forming "hot" compact configurations, are predicted for the synthesis of compound nucleus 217At* with 8Li + 209Pb as one of the target-projectile combination, or another (t , p) combination 48Ca + 169Tb, with a doubly magic 48Ca, as the best possibility.
5 CFR 531.217 - Special conversion rules for certain non-GS employees.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special conversion rules for certain non... SERVICE REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Setting Pay When Appointment Or Position Changes § 531.217 Special conversion rules for certain non-GS employees. When an...
Directory of Open Access Journals (Sweden)
Bitzer J
2015-05-01
Full Text Available Johannes Bitzer,1 Maria Jesusa Banal-Silao,2 Hans-Joachim Ahrendt,3 Jaime Restrepo,4 Marion Hardtke,5 Ulrike Wissinger-Graefenhahn,6 Dietmar Trummer7 1Department of Obstetrics and Gynecology, University Hospital of Basel, Basel, Switzerland; 2University of the Philippines College of Medicine, Manila, Philippines; 3Praxis für Frauenheilkunde, Klinische Forschung und Weiterbildung (Clinical Research and Further Education, Magdeburg, Germany; 4Centro de Investigación Clínica, Clinica Medellin Poblado, Medellin, Colombia; 5Global Clinical Development Operations, Bayer Pharma AG, Berlin, Germany; 6Global Medical Affairs Women’s Healthcare, Bayer Pharma AG, Berlin, Germany; 7Clinical Statistics Europe, Bayer Pharma AG, Berlin, Germany Objective: To assess whether the combined oral contraceptive (COC ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4-day regimen (ie, 4-day hormone-free interval is more effective than an EE 20 µg/desogestrel (DSG 150 µg COC taken in a 21/7-day regimen (ie, 7-day hormone-free interval in reducing hormone withdrawal-associated symptoms (HWAS.Methods: This double-blind, randomized study (NLM identifier: NCT01076582 was conducted at 34 centers in 12 countries. Otherwise healthy women who experienced ≥2 HWAS of headache, pelvic pain, and/or bloating when using their current COCs in a 21/7-day regimen were recruited. Subjects rated the severity of their HWAS daily on a seven-point Likert scale during a baseline cycle and during four 28-day cycles with EE/drospirenone 24/4 (n=290 or EE/DSG 21/7 (n=304. The primary variable was the mean change from baseline to cycle 4 in the composite HWAS score (sum of scores for all three symptoms during cycle days 22–28.Results: In the EE/drospirenone 24/4 group, the mean (standard deviation composite HWAS score during cycle days 22–28 was reduced from 42.2 (24.8 at baseline to 12.8 (13.4 at cycle 4 (change from baseline: -30.3 [22.9]. In the EE/DSG 21/7 group, the
Wu, Ning; Zhang, Xuezhong; Wang, Wen; Zhang, Hongye
2015-08-01
This study aimed to evaluate the accuracy of the automated oscillometric upper arm blood pressure (BP) monitor Konsung QD217A for home BP monitoring according to the European Society of Hypertension International Protocol revision 2010. Three trained observers validated the performance of these devices by comparing the measurements obtained from these devices with those taken using a standard mercury sphygmomanometer. Systolic blood pressure (SBP) and diastolic blood pressure (DBP) were sequentially measured in 33 participants using a standard mercury sphygmomanometer and the Konsung QD217A device. A total of 99 pairs of comparisons were obtained from 33 participants. The QD217A device achieved the targets in part 1 of the validation study. The number of absolute differences between the device and the observers within a range of 5, 10 and 15 mmHg was 70/99, 92/99 and 96/99, respectively, for SBP and 80/99, 94/99 and 99/99, respectively, for DBP. The device also achieved the targets in part 2 of the validation study. A total of 27 and 31 participants for SBP and DBP, respectively, showed at least two of the three device-observers differences within 5 mmHg (required≥24). The number of participants without device-observer difference within 5 mmHg was one for SBP and one for DBP (required≤3). The Konsung upper arm BP monitor QD217A has passed the International Protocol requirements and it can be recommended for clinical use and self-measurement in adults. Copyright © 2015 Wolters Kluwer Health, Inc. All rights reserved.
Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available y (0) YDL217C TIM22 Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopi...rey gene name TIM22 Prey description Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopic
9 CFR 381.217 - Authority for condemnation or seizure under other provisions of law.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority for condemnation or seizure... Detention; Seizure and Condemnation; Criminal Offenses § 381.217 Authority for condemnation or seizure under other provisions of law. The provisions of this subpart relating to detention, seizure, condemnation and...
Pt.2. Charge and mass analysis at 217MeV bombarding energy
International Nuclear Information System (INIS)
Galin, J.; Gatty, B.; Guerreau, D.; Lefort, M.; Tarrago, X.; Agarwal, S.; Babinet, R.; Cauvin, B.; Girard, J.; Nifenecker, H.
1977-01-01
Atomic numbers and masses have been identified for the fragments (12 40 Ar (217MeV) + 197 Au. Even for such a large mass asymmetry in the entrance channel it is shown how difficult it is, for some part of the cross section, to distinguish between a classical deep inelastic phenomenon and the formation of a true compound nucleus followed by symmetric fission. The two reaction mechanisms are then studied separately in a critical way comparing with existing models
Fluid-mixing studies in a hexagonal 217-pin wire-wrapped rod bundle
International Nuclear Information System (INIS)
Symolon, P.D.; Todreas, N.E.
1981-02-01
Mixing, pressure drop, and flow split experiments were performed on a 217 pin LMFBR fuel bundle with a pitch to diameter ratio of 1.25 and a lead length of 12 inches. It was found that the turbulent flow data could best be characterized by the energy parameter C/sub 1L/=.106, which is 9% higher than the value from the correlation of Chiu et al. Chiu's correlation was developed on a data base of 61 and 91 pins. The spread of existing data about the correlation is +- 25%, but the error band on our data is expected to be less (approx. +- 10% since injection depth effects were not previously considered). This result is consistent with the concept of increased swirl flow in larger bundles
Health and relationships with leisure time activities in Swedish children aged 2-17 years.
Berntsson, Leeni T; Ringsberg, Karin C
2014-09-01
Three cross-sectional time series studies, randomised and stratified for age and gender, were performed on children aged 2-17, studying their health and well-being. The studies were performed in the Nordic countries in 1984, 1996 and 2011. Long-term illness (LTI) and psychosomatic complaints (PSC) increased during the period. Data were collected from mailed questionnaires. Data of 1461 Swedish children from 2011 were used and compared with data from 1984 and 1996. Relationships between the health indicators (the absence of LTI, 13 diagnoses, the absence of PSC, six symptoms, six items of well-being) and 12 activities were analysed. A total of 83.2% of the children were healthy and 16.8% had at least one LTI, boys 19.1% and girls 14.5%. PSC increased from 18.6% in 1996 to 23.1% in 2011. The distribution was higher in girls. Girls were more active than boys during leisure time. 'Reading books', 'visiting friends', 'listening to music' and 'activity in organisations' were related to an absence of PSC, LTI and well-being. 'Surfing/blogging on the Internet' was negatively related to LTI, PSC and well-being. Multiple regression showed that that 'visits or is visited by friends' was related with a low probability for LTI and also with a high probability for well-being. In the logistic regression analyses, the following variables were seen as promoting health most: 'visits or is visited by friends' and 'is active in organizations' for children aged 2-17 years, especially for boys and well-being. The health of Swedish children declined between 1984 and 2011. Positive relationships were found between some activities and health as well as other activities related to ill health. The results suggest an increased focus on the activities that have positive relationships with health in order to promote health among children. © 2013 Nordic College of Caring Science.
International Nuclear Information System (INIS)
Lu, Lu; Luo, Fei; Liu, Yi; Liu, Xinlu; Shi, Le; Lu, Xiaolin; Liu, Qizhan
2015-01-01
Lung cancer is regarded as the leading cause of cancer-related deaths, and cigarette smoking is one of the strongest risk factors for the development of lung cancer. However, the mechanisms for cigarette smoke-induced lung carcinogenesis remain unclear. The present study investigated the effects of an miRNA (miR-217) on levels of an lncRNA (MALAT1) and examined the role of these factors in the epithelial–mesenchymal transition (EMT) induced by cigarette smoke extract (CSE) in human bronchial epithelial (HBE) cells. In these cells, CSE caused decreases of miR-217 levels and increases in lncRNA MALAT1 levels. Over-expression of miR-217 with a mimic attenuated the CSE-induced increase of MALAT1 levels, and reduction of miR-217 levels by an inhibitor enhanced expression of MALAT1. Moreover, the CSE-induced increase of MALAT1 expression was blocked by an miR-217 mimic, indicating that miR-217 negatively regulates MALAT1 expression. Knockdown of MALAT1 reversed CSE-induced increases of EZH2 (enhancer of zeste homolog 2) and H3K27me3 levels. In addition to the alteration from epithelial to spindle-like mesenchymal morphology, chronic exposure of HBE cells to CSE increased the levels of EZH2, H3K27me3, vimentin, and N-cadherin and decreased E-cadherin levels, effects that were reversed by MALAT1 siRNA or EZH2 siRNA. The results indicate that miR-217 regulation of EZH2/H3K27me3 via MALAT1 is involved in CSE-induced EMT and malignant transformation of HBE cells. The posttranscriptional silencing of MALAT1 by miR-217 provides a link, through EZH2, between ncRNAs and the EMT and establishes a mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure decreases miR-217 levels and increases MALAT1 levels. • miR-217 negatively regulates MALAT1 expression. • MALAT1, via EZH2, is involved in the EMT of CSE-transformed HBE cells.
5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program?
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Are part-time Federal employees eligible... the Child Care Subsidy Program Legislation and to Whom Does It Apply? § 792.217 Are part-time Federal employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for...
Echomorphology of cardiomyopathy: review of 217 cases from 1999 to 2010
International Nuclear Information System (INIS)
Ilyas, S.; Ilyas, H.; Fawad, A.; Hameed, A.; Fazli, A.
2013-01-01
Objective: To study echocardiogram features of different types of cardiomyopathy presenting over a 12 year period at a single centre in Peshawar. Methods: The series comprised a retrospective review of 13,788 consecutive echocardiograms carried out at the Muhammadi Hospital International Medical Research Centre, Hayatabad, Peshawar, from January 1999 to December 2010. Patients were split into two: Group I with paediatric and adolescent cases (0-18 years) and Group II with adults (>18 years). In the adult group, women with peripartum cardiomyopathy were subdivided into two groups of 18-30 years and 30 to 44 years. Standard Echo B and M modes and Doppler parameters were recorded to ascertain the diagnoses of common primary and secondary cardiomyopathies. Patients with myocarditis with chambers dilatation and global dysfunction, and cardiopathy associated with major cardiovascular diseases were excluded. SPSS 14 was used for statistical analysis. Results: Cardiomyopathy was diagnosed in 217 (1.57%) cases. There were 144 (66%) cases of dilated cardiomyopathy with a mean age of 13+-14.8 years; 17 (8%) cases of hypertrophic cardiomyopathy with a mean age of 12+-11.5 years; and 7 (3%) cases of restrictive cardiomyopathy with a mean age of 31+-7.8 years. Primary cardiac amyloidosis was confirmed in 9 (4%) cases, and peripartum cardiomyopathy in 25 (11%) females. Rare subtypes were found in 15 (7%) cases. Conclusion: DCM was the most frequently diagnosed subtype of cardiomyopathy followed by HCM in both the adult and paediatric age groups. (author)
Directory of Open Access Journals (Sweden)
Victor Emmanuel Viana Geddes
2018-05-01
Full Text Available Oropouche Virus is the etiological agent of an arbovirus febrile disease that affects thousands of people and is widespread throughout Central and South American countries. Although isolated in 1950's, still there is scarce information regarding the virus biology and its prevalence is likely underestimated. In order to identify and elucidate interactions with host cells factors and increase the understanding about the Oropouche Virus biology, we performed microRNA (miRNA and target genes screening in human hepatocarcinoma cell line HuH-7. Cellular miRNAs are short non-coding RNAs that regulates gene expression post-transcriptionally and play key roles in several steps of viral infections. The large scale RT-qPCR based screening found 13 differentially expressed miRNAs in Oropouche infected cells. Further validation confirmed that miR-217 and miR-576-3p were 5.5 fold up-regulated at early stages of virus infection (6 hours post-infection. Using bioinformatics and pathway enrichment analysis, we predicted the cellular targets genes for miR-217 and miR-576-3p. Differential expression analysis of RNA from 95 selected targets revealed genes involved in innate immunity modulation, viral release and neurological disorder outcomes. Further analysis revealed the gene of decapping protein 2 (DCP2, a previous known restriction factor for bunyaviruses transcription, as a miR-217 candidate target that is progressively down-regulated during Oropouche infection. Our analysis also showed that activators genes involved in innate immune response through IFN-β pathway, as STING (Stimulator of Interferon Genes and TRAF3 (TNF-Receptor Associated Factor 3, were down-regulated as the infection progress. Inhibition of miR-217 or miR-576-3p restricts OROV replication, decreasing viral RNA (up to 8.3 fold and virus titer (3 fold. Finally, we showed that virus escape IFN-β mediated immune response increasing the levels of cellular miR-576-3p resulting in a decreasing of
Aging method for electronic components and systems based on MIL-HDBK 217
International Nuclear Information System (INIS)
Declercq, M.; Simoens, F.
1984-01-01
Accelerated aging tests as requested to comply IEEE Std 323-1974, rise the question of the availability of an adequate aging model. After getting through the usual models, the authors describe an aging methodology based on MIL-HDBK 217. The method, taking into account several stress factors, is shown to yield on acceptable acceleration of time, while reducing the relative importance of temperature. Practical implementation of acceleration testing is discussed, and a summary of the gained experience is made and discussed in the scope of the philosophy of IEEE Std 650. Only natural thermal aging and functional aging, excluding irradiation or thermal shocks, are considered [fr
Murata, Yasuhiko; Hashimoto, Takuma; Urushihara, Yusuke; Shiga, Soichiro; Takeda, Kazuya; Jingu, Keiichi; Hosoi, Yoshio
2018-01-22
Presence of unperfused regions containing cells under hypoxia and nutrient starvation contributes to radioresistance in solid human tumors. It is well known that hypoxia causes cellular radioresistance, but little is known about the effects of nutrient starvation on radiosensitivity. We have reported that nutrient starvation induced decrease of mTORC1 activity and decrease of radiosensitivity in an SV40-transformed human fibroblast cell line, LM217, and that nutrient starvation induced increase of mTORC1 activity and increase of radiosensitivity in human liver cancer cell lines, HepG2 and HuH6 (Murata et al., BBRC 2015). Knockdown of mTOR using small interfering RNA (siRNA) for mTOR suppressed radiosensitivity under nutrient starvation alone in HepG2 cells, which suggests that mTORC1 pathway regulates radiosensitivity under nutrient starvation alone. In the present study, effects of hypoxia and nutrient starvation on radiosensitivity were investigated using the same cell lines. LM217 and HepG2 cells were used to examine the effects of hypoxia and nutrient starvation on cellular radiosensitivity, mTORC1 pathway including AMPK, ATM, and HIF-1α, which are known as regulators of mTORC1 activity, and glycogen storage, which is induced by HIF-1 and HIF-2 under hypoxia and promotes cell survival. Under hypoxia and nutrient starvation, AMPK activity and ATM expression were increased in LM217 cells and decreased in HepG2 cells compared with AMPK activity under nutrient starvation alone or ATM expression under hypoxia alone. Under hypoxia and nutrient starvation, radiosensitivity was decreased in LM217 cells and increased in HepG2 cells compared with radiosensitivity under hypoxia alone. Under hypoxia and nutrient starvation, knockdown of AMPK decreased ATM activity and increased radiation sensitivity in LM217 cells. In both cell lines, mTORC1 activity was decreased under hypoxia and nutrient starvation. Under hypoxia alone, knockdown of mTOR slightly increased ATM
Energy Technology Data Exchange (ETDEWEB)
Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2012-09-01
This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.
Zhang, Chuanzhao; Zhi, Wanqing Iris; Lu, Haiquan; Samanta, Debangshu; Chen, Ivan; Gabrielson, Edward; Semenza, Gregg L
2016-10-04
Exposure of breast cancer cells to hypoxia increases the percentage of breast cancer stem cells (BCSCs), which are required for tumor initiation and metastasis, and this response is dependent on the activity of hypoxia-inducible factors (HIFs). We previously reported that exposure of breast cancer cells to hypoxia induces the ALKBH5-mediated demethylation of N6-methyladenosine (m6A) in NANOG mRNA leading to increased expression of NANOG, which is a pluripotency factor that promotes BCSC specification. Here we report that exposure of breast cancer cells to hypoxia also induces ZNF217-dependent inhibition of m6A methylation of mRNAs encoding NANOG and KLF4, which is another pluripotency factor that mediates BCSC specification. Although hypoxia induced the BCSC phenotype in all breast-cancer cell lines analyzed, it did so through variable induction of pluripotency factors and ALKBH5 or ZNF217. However, in every breast cancer line, the hypoxic induction of pluripotency factor and ALKBH5 or ZNF217 expression was HIF-dependent. Immunohistochemistry revealed that expression of HIF-1α and ALKBH5 was concordant in all human breast cancer biopsies analyzed. ALKBH5 knockdown in MDA-MB-231 breast cancer cells significantly decreased metastasis from breast to lungs in immunodeficient mice. Thus, HIFs stimulate pluripotency factor expression and BCSC specification by negative regulation of RNA methylation.
Snow hazard potential evaluation along G217 highway in Tianshan mountains by using GIS and RS
Tao, Jianwei
2007-11-01
Snow hazard especially avalanche potential along G217 national highway in Tianshan Mountains using remote sensing and GIS is evaluated and compared with actual site records of avalanche in a test area. Most places of the actual avalanche accidents are consistent with the places with the high snow hazard potential. But there are several places of the avalanche were not in the high hazard potential areas. The reason for this difference is discussed.
2010-04-01
... chapter (Employment Tax Regulations). The term self-employed individual as used in this section is defined... within such period. (b) Definition of moving expenses—(1) In general. Section 217(b) defines the term... placement charges which are, in essence, prepayments of interest, or the purchase price of the residence...
International Nuclear Information System (INIS)
Takenaga, H.; Sakasai, A.; Kubo, H.
2001-01-01
Particle pumping characteristics were compared between pumping from the inner side private flux region (IPP) and pumping from both sides of the private flux region (BPP) in the JT-60U W shaped divertor, and between JT-60U IPP and pumping in the DIII-D lower baffled divertor. The pumping flux for BPP is smaller than that for IPP by about a factor of 2 with weak in-out asymmetry of recycling neutral flux and by a factor of 3.5-6.5 with strong in-out asymmetry. The reduction of the pumping flux for BPP is consistent with Monte Carlo simulations, where backflow at the outer pumping slot is observed due to in-out recycling asymmetry. The pumping flux in DIII-D at I p =0.8 MA and B T =1.6 T is comparable to or smaller than that for JT-60U IPP at I p =1.0 MA, B T =3.8 T and I p =1.5 MA, B T =3.5 T in the same density regime. In the DIII-D divertor with pumping from the private flux region, the pumping flux decreases with increasing in-out asymmetry. The pumping flux normalized by the integrated D α emission over the whole plasma exhibits a similar dependence on the distance between the pumping slot and the strike point in JT-60U IPP and the DIII-D lower divertor with pumping through the outer divertor plasma region. (author)
International Nuclear Information System (INIS)
Gajapathy, R.; Velusamy, K.; Selvaraj, P.; Chellapandi, P.; Chetal, S.C.
2009-01-01
Preliminary investigations of sodium flow and temperature distributions in heat generating fuel pin bundles with helical spacer wires have been carried out. Towards this, the 3D conservation equations of mass, momentum and energy have been solved using a commercial computational fluid dynamics (CFD) code. Turbulence has been accounted through the use of high Reynolds number version of standard k-ε model, with uniform mesh density respecting wall function requirements. The geometric details of the bundle and the heat flux in are similar to that of the Indian Prototype Fast Breeder Reactor (PFBR) that is currently under construction. The mixing characteristics of the flow among the peripheral and central zones are compared for 7, 19 and 37 fuel pin bundles and the characteristics are extended to a 217 pin bundle. The friction factors of the pin bundles obtained from the present study is seen to agree well with the values derived from experimental correlations. It is found that the normalized outlet velocities in the peripheral and central zones are nearly equal to 1.1-0.9, respectively which is in good agreement with the published hydraulic experimental measurements of 1.1-0.85 for a 91 pin bundle. The axial velocity is the maximum in the peripheral zone where spacer wires are located and minimum in the zones which are diametrically opposite to the respective zone of maximum velocity. The sodium temperature is higher in the zones where the flow area and mass flow rates are less due to the presence of the spacer wires though the axial velocity is higher there. It is the minimum in the peripheral zones where the circumferential flow is larger. Based on the flow and temperature distributions obtained for 19 and 37 pin bundles, a preliminary extrapolation procedure has been established for estimating the temperatures of peripheral and central zones of 217 pin bundle.
Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants
Directory of Open Access Journals (Sweden)
Mark Walter
2006-08-01
Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.
Microstructural changes during the slow-cooling annealing of nanocrystalline SmCo 2:17 type magnets
International Nuclear Information System (INIS)
Romero, S.A.; Campos, M.F. de; Castro, J.A. de; Moreira, A.J.; Landgraf, F.J.G.
2013-01-01
Highlights: ► Use of the Stoner-Wohlfarth Callen Liu Cullen model in 2:17 type magnets. ► Data suggest exchange coupling between Sm2(CoFe)17 and Sm(CoCu)5 phases. ► It is given structural data for phase Sm0.33Zr0.67TM3, with TM=Co,Fe,Cu. ► The beneficial effect of the slow cooling treatment is explained. - Abstract: The microstructure and magnetic properties of 2:17 type isotropic magnets were investigated. The slow cooling heat treatment (cooling at 1 °C/min from 820 to 400 °C, and isothermal treatment during 24 h) was interrupted after the temperatures of 820, 700, 600 and 500 °C and their hysteresis were measured with fields up to 9 T. The fully heat treated sample presented coercivity (μ 0 H) of 3.32 T, after 24 h at 400 °C. The microstructure was investigated with SEM–FEG (Scanning Electron Microscope with Field Emission Gun) and X-ray Diffraction Rietveld analysis. The application of the Stoner–Wohlfarth–Callen–Liu–Cullen (SW–CLC) model points out exchange coupling between ferromagnetic Sm 2 (CoFe) 17 nanocells and ferromagnetic Sm(CoCu) 5 present at the cell boundary phase. The results are interpreted with the double shell model: first-a cobalt-rich ferromagnetic Sm(CoCu) 5 shell originates exchange coupling and second-a copper-rich paramagnetic Sm(CuCo) 5 shell produces magnetic decoupling. This double shell helps to maximize coercivity and remanence. The anisotropy field of the Sm 2 (CoFe) 17 cell phase was estimated in 7 T with the SW–CLC model.
Prakash, Gaurav; Agarwal, Amar; Kumar, Dhivya Ashok; Jacob, Soosan; Agarwal, Athiya; Maity, Amrita
2011-03-01
To evaluate the visual and refractive outcomes and expected benefits of Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking. This prospective, interventional case series comprised 122 eyes (70 patients). Pre- and postoperative assessment included uncorrected distance visual acuity (UDVA), corrected distance visual acuity (CDVA), refraction, and higher order aberrations. All patients underwent Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking using the Technolas 217z 100-Hz excimer platform (Technolas Perfect Vision GmbH). Follow-up was performed up to 6 months postoperatively. Theoretical benefit analysis was performed to evaluate the algorithm's outcomes compared to others. Preoperative spherocylindrical power was sphere -3.62 ± 1.60 diopters (D) (range: 0 to -6.75 D), cylinder -1.15 ± 1.00 D (range: 0 to -3.50 D), and spherical equivalent -4.19 ± 1.60 D (range: -7.75 to -2.00 D). At 6 months, 91% (111/122) of eyes were within ± 0.50 D of attempted correction. Postoperative UDVA was comparable to preoperative CDVA at 1 month (P=.47) and progressively improved at 6 months (P=.004). Two eyes lost one line of CDVA at 6 months. Theoretical benefit analysis revealed that of 101 eyes with astigmatism, 29 would have had cyclotorsion-induced astigmatism of ≥ 10% if iris recognition and dynamic rotational eye tracking were not used. Furthermore, the mean percentage decrease in maximum depth of ablation by using the Tissue Saving Treatment was 11.8 ± 2.9% over Aspheric, 17.8 ± 6.2% over Personalized, and 18.2 ± 2.8% over Planoscan algorithms. Tissue saving surface ablation with iris recognition and dynamic rotational eye tracking was safe and effective in this series of eyes. Copyright 2011, SLACK Incorporated.
14 CFR 145.209 - Repair station manual contents.
2010-01-01
...; (g) Procedures for maintenance, preventive maintenance, or alterations performed under § 145.205; (h)Procedures for— (1) Maintaining and revising the contract maintenance information required by § 145.217(a)(2...) Maintaining and revising the contract maintenance information required by § 145.217(a)(2)(ii) and notifying...
Pelotti, P; Ciminari, R; Bacci, G; Avella, M; Briccoli, A
1988-01-01
The value of stratigraphy and pulmonary CT in the initial work-up of osteosarcoma of the extremities is assessed with reference to 217 patients encountered in the Bone Tumour Centre of Rizzoli Orthopaedic Institute in May 1983-May 1986. Stratigraphy revealed lung metastases not identified by standard radiography in 4 patients (1.8%), while CT revealed metastases not identified by either standard X-rays or stratigraphy in a further 6 cases (2.7%). It is concluded that the increase in the percentage of cures (about 30%) reported in the last 10 years in osteosarcoma cases given adjuvant chemotherapy cannot be explained by any difference in initial selection due to the use of these techniques that were not adopted in the historical series.
Analysis the findings of chest radiograph and CT scan in 217 acute thoracic trauma
International Nuclear Information System (INIS)
Huang Shaoying
2005-01-01
Objective: To evaluate chest radiograph and CT scan in assessing acute thoracic trauma. Methods: Retrospectively analyzed the findings of chest radiograph and CT scan in 217 cases of acute thoracic trauma and positive rate of each modality was compared. Results: The positive rate of rib and clavicle fracture was higher in chest radiograph than these in CT scan. But the positive rate of chest wall hematoma, mediastinum and subcutaneous emphysema, pneumothorax, hydropneumothorax, damage of lung parenchyma and traumatic pulmonary atelectasis was higher in CT scan than those in chest radiograph. Conclusion: The application of the combined imaging modalities improves assessing of acute thoracic trauma, because the imaging manifestation of the lesion is various. (authors)
Berntsson, Leeni T; Ringsberg, Karin C
2014-11-01
Nordic children's health has declined. Studies show that parents' engagement in children's leisure-time activities might provide beneficial health outcomes for children. The aim of the present study was to examine the association between Swedish parents' activities together with their children, the parents' experiences of time pressure and their children's health. Data of 1461 Swedish children aged 2-17 years old that were collected in the NordChild study of 2011 were used. We analyzed physical health, diseases and disabilities, psychosomatic health and well-being, and the parents' experiences of time pressure; and we calculated the associations between parental activity together with the child and health indicators. Activities that were significantly and positively associated with children's health at ages 2-17 years of age were: playing and playing games; going to the cinema, theatre, and sporting events; reading books; playing musical instruments/singing; sports activities; watching TV/video/DVD. Playing video games or computer games, driving child to activities and going for walks were significantly and positively associated at age groups 7-12 years and 13-17 years. Activities that were negatively associated with health were: surfing/blogging on the Internet, going shopping and doing homework. Parents who were not experiencing time pressures had a higher level of activity together with their children. The parental experience of time pressure was associated with work time, with less homework activity and more symptoms in children. The family and home are important settings for the development of children's health we found eight parental activities together with their children that promoted the children's health parents' working time and their time pressure experiences affected their activities with their children there is a need for an increased focus on parental activities that are positively associated with children's health. © 2014 the Nordic Societies of
Czech Academy of Sciences Publication Activity Database
Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena
2015-01-01
Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015
Recent extensions and use of the statistical model code EMPIRE-II - version: 2.17 Millesimo
International Nuclear Information System (INIS)
Herman, M.
2003-01-01
This lecture notes describe new features of the modular code EMPIRE-2.17 designed to perform comprehensive calculations of nuclear reactions using variety of nuclear reaction models. Compared to the version 2.13, the current release has been extended by including Coupled-Channel mechanism, exciton model, Monte Carlo approach to preequilibrium emission, use of microscopic level densities, widths fluctuation correction, detailed calculation of the recoil spectra, and powerful plotting capabilities provided by the ZVView package. The second part of this lecture concentrates on the use of the code in practical calculations, with emphasis on the aspects relevant to nuclear data evaluation. In particular, adjusting model parameters is discussed in details. (author)
Radial cracks and fracture mechanism of radially oriented ring 2:17 type SmCo magnets
International Nuclear Information System (INIS)
Tian Jianjun; Pan Dean; Zhou Hao; Yin Fuzheng; Tao Siwu; Zhang Shengen; Qu Xuanhui
2009-01-01
Radially oriented ring 2:17 type SmCo magnets have different microstructure in the radial direction (easy magnetization) and axial direction (hard magnetization). The structure of the cross-section in radial direction is close-packed atomic plane, which shows cellular microstructure. The microstructure of the cross-section in axial direction consists of a mixture of rhombic microstructure and parallel lamella phases. So the magnets have obvious anisotropy of thermal expansion in different directions. The difference of the thermal expansion coefficients reaches the maximum value at 830-860 deg. C, which leads to radial cracks during quenching. The magnets have high brittlement because there are fewer slip systems in crystal structure. The fracture is brittle cleavage fracture.
Szenborn, L; Osipova, I V; Czajka, H; Kharit, S M; Jackowska, T; François, N; Habib, M A; Borys, D
2017-09-25
Immunization with pneumococcal vaccines is an important prophylactic strategy for children with asplenia or splenic dysfunction, who are at high risk of bacterial infections (including S. pneumoniae). This study aimed to assess immunogenicity and safety of pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV, GSK) in this at-risk population. This phase III, multi-centre, open-label, controlled study, in which at-risk children with asplenia or splenic dysfunction were enrolled (age strata: 2-4, 5-10 and 11-17years), was conducted in Poland and the Russian Federation. For the 2-4years at-risk group, healthy age-matched children were enrolled as control. Unprimed children (not previously vaccinated with any pneumococcal vaccine) received 2 PHiD-CV doses (≥2months apart) and pneumococcal vaccine-primed children received 1 dose. Immune responses were assessed pre-vaccination and one month post-each dose. Solicited and unsolicited adverse events (AEs) were recorded for 4 and 31days post-vaccination, respectively, and serious AEs (SAEs) throughout the study. Of 52 vaccinated children (18 at-risk primed, 28 at-risk unprimed and 6 control unprimed), 45 (18, 23 and 4, respectively) were included in the according-to-protocol cohort for immunogenicity. Post-vaccination (post-dose 1 in primed and post-dose 2 in unprimed children), for each vaccine pneumococcal serotype and vaccine-related serotype 6A all at-risk children had antibody concentrations ≥0.2µg/mL, and for vaccine-related serotype 19A at least 94.4%. Increases in antibody geometric mean concentrations were observed. For most serotypes, all at-risk children had post-vaccination opsonophagocytic activity (OPA) titers ≥8 and increases in OPA geometric mean titers were observed. No safety concerns were raised. One non-fatal SAE (respiratory tract infection, considered not vaccine-related) was reported by one at-risk unprimed child. PHiD-CV was immunogenic and well tolerated in 2-17
VizieR Online Data Catalog: Catalog of Eq.Widths of Interstellar 217nm Band (Friedemann 1992)
Friedemann, C.
2005-03-01
(from CDS Inf. Bull. 40, 31) The main task of the catalogue consists in a comprehensive collection of equivalent widths of the 217nm band derived from both spectrophotometric and filterphotometric measurements obtained with TD-1, OAO-2 and ANS satellites. These data concern reddened O, B stars with color excesses E(B-V) >= 0.02 mag. The extinction curve is approximated by the empirical formula introduced by Guertler et al. (1982AN....303..105G) e({lambda}) = A(i/{lambda} - 1/{lambda}o)n + B + C {kappa}({lambda}) The relative errors amount to about {delta}A/A = +/- 0.10, {delta}B/B = +/- 0.02 and {delta}C/C = +/- 0.03. (1 data file).
Arce, J. L.; Gardner, J. E.; Macías, J. L.
2013-01-01
The Nevado de Toluca volcano in Central Mexico has been active over the last ca. 42 ka, during which tens of km3 of pyroclastic material were erupted and two important Plinian-type eruptions occurred at ca. 21.7 ka (Lower Toluca Pumice: LTP) and ca. 10.5 ka (Upper Toluca Pumice: UTP). Samples from both the LTP and UTP contain plagioclase, amphibole, iron-titanium oxides, and minor anhedral biotite, set in a vesicular, rhyolitic, glassy matrix. In addition, UTP dacites contain orthopyroxene. Analysis of melt inclusions in plagioclase phenocrysts yields H2O contents of 2-3.5 wt.% for LTP and 1.3-3.6 wt.% for UTP samples. Ilmenite-ulvospinel geothermometry yields an average temperature of ~ 868 °C for the LTP magma (hotter than the UTP magma, ~ 842 °C; Arce et al., 2006), whereas amphibole-plagioclase geothermometry yields a temperature of 825-859 °C for the LTP magma. Water-saturated experiments using LTP dacite suggest that: (i) amphibole is stable above 100 MPa and below 900 °C; (ii) plagioclase crystallizes below 250-100 MPa at temperatures of 850-900 °C; and (iii) pyroxene is stable only below pressures of 200-100 MPa and temperatures of 825-900 °C. Comparison of natural and experimental data suggests that the LTP dacitic magma was stored at 150-200 MPa (5.8-7.7 km below the volcano summit). No differences in pressure found between 21.7 ka and 10.5 ka suggest that these two magmas were stored at similar depths. Orthopyroxene produced in lower temperature LTP experiments is compositionally different to those found in UTP natural samples, suggesting that they originated in two different magma batches. Whole-rock chemistry, petrographic features, and mineral compositions suggest that magma mixing was responsible for the generation of the dacitic Plinian LTP eruption.
On employing H216O, H217O, H218O, and D216O lines as frequency standards in the 15-170 cm-1 window
International Nuclear Information System (INIS)
Furtenbacher, Tibor; Csaszar, Attila G.
2008-01-01
The protocol MARVEL, standing for measured active rotational-vibrational energy levels, is used to study high-accuracy measurements of rotational lines of four isotopologues of water, H 2 16 O, H 2 17 O, H 2 18 O, and D 2 16 O, obtained by spectroscopy in the far-infrared (FIR) region of 15-170 cm -1 by Matsushima et al. [Matsushima F, Odashima H, Iwasaki T, Tsunekawa S, Takagi K. Frequency measurement of pure rotational transitions of H 2 O from 0.5 to 5 THz. J Mol Struct 1995; 352/353, 371-8; Matsushima F, Nagase H, Nakauchi T, Odashima H, Takagi K. Frequency measurement of pure rotational transitions of H 2 17 O and H 2 18 O from 0.5 to 5 THz. J Mol Spectrosc 1999;193: 217-23; Matsushima F, Matsunaga M, Qian GY, Ohtaki Y, Wang RL, Takagi K. Frequency measurement of pure rotational transitions of D 2 O from 0.5 to 5 THz. J Mol Spectrosc 2001;206: 41-6; Matsushima F, Tomatsu N, Nagai T, Moriwaki Y, Takagi K. Frequency measurement of pure rotational transitions in the v 2 =1 state of H 2 O. J Mol Spectrosc 2006;235: 190-5]. MARVEL validates the high accuracy of most of the measured line positions. It results in a considerable number of energy levels with an average internal uncertainty of only 40 kHz (2σ). It also supports serious inaccuracy problems when Watson-type A-reduced Hamiltonians are used for predicting the highly accurate rotational measurements for water. Finally, MARVEL suggests a large number of para-water levels, for example 41 for H 2 16 O, which are candidates for becoming frequency standards in the FIR region of 15-170 cm -1 (the 0.5-5 THz window) when an accuracy of about 0.1 MHz is deemed to be sufficient
Czech Academy of Sciences Publication Activity Database
Doubková, Pavla; Sudová, Radka
2014-01-01
Roč. 24, č. 3 (2014), s. 209-217 ISSN 0940-6360 R&D Projects: GA AV ČR KJB600050812 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal * symbiosis * nickel toxicity * semi-hydroponics Subject RIV: EF - Botanics Impact factor: 3.459, year: 2014
Directory of Open Access Journals (Sweden)
Mahsa Mansourian
2012-03-01
Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.
Jonniaux, J L; Coster, F; Purnelle, B; Goffeau, A
1994-12-01
We report the amino acid sequence of 13 open reading frames (ORF > 299 bp) located on a 21.7 kb DNA segment from the left arm of chromosome XIV of Saccharomyces cerevisiae. Five open reading frames had been entirely or partially sequenced previously: WHI3, GCR2, SPX19, SPX18 and a heat shock gene similar to SSB1. The products of 8 other ORFs are new putative proteins among which N1394 is probably a membrane protein. N1346 contains a leucine zipper pattern and the corresponding ORF presents an HAP (global regulator of respiratory genes) upstream activating sequence in the promoting region. N1386 shares homologies with the DNA structure-specific recognition protein family SSRPs and the corresponding ORF is preceded by an MCB (MluI cell cycle box) upstream activating factor.
[Physician Assisted Suicide - Survey on § 217 StGB in Germany].
Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael
2017-03-01
Background In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results 457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.
Identification and chromosomal localization of ecogenetic components of electrolyte excretion
Czech Academy of Sciences Publication Activity Database
Dumas, P.; Křen, Vladimír; Křenová, D.; Pravenec, Michal; Hamet, P.; Tremblay, J.
2002-01-01
Roč. 20, č. 2 (2002), s. 209-217 ISSN 0263-6352 R&D Projects: GA ČR GV204/98/K015 Institutional research plan: CEZ:AV0Z5011922 Keywords : quantitative trait loci * ecogenetics * hypertension Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2002
Airline fuel saving through JT9D engine refurbishment
Energy Technology Data Exchange (ETDEWEB)
Allison, J.W.; Weisel, D.R.
1981-01-01
Areas are identified in the JT9D engine where the potential exists for either further performance recovery following repair, or for improved performance retention. A number of new procedures and tools which will improve performance recovery are described. Improvements in inspection techniques are discussed. Operational techniques which will improve performance retention and impact degree of refurbishment required are also presented.
The design study of the JT-60SU device. No.8. Nuclear shielding and safety design
Energy Technology Data Exchange (ETDEWEB)
Miya, Naoyuki; Kikuchi, Mitsuru; Ushigusa, Kenkichi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment] [and others
1998-03-01
Results of nuclear shielding design study and safety analysis for the steady-state tokamak device JT-60SU are described. D-T operation (option) for two years is adopted in addition to ten years operation using deuterium. Design work has been done in accordance with general laws for radioisotopes handling in Japan as a guideline of safety evaluation, which is applied to the operation of present JT-60U device. Optimization of the shielding design for the device structure including vacuum vessel has been presented to meet with allowable limits of biological shielding determined in advance. It is shown that JT-60SU can be operated safely in the present JT-60 experimental building. It is planed to use 100g/year of tritium in D-T operation phase. A concept of multiple -barrier system is applied to the facility design to prevent propagation of tritium, in which the torus hall and the tritium removal room provide the tertiary confinement. From the design of atmosphere detritiation system for accidental tritium release, it is shown that tritium concentration level can be reduced to the allowable level after two weeks with reasonable compact size components. Safety assessment related to activation of coolant/air, and atmospheric tritium effluents are discussed. (author)
Construction and testing of JT-60
International Nuclear Information System (INIS)
Kishimoto, H.; Aikawa, H.; Oikawa, A.; Miya, N.; Suzuki, K.; Ozeki, T.; Tokutake, T.; Kunieda, S.; Hiruta, K.; Hosoda, R.
1987-01-01
The JT-60 project is reviewed in terms of design, R and D, construction, commissioning and project management. Design features of JT-60 have been refined and renewed through periodic assessments. Engineering targets have been achieved by R and D efforts. Construction and commissioning have progressed on schedule with intensive project management and control. JT-60 obtained high performance and has entered into the experimental phase after completion of machine construction. (orig.)
Directory of Open Access Journals (Sweden)
Belquiz R. Amaral Nassaralla
2003-01-01
Full Text Available OBJETIVO: Determinar a segurança, eficácia, previsibilidade e estabilidade da técnica "laser in situ keratomileusis" (LASIK, três anos após a cirurgia, para a correção de alta anisometropia em crianças, para as quais os tratamentos convencionais não obtiveram êxito. MÉTODOS: Nove olhos de nove pacientes, três meninos e 6 meninas, com idade média de 11,5 anos (variando de 8 a 15 anos, foram submetidos à técnica LASIK utilizando-se o excimer laser Chiron Technolas 217. O tempo mínimo de seguimento foi de 36 meses. RESULTADOS: Três anos após o LASIK, a acuidade visual sem correção (AVSC melhorou pelo menos 5 linhas em todos os olhos; cinco olhos (55,5% apresentavam AVSC de 20/50 ou melhor. Seis olhos (66,6%, apresentavam acuidade visual com correção (AVCC de 20/50 ou melhor e cinco olhos (55,5% ganharam pelo menos 1 linha na AVCC. Devido a ambliopia, nenhum olho apresentou AVSC de 20/20 ou melhor. A média do equivalente esférico pré-operatório foi reduzida de -7,66 (± 3,75 D para -1,02 (± 1,26 D e a do astigmatismo, de -3,11 (± 2,09 D para -0,75 (± 0,25 D. A maior anisometropia encontrada foi de 1,5 D. CONCLUSÕES: Após três anos de seguimento, a técnica LASIK parece ser opção segura e eficaz na correção de alta anisometropia em crianças entre 8 e 15 anos de idade, para os quais os tratamentos convencionais não obtiveram êxito. A progressão do erro refracional relacionada à idade não impediu o uso da correção visual adequada.PURPOSE: To determine the safety, efficacy, predictability and stability of laser in situ keratomileusis (LASIK, three years after surgery, to correct high myopia or high myopic astigmatism in children with high anisometropia in whom conventional treatments had failed. METHODS: Nine eyes of 9 patients, 3 boys and 6 girls with a mean age of 11.5 years (range, 8 to 15 years underwent LASIK using the Chiron Technolas 217 excimer laser. Minimum follow-up was 36 months. RESULTS: Three
8 CFR 209.1 - Adjustment of status of refugees.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of refugees. 209.1... STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.1 Adjustment of status of refugees. The provisions of this section shall provide the sole and exclusive procedure for adjustment of status by a refugee...
Progress in JT-60 innovative technologies
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-09-01
This review report provides the synthetic archives of innovative technologies in 20-year facility developments for the large tokamak experimental device JT-60, first founded as the major magnetic fusion device in the Second Basic Program for Fusion Research and Development of Japan. Manufacture of JT-60 was started in 1978, and the first plasma was achieved on April 8, 1985. In 1989-1991, the vacuum vessel and poloidal field coils were entirely reconfigured to improve the plasma performance. The major original mission of the JT-60 project, a breakeven condition for a D-T equivalent plasma, was finally attained in 1996. After this, JT-60, as a leading device for magnetic fusion research in the world, continues to challenge many experimental issues, which has been achieved by collaboration of innovative facility developments and experimental improvements. In addition, at this time to start the ITER construction phase in 2005, this review is expected to contribute the construction and operation activities for the next generation tokamak by providing the basic ideas in facility developments. We classified a tremendous number of development items into the selected sections for this review. Since the authors have been in charge of each development activity of their own, the contents are full of essential stories, points, and keywords in spite of its compact handbook size. We believe this review could provide highly sophisticated, informative ideas matured in JT-60 technological developments. (author)
International Nuclear Information System (INIS)
Kitsunezaki, Akio; Seki, Shogo; Yokomizo, Hideaki; Matsuda, Toshiaki; Saito, Ryuta
1978-08-01
The present status of design of JT-4 tokamak is described. The objectives of JT-4 are shown graphically and the main parameters are tabulated. JT-4 is a tokamak of non-circular (ellipse or D-shape) plasma cross section with axisymmetric divertors at top and bottom of the plasma column. The principal purpose of JT-4 is to obtain high plasma beta values, desirably exceeding 5%, by strong secondary plasma heating and by impurities elimination. The experimental results obtained with JT-4 are essential in the design of future tokamaks and tokamak reactors with high efficiency and at reasonable cost. (author)
Sensitivity of European wheat to extreme weather
Czech Academy of Sciences Publication Activity Database
Mäkinen, H.; Kaseva, J.; Trnka, Miroslav; Balek, Jan; Kersebaum, K. C.; Nendel, C.; Gobin, A.; Olesen, J. E.; Bindi, M.; Ferrise, R.; Moriondo, M.; Rodríguez, A.; Ruiz-Ramos, M.; Takáč, J.; Bezák, P.; Ventrella, D.; Ruget, F.; Capellades, G.; Kahiluoto, H.
2018-01-01
Roč. 222, jun (2018), s. 209-217 ISSN 0378-4290 R&D Projects: GA MŠk(CZ) LO1415; GA MZe(CZ) QJ1610072 Institutional support: RVO:86652079 Keywords : Climate change * Cultivar * European wheat * Extreme * Weather * Yield response Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.048, year: 2016
8 CFR 209.2 - Adjustment of status of alien granted asylum.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of alien granted asylum. 209.2 Section 209.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.2 Adjustment of status of alien...
DEFF Research Database (Denmark)
Bergh, C.; Fenstad, Ann M.; Furnes, O.
2014-01-01
. The relative risk of revision for any reason, for aseptic loosening, dislocation, deep infection, and periprosthetic fracture was studied before and after adjustment for covariates using Cox regression models. Results - 416,217 hips with POA (mean age 69 (SD 10), 59% females) and 11,589 with FHN (mean age 65...
International Nuclear Information System (INIS)
Naveen Raj, M.; Velusamy, K.
2016-01-01
Highlights: • We simulate flow and temperature fields in fuel subassembly of fast reactor. • We perform high fidelity computations for 217 pin bundle of 7 axial pitch lengths. • We investigate transverse and axial flows in different types of subchannels. • Correlations are proposed for transverse flow, which form input for subchannel analysis. • Periodic variations of large magnitude are observed in subchannel flow rates. - Abstract: RANS based computational fluid dynamic (CFD) simulation of flow and temperature fields in a fast reactor fuel subassembly has been carried out. The sodium cooled prototype subassembly consists of 217 pins with helical wire spacers. An axial length of seven helical wire pitches has been considered for the study adopting a structured mesh having 36 million points and 84 processors in parallel. The computational model has been validated against in-house and published experimental data for friction factor and Nusselt number. Also, the transverse flow in the central subchannel and swirl flow in the peripheral subchannel are compared against reported experimental data and those computed by subchannel models. The focus of the study is investigation of transverse and axial flows in different types of subchannels. Based on the 3-dimensional CFD study, correlations have been proposed for calculation of transverse flow, which forms an important input for development of subchannel analysis codes. Periodic variations have been observed in the subchannel axial flow rates. For the subchannels located in the central region, the peak to peak variation in the axial flow rate is ∼21% and it is found to be contributed by the changes in the flow area and hydraulic resistance due to frequent passage of helical wires through the subchannel. For the subchannels located in the periphery, this variation is as high as 50%. The transverse flow in the central subchannels follows a cosine profile, for all the faces. However, there is a phase lag of 120
Determination of reaction cross sections with the aid of α decay in the 12C, 14C + 209Bl reactions
International Nuclear Information System (INIS)
Hick, H.
1980-01-01
For the reactions 14 C + 209 Bi and 12 C + 209 Bi excitation functions at energies in the range between 57 MeV and 76 MeV are measured. Radiative capture and particle evaporation cross sections were determined by means of α-spectroscopy, and fission cross sections were determined by the measurement of the γ-radiation after the β-decay of the fission products. For the radiative capture for the reaction 14 C + 209 Bi upper limits for the cross section from 21 nbarn to 178 nbarn in the energy interval 61-74 MeV were determined. The fission cross sections were 80 +- 30 mbarn at 490 +- 200 mbarn at 76 MeV. For the reaction 12 C + 209 Bi three new α-lines were found. They were due to the slope at their excitation functions assigned to the decay of isomeric states of following nuclei: 219 Ac Esub(α) = 9419 +- 4 keV Tsub(1/2) = 830 +- 100/μsec, 218 Ac Esub(α) = 9271 +- 4 keV Tsub(1/2) = 810 +- 70/μsec, 217 Ac Eα = 9730 +- 5 keV Tsub(1/2) = 970 +- 190/μsec. For the reactions respectively 12 C + 209 Bi calculations using the statistical model code Grogi of J. Gilat are performed. The calculated branchings of the evaporation channels were compared with the experiment. (orig./HSI) [de
Czech Academy of Sciences Publication Activity Database
Köhlerová, Eva; Škarda, Josef
2004-01-01
Roč. 51, č. 5 (2004), s. 209-217 ISSN 0931-184X R&D Projects: GA ČR GA524/02/0406; GA AV ČR IBS5045302; GA AV ČR KSK5020115 Institutional research plan: CEZ:AV0Z5045916 Keywords : bioassay * anti-oestrogens * oestrogenicity Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 0.471, year: 2004
Mutacin H-29B is identical to mutacin II (J-T8
Directory of Open Access Journals (Sweden)
Lavoie Marc C
2006-04-01
Full Text Available Abstract Background Streptococcus mutans produces bacteriocins named mutacins. Studies of mutacins have always been hampered by the difficulties in obtaining active liquid preparations of these substances. Some of them were found to be lantibiotics, defined as bacterial ribosomally synthesised lanthionine-containing peptides with antimicrobial activity. The goal of this study was to produce and characterize a new mutacin from S. mutans strain 29B, as it shows a promising activity spectrum against current human pathogens. Results Mutacin H-29B, produced by S. mutans strain 29B, was purified by successive hydrophobic chromatography from a liquid preparation consisting of cheese whey permeate (6% w/v supplemented with yeast extract (2% and CaCO3 (1%. Edman degradation revealed 24 amino acids identical to those of mutacin II (also known as J-T8. The molecular mass of the purified peptide was evaluated at 3246.08 ± 0.1 Da by MALDI-TOF MS. Conclusion A simple procedure for production and purification of mutacins along with its characterization is presented. Our results show that the amino acid sequence of mutacin H-29B is identical to the already known mutacin II (J-T8 over the first 24 residues. S. mutans strains of widely different origins may thus produce very similar bacteriocins.
Czech Academy of Sciences Publication Activity Database
Lahoda, M.; Mesters, J. R.; Stsiapanava, A.; Chaloupková, R.; Kutý, Michal; Damborský, J.; Kutá-Smatanová, Ivana
2014-01-01
Roč. 70, FEB 2014 (2014), s. 209-217 ISSN 0907-4449 Institutional support: RVO:67179843 Keywords : DhaA31 * substrate-free * 3rk4 * complex with TCP * 4fwb * wild-type DhaA * 4hzg Subject RIV: CE - Biochemistry Impact factor: 7.232, year: 2013
Development of magnetic sensors for JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Takechi, M., E-mail: takechi.manabu@jaea.go.jp [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Matsunaga, G.; Sakurai, S.; Sasajima, T.; Yagyu, J.; Hoshi, R.; Kawamata, Y.; Kurihara, K. [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Nishikawa, T.; Ryo, T.; Kagamihara, S. [Okazaki Manufacturing Company, Kobe, Hyogo 651-0087 (Japan); Nakamura, K. [RIAM, Kyushu Univ., Kasuga, Fukuoka 816-8580,Japan (Japan)
2015-10-15
JT-60SA has been designed and is being constructed to demonstrate and develop steady-state high-beta operation. Resistive wall mode (RWM) control, error field correction, and edge-localized mode (ELM) control will be performed using in-vessel coils. For these controls, we have developed a biaxial magnetic sensor to determine 3D magnetic configuration of the plasma. Moreover, for obtaining basic information about JT-60SA plasma, magnetic sensors, in particular, one-turn loops, Rogowski coils, diamagnetic loops, and saddle coils have been developed. Because the length of the vacuum vessel in the poloidal direction of JT-60SA is 16 m and almost twice as long as that of JT-60U, the length of the Rogowski coil and the diamagnetic loop of JT-60SA are also twice as long as those on JT-60U. We have devised new types of sensors and a connector for the mineral-insulated cable because construction and installation of these sensors are much more difficult in JT-60SA. We will report the design and specification of the magnetic sensors for JT-60SA from the physics and engineering aspects.
Několik poznámek k problematice ochrany duševního vlastnictví
Czech Academy of Sciences Publication Activity Database
Krejčí, Jindřich
2011-01-01
Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf
Heat structural problems in JT-60
International Nuclear Information System (INIS)
Takatsu, Hideyuki; Shimizu, Masaomi; Yamamoto, Masahiro; Nakamura, Hiroo; Miyauchi, Yasuyuki.
1980-01-01
The construction of JT-60 is in progress to study the behavior of hydrogen plasma. The D-T reaction does not occur in this device, therefore the considerations for neutron damage, tritium leakage and so on are not necessary. The long-pulse operation will be done, and the suppression of the production and mixing of impurity is considered in the design of the JT-60. The high temperature baking is possible, and the magnetic limiter is set. The vacuum container has the complex structure consists of 8 sector type thick rings and 8 U-shaped bellows, and has egg-shaped cross section. The main radius of the torus is about 3 m. The material of the vacuum container is INCONEL 625. The analyses of various stresses due to such as atmospheric pressure, eddy current and thermal expansion were made. It is also necessary to consider the thermal stress due to the leakage of neutral beam. The thermal input of about 20 MW per one discharge to the first wall is taken into consideration. The material of the first wall is molybdenum. (Kato, T.)
Physical design of JT-60 Super Upgrade
International Nuclear Information System (INIS)
Nagashima, K.; Kikuchi, M.; Kurita, G.; Ozeki, T.; Aoyagi, T.; Ushigusa, K.; Neyatani, Y.; Kubo, T.; Mori, K.; Nakagawa, S.; Kuriyama, M.; Nagami, M.
1997-01-01
The JT-60 Super Upgrade (JT-60SU) is an upgraded tokamak device of JT-60U for developing the steady-state reactor and advanced tokamak operation in the International Thermonuclear Experimental Reactor. The device is planned to utilize the JT-60 facilities fully and to minimize the needed modification. The major radius is 4.8 m and the maximum plasma current is 10 MA. Neutral beam injection with 750 keV beam energy is the primary heating method. The machine is capable of steady-state operation with high density up to 8.8 x 10 19 m -3 at 5 MA plasma current. The high operating density, over the Greenwald et al. limit, is critically important in order to achieve high bootstrap current fraction. Ballooning mode and low n ideal magnetohydrodynamic (MHD) mode including the bootstrap current were analyzed for steady-state operation. The current profile must be optimized to obtain a normalized beta up to 3. The plasma configuration with high triangularity was adopted in order to get good MHD stability and high energy confinement. A compact divertor was designed in order to get the large plasma space. (orig.)
Metastatic breast cancer - age has a significant effect on survival ...
African Journals Online (AJOL)
The data on 217 elderly (aged ≥ 65 years) and 209 middleaged postmenopausal patients with metastatic breast cancer treated in the Department of Medical Oncology, University of Pretoria, from 1976 to 1985 were analysed to determine the effect of age on survival. When considered as a group, the elderly have a more ...
Planococcus salinus sp. nov., a moderately halophilic bacterium isolated from a saline-alkali soil.
Gan, Longzhan; Zhang, Heming; Tian, Jiewei; Li, Xiaoguang; Long, Xiufeng; Zhang, Yuqin; Dai, Yumei; Tian, Yongqiang
2018-02-01
A novel aerobic, Gram-stain-positive, motile, moderately halophilic and coccoid bacterial strain, designated LCB217 T , was isolated from a saline-alkali soil in north-western China and identified using a polyphasic taxonomic approach. Growth occurred with 3-15 % (w/v) NaCl (optimum 3-5 %), at 10-45 °C (optimum 30 °C) and at pH 7.0-9.0 (optimum pH 9.0). Strain LCB217 T contained MK-7 and MK-8 as the predominant menaquinones and anteiso-C15 : 0, iso-C14 : 0 and iso-C16 : 0 as the major fatty acids. The polar lipids from strain LCB217 T consisted of diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, one unidentified phospholipid, one unidentified aminophospholipid and one unidentified lipid. The peptidoglycan type was A4α (l-Lys-d-Glu). Phylogenetic analysis of the 16S rRNA gene sequence showed that strain LCB217 T belonged to the genus Planococcus and was closely related to the type strains Planococcus plakortidis AS/ASP6 (II) T (98.2 % similarity), Planococcus maitriensis S1 T (97.7 %) and Planococcus salinarum ISL-16 T (97.2 %). The G+C content of the genomic DNA was 49.4 mol%. DNA-DNA relatedness values between strain LCB217 T andPlanococcusplakortidis AS/ASP6 (II) T , Planococcusmaitriensis S1 T andPlanococcussalinarum ISL-16 T were 29.5, 38.1 and 39.5 %, respectively. On the basis of the phenotypic, phylogenetic and genomic data, strain LCB217 T represents a novel species of the genus Planococcus, for which the name Planococcus salinus sp. nov. is proposed. The type strain is LCB217 T (=CGMCC 1.15685 T =KCTC 33861 T ).
Prescriptions for category D and X drugs during pregnancy in Taiwan: a population-based study.
Kao, Li-Ting; Chen, Yi-Hua; Lin, Herng-Ching; Chung, Shiu-Dong
2014-10-01
This study aimed to investigate the most prescribed medications and principle diagnoses for category D and X drugs during pregnancy using a population-based dataset in Taiwan. The data for the present study were sourced from the Taiwan Longitudinal Health Insurance Database 2000. We selected 14 125 women who had live singleton births between 1 January 2009 and 31 December 2011. In total, 217 226 prescriptions prescribed to these pregnant women were identified. Of the total 217 226 prescriptions, 1.1% were category D or X drugs; in the first, second, and third trimesters of pregnancy, 1.8%, 0.7%, and 0.5% of prescriptions were category D or X drugs, respectively. Progestins (15.3%) and propylthiouracil (10.7%) were the two most frequently prescribed category D or X drugs during pregnancy. In particular, progestins (20.4%) and estrogens (15.6%) were the most frequently prescribed category D or X drug in the first trimester of pregnancy. Propylthiouracil was the most prescribed category D or X drug in the second (20.3%) and third trimesters (23.1%) of pregnancy, respectively. The most common principal diagnosis during pregnancy was "disorders of menstruation and other abnormal bleeding from the female genital tract" (22% of all principal diagnoses for prescribing category D and X drugs). Our study found that the physicians obviously reduced the use of category D and X drugs for women after becoming aware that they were pregnant. Copyright © 2014 John Wiley & Sons, Ltd.
Simulation of collisional effects on divertor pumping in JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Gleason-González, C., E-mail: cristian.gleason@kit.edu [Karlsruhe Institute of Technology, Hermann-von-Helmholtz-Platz 1, Baden-Württemberg 76344 (Germany); Varoutis, S.; Luo, X. [Karlsruhe Institute of Technology, Hermann-von-Helmholtz-Platz 1, Baden-Württemberg 76344 (Germany); Shimizu, K.; Nakano, T.; Hoshino, K.; Kawashima, H.; Asakura, N. [Japan Atomic Energy Agency, 801-1, Mukoyama, Naka, Ibaraki 311-0193 (Japan); Day, Chr. [Karlsruhe Institute of Technology, Hermann-von-Helmholtz-Platz 1, Baden-Württemberg 76344 (Germany); Sakurai, S. [Japan Atomic Energy Agency, 801-1, Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2016-11-01
Highlights: • The exhausted (sub-divertor) gas flows calculations in tokamaks by means of three approaches: ProVac3D, DIVGAS and NEUT2D. • Exhausted neutral gas flow is modeled for two scenarios of a simplified JT-60SA sub-divertor geometry. • A modelled scenario with a simplified setup is done by using two intrinsic collisionless approaches: ProVac3D and NEUT2D and a third approach: DIVGAS, which has been used without its collision module for a direct comparison with the other two. The solvers are cross-checked in terms of the reproduction of the transmission probability. • A second case study is based on the Scenario # 2 of JT-60SA, where the assessment of collisionality in the sub-divertor was done. The gas flow is simulated by using DIVGAS with and without consideration of collisions. • The results include the transmission probability in JT-60SA sub-divertor, the Knudsen number, which characterizes the collisionality of the flow, velocity profiles, pressure and temperature distributions. - Abstract: In this work, the exhausted neutral gas flow is modeled for two cases of a simplified JT-60SA sub-divertor geometry and compared via three different approaches, namely (i) a collisionless approach based on the ProVac3D code, (ii) the DSMC approach based on the DIVGAS code that can be run with and without consideration of particle collisions, and (iii) the NEUT2D approach which has been extensively used in the past for the JT-60 design. In a first case study, the transmission probability was calculated by the 3 approaches and very good agreement is found between NEUT2D-ProVac3D whereas discrepancies between DIVGAS and NEUT2D are found and further analyzed. In the second case, the assessment of collisions is done by means of DIVGAS. Simulations showed that the flow is found in the transitional regime with Kn numbers between 0.1 and 0.4. The DIVGAS collisionless case yielded lower values of temperature than the collisional one by factors of 0.5–0.8 in
International Nuclear Information System (INIS)
Crutcher, J.W.; Wilson, M.J.
1990-02-01
In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs
Development of integrated SOL/Divertor code and simulation study of the JT-60U/JT-60SA tokamaks
International Nuclear Information System (INIS)
Kawashima, H.; Shimizu, K.; Takizuka, T.
2007-01-01
To predict the particle and heat controllability in the divertor of tokamak reactors such as ITER and to optimize the divertor design, comprehensive simulations by integrated modelling with taking in various physical processes are indispensable. For the design study of ITER divertor, the modelling codes such as B2, UEDGE and EDGE2D have been developed, and their results have contributed to the evolution of the divertor concept. In Japan Atomic Energy Agency (JAEA), SOL/divertor codes have also been developed for the interpretation and the prediction on behaviours of plasmas, neutrals and impurities in the SOL/divertor regions. The code development is originally carried out since physics models can be verified quickly and flexibly under the circumstance of close collaboration with JT-60 team. Figure 1 shows our code system, which consists of the 2 dimensional fluid code SOLDOR, the neutral Monte Carlo (MC) code NEUT2D, and the impurity MC code IMPMC. The particle simulation code PARASOL has also been developed in order to establish the physics modelling used in fluid simulations. Integration of SOLDOR, NEUT2D and IMPMC, called the '' SONIC '' code, is being carried out to simulate self-consistently the SOL/divertor plasmas in present tokamaks and in future devices. Combination of the SOLDOR and NEUT2D was completed, which has the features such as 1) high-resolution oscillation-free scheme in solving fluid equations, 2) neutral transport calculation under the fine meshes, 3) success in reduction of MC noise, 4) optimization on the massive parallel computer, etc. The simulation reproduces the X-point MARFE in the JT-60U experiment. It is found that the chemically sputtered carbon at the dome causes the radiation peaking near the X-point. The performance of divertor pumping in JT-60U is evaluated from the particle balances. We also present the divertor designing of JT-60SA, which is the modification program of JT-60U to establish high beta steady-state operation. To
Fabrication of the vacuum vessel for JT-60 machine upgrade
International Nuclear Information System (INIS)
Uchikawa, T.; Takanabe, K.; Tsujimura, S.; Ue, K.; Oka, K.; Kuri, S.; Ioki, K.; Namiki, K.; Suzuki, Y.; Horliike, H.; Ninomiya, H.; Yamamoto, M.; Neyatani, Y.; Ando, T.; Matsukawa, M.
1992-01-01
The JT-60 tokamak was upgraded to double the plasma current to 6 MA. In the JT-60 machine upgrade (JT-60U), the vacuum vessel and poloidal field (PF) coils were renewed. The new vacuum vessel features a three-dimensionally curved, thin double-skin torus with multi-arc D-shaped cross section. The double-skin structure is strengthened with square pipes placed in between the outer and inner skins. Fabrication and site installation of the vessel was smoothly completed in February, 1991. This paper describes an overview of the JT-60U vacuum vessel construction
Development of fast opening magnetic valve for JT-60 pellet injector
International Nuclear Information System (INIS)
Hiratsuka, Hajime; Kawasaki, Kouzo; Takatsu, Hideyuki; Miyo, Yasuhiko; Yoshioka, Yuji; Ohta, Kazuya; Shimizu, Masatsugu; Onozuka, Masanori; Uchikawa, Takashi; Iwamoto, Syuichi; Hashiri, Noboru
1989-01-01
A pneumatic four-pellet injector (JT-60 pellet injector) has been constructed for JT-60 in May, 1988. A fast opening magnetically driven propellant gas injection valve has been developed for JT-60 pellet injector. This valve can accelerate four cylindrical pellets, two 3.8 mm diameter by 3.8 mm and two 2.7 mm diameter by 2.7 mm, to greater than 1.6 km/s with propellent gas of up to 50 bar. It is now successfully in use in JT-60, contributing to plasma studies. In this paper the outline of a newly developed fast opening magnetic valve and the results of performance tests are presented. (author). 6 figs.; 1 tab
Možnosti mediální výchovy v učebnicích českého jazyka
Czech Academy of Sciences Publication Activity Database
Dufek, Ondřej
2012-01-01
Roč. 62, č. 5 (2012), s. 209-217 ISSN 0009-0786 Institutional support: RVO:68378092 Keywords : media literacy * media education * communication training * Czech language * Framework Educational Programme * cross-sectional subject Subject RIV: AI - Linguistics
48 CFR 217.7801 - Definitions.
2010-10-01
... elements of the Department of Homeland Security concerned with the analysis of intelligence information... order for the acquisition of supplies or services on behalf of DoD. Direct acquisition means the type of interagency contracting through which DoD orders a supply or service from a Governmentwide acquisition...
Advances in cost effective processing of titanium
International Nuclear Information System (INIS)
Nelson, O.E.
1993-01-01
Recently an industry expert pointed out that one of the greatest hindrances to the growth of titanium usage has been the low percentage of material usable in the final product. Due to the extensive processing, forming, and machining operations typically performed on titanium, yield losses are high. This is especially true in aerospace applications where most titanium is used. In engine components, the start to finish ratio, known as the buy to fly ratio, is often as high as 7 to 1. This can be illustrated by looking at the use of titanium in Pratt and Whitney engines. In the JT-8D-217 used on Boeing's 737-200, the titanium buyweight is 5,385 pounds, whereas the finished titanium, flyweight is just 758 pounds. This start to finish ratio is 7.1:1, giving titanium 17.0% of total engine weight. (orig.)
2010-10-01
... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... threshold through a non-DoD agency in any fiscal year only if the head of the non-DoD agency has certified... order exceeds the simplified acquisition threshold. These procedures shall include— (1) Evaluating...
International Nuclear Information System (INIS)
Dracoulis, G.D.; Riess, R.; Stuchbery, A.E.; Bark, R.A.; Gupta, S.L.; Baxter, A.M.; Kruse, M.
1988-01-01
The lifetime of the yrast 15/2 - state in 215 Ra was measured using pulsed beams and γ-ray and electron techniques. Transition multipolarities were established from measured conversion coefficients. The B(E3) of the 15/2 - → 9/2 + transition is found to be considerably larger than previously reported. A candidate for the corresponding transition in 217 Th was also observed. The E3 strength of the 15/2 - → 9/2 + transition in the N=127 isotones is evaluated in the light of these and other recent results. Interpretation in the framework of particle-octupole vibration coupling requires a systematic lowering of the core 3 - vibration as proton pairs are added to 208 Pb
Sarwar, Ambrin; Hassan, Muhammad Nadeem; Imran, Muhammad; Iqbal, Mazhar; Majeed, Saima; Brader, Günter; Sessitsch, Angela; Hafeez, Fauzia Yusuf
2018-04-01
The potential of the Bacillus genus to antagonize phytopathogens is associated with the production of cyclic lipopeptides. Depending upon the type of lipopeptide, they may serve as biocontrol agents that are eco-friendly alternatives to chemical fertilizers. This study evaluates the biocontrol activity of surfactin-producing Bacillus (SPB) strains NH-100 and NH-217 and purified surfactin A from these strains against rice bakanae disease. Biologically active surfactin fractions were purified by HPLC, and surfactin A variants with chain lengths from C12 to C16 were confirmed by LCMS-ESI. In hemolytic assays, a positive correlation between surfactin A production and halo zone formation was observed. The purified surfactin A had strong antifungal activity against Fusarium oxysporum, F. moniliforme, F. solani, Trichoderma atroviride and T. reesei. Maximum fungal growth suppression (84%) was recorded at 2000 ppm against F. moniliforme. Surfactin A retained antifungal activity at different pH levels (5-9) and temperatures (20, 50 and 121 °C). Hydroponic and pot experiments were conducted to determine the biocontrol activity of SPB strains and the purified surfactin A from these strains on Super Basmati rice. Surfactin production in the rice rhizosphere was detected by LCMS-ESI at early growth stages in hydroponics experiments inoculated with SPB strains. However, the maximum yield was observed with a consortium of SPB strains (T4) and purified surfactin A (T5) treatments in the pot experiment. The outcomes of the present study revealed that surfactin A significantly reduced rice bakanae disease by up to 80%. These findings suggest that purified surfactin A could be an effective biocontrol agent against bakanae disease in rice and should be incorporated into strategies for disease management. Copyright © 2018 Elsevier GmbH. All rights reserved.
Adaptation to different climates results in divergent phenotypic ...
Indian Academy of Sciences (India)
The phenotypic plasticity of wing size and wing shape of Zaprionus indianus was ... C) in two natural populations living under different climates, equatorial and ... size and shape in an invasive drosophilid. J. Genet. 87, 209–217]. Introduction.
Czech Academy of Sciences Publication Activity Database
Klimeš, Jan; Vilímek, V.; Omelka, M.
2009-01-01
Roč. 50, č. 1 (2009), s. 193-209 ISSN 0921-030X Institutional research plan: CEZ:AV0Z30460519 Keywords : rock debris avalanches * natural hazards * Huascaran Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.217, year: 2009
Accomplishment of JT-60U disassembly work dealing with radioactive components
International Nuclear Information System (INIS)
Ikeda, Yoshitaka
2015-01-01
The upgrade of the JT-60U to the superconducting tokamak 'JT-60SA' has been carried out to contribute the early realization of fusion energy by addressing key physics issues relevant for ITER and DEMO. Disassembly of the JT-60U tokamak was required so as to newly install the JT-60SA torus at the same position in the torus hall. The JT-60U tokamak was featured by the complicated and welded structure against the strong electromagnetic force, and by the radioactivation due to deuterium-deuterium (D-D) reactions of 1.5x10"2"0 (n) in total. Since this work was the first experience of disassembling a large radioactivated fusion device in Japan, careful preparations of disassembly activities, including treatment of the radioactivated materials and safety work, have been made. About 13,000 components with a total weight of more than 5,400 tonnes were removed from the torus hall and stored safely in storage facilities. All disassembly components were stored with recording the data such as dose rate, weight and kind of material, so as to apply the clearance level regulation in future. It was confirmed that the main radioactive material of the disassembly components was the stainless steel and that its dose rate was almost background level (∼0.1 μSv/h) at ∼10 m far from the vacuum vessel. It seems that the disassembly components with background dose level are in the clearance level. The assembly of JT-60SA tokamak has started in January 2013 after this disassembly of the JT-60U tokamak. (author)
Advanced fusion technologies developed for JT-60 superconducting tokamak
International Nuclear Information System (INIS)
Sakasai, Akira; Ishida, S.; Matsukawa, M.
2003-01-01
The modification of JT-60U is planned as a full superconducting tokamak (JT-60SC). The objectives of the JT-60SC program are to establish scientific and technological bases for the steady-state operation of high performance plasmas and utilization of reduced-activation materials in economically and environmentally attractive DEMO reactor. Advanced fusion technologies relevant to DEMO reactor have been developed in the superconducting magnet technology and plasma facing components for the design of JT-60SC. To achieve a high current density in a superconducting strand, Nb 3 Al strands with a high copper ratio of 4 have been newly developed for the toroidal field coils (TFC) of JT-60SC. The R and D to demonstrate applicability of Nb 3 Al conductor to the TFC by a react-and-wind technique have been carried out using a full-size Nb 3 Al conductor. A full-size NbTi conductor with low AC loss using Ni-coated strands has been successfully developed. A forced cooling divertor component with high heat transfer using screw tubes has been developed for the first time. The heat removal performance of the CFC target was successfully demonstrated on the electron beam irradiation stand. (author)
VizieR Online Data Catalog: HK photometry in an UCHII region near Sh2-217 (Brand+, 2011)
Brand, J.; Massi, F.; Zavagno, A.; Deharveng, L.; Lefloch, B.
2010-11-01
Coordinates and photometric parameters (magnitudes and colours) are presented of the stars located in a molecular condensation on the SW-border of the Galactic HII region Sh2-217. The data were obtained on January 4, 2004 with the 3.58-m Telescopio Nazionale Galileo (TNG; La Palma, Canary Islands, Spain). Near-infrared observations were carried out through H and K' broad-band filters with the camera NICS. The image scale is 0.25arcsec/pixel, yielding a field of view of about 4.2'x4.2'. Observing strategy and exposure times are described in Deharveng et al. (2006A&A...458..191D), the only difference being that the dithering sequence for the H-band images was the same as adopted for K'. The data reduction steps adopted are outlined in Deharveng et al. (2006A&A...458..191D). Aperture photometry was done using the DAOPHOT package in IRAF. We followed the same procedure described in Deharveng et al. (2006A&A...458..191D) to obtain aperture photometry, after which PSF-fitting photometry was performed. Although the seeing was good (<1"), the night was barely photometric, so we calibrated our H, K' photometry with that performed on the same field by Deharveng et al. (2003, Cat. J/A+A/399/1135). We calculated the difference in magnitudes for each coinciding source and plotted it against our derived instrumental H-K'. A colour term was present in K' because of the difference between the K and K' filters. After a best-fit calibration, a residual r.m.s. of about 0.2mag. was present in the difference between our photometry and that of Deharveng et al. (2003, J/A+A/399/1135), probably because of the different seeing and possibly also due to the intrinsic variability of young stars. Our photometry is thus on the same HK standard system as Deharveng et al. (2003, J/A+A/399/1135). Sources with K, H < 11-12 are in the non-linear regime or saturated, but such bright objects are few in number and lie outside the cluster, and are probably foreground stars. The approximate limiting
FIR-laser scattering for JT-60
International Nuclear Information System (INIS)
Itagaki, Tokiyoshi; Matoba, Tohru; Funahashi, Akimasa; Suzuki, Yasuo
1977-09-01
An ion Thomson scattering method with far infrared (FIR) laser has been studied for measuring the ion temperature in large tokamak JT-60 to be completed in 1981. Ion Thomson scattering has the advantage of measuring spatial variation of the ion temperature. The ion Thomson scattering in medium tokamak (PLT) and future large tokamak (JET) requires a FIR laser of several megawatts. Research and development of FIR high power pulse lasers with power up to 0.6 MW have proceeded in ion Thomson scattering for future high-temperature tokamaks. The FIR laser power will reach to the desired several megawatts in a few years, so JAERI plans to measure the ion temperature in JT-60 by ion Thomson scattering. A noise source of the ion Thomson scattering with 496 μm-CH 3 F laser is synchrotron radiation of which the power is similar to NEP of the Schottky-barrier diode. However, the synchrotron radiation power is one order smaller than that when a FIR laser is 385 μm-D 2 O laser. The FIR laser power corresponding to a signal to noise ratio of 1 is about 4 MW for CH 3 F laser, and 0.4 MW for D 2 O laser if NEP of the heterodyne mixer is one order less. A FIR laser scattering system for JT-60 should be realized with improvement of FIR laser power, NEP of heterodyne mixer and reduction of synchrotron radiation. (auth.)
LENUS (Irish Health Repository)
Delanty, Norman
2012-02-01
Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive
Development of JT-60 diagnostics system
International Nuclear Information System (INIS)
Suzuki, Yasuo
1988-01-01
The various kinds of plasma diagnostics have been developed and utilized in the JT-60 experiments. The features of JT-60 diagnostics system and the historical proceeding of the development are described in this paper. Taking account of the design consideration, JT-60 diagnostics system is sorted out into eight groups, which include six diagnostics systems, the data processing system and diagnostics supporting system. The all devices in the JT-60 diagnostics system were instrumented on schedule in the end of the fiscal year of 1985 and have contributed to JT-60 experiments. (author)
A four-pellet pneumatic injection system in the JT-60
International Nuclear Information System (INIS)
Hiratsuka, Hajime; Kawasaki, Kouzo; Miyo, Yasuhiko; Yoshioka, Yuji; Ohta, Kazuya; Shimizu, Masatsugu; Kondo, Ikuo; Onozuka, Masanori; Shimomura, Tomoyoshi; Iwamoto, Syuichi; Hashiri, Noboru
1991-01-01
A four-pellet pneumatic injection system has been developed for plasma fueling of the JT-60. The JT-60 pellet injector is capable of accelerating separately four cylindrical pellets 3.0 mm in diameter x 3.0 mm long for two pellets and 4.0 mm in diameter x 4.0 mm long for the remaining two. The JT-60 pellet injector was installed on the JT-60 tokamak machine at the end of 1988. Obtained pellet velocity was higher than 2300 m/s by propellant gases of up to 100 bar and the pellet fueling efficiency achieved was around 70% for both dimensions of pellets. This paper describes the design, injection operation and performance test results of the JT-60 pellet injector. (orig.)
A four-pellet pneumatic injection system in the JT-60
Energy Technology Data Exchange (ETDEWEB)
Hiratsuka, Hajime; Kawasaki, Kouzo; Miyo, Yasuhiko; Yoshioka, Yuji; Ohta, Kazuya; Shimizu, Masatsugu; Kondo, Ikuo (Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan)); Onozuka, Masanori; Shimomura, Tomoyoshi; Iwamoto, Syuichi; Hashiri, Noboru (Mitsubishi Heavy Industries Ltd., Kobe (Japan))
1991-05-01
A four-pellet pneumatic injection system has been developed for plasma fueling of the JT-60. The JT-60 pellet injector is capable of accelerating separately four cylindrical pellets 3.0 mm in diameter x 3.0 mm long for two pellets and 4.0 mm in diameter x 4.0 mm long for the remaining two. The JT-60 pellet injector was installed on the JT-60 tokamak machine at the end of 1988. Obtained pellet velocity was higher than 2300 m/s by propellant gases of up to 100 bar and the pellet fueling efficiency achieved was around 70% for both dimensions of pellets. This paper describes the design, injection operation and performance test results of the JT-60 pellet injector. (orig.).
Disassembly of JT-60 tokamak device and ancillary facilities for JT-60 tokamak
International Nuclear Information System (INIS)
Okano, Fuminori; Ichige, Hisashi; Miyo, Yasuhiko; Kaminaga, Atsushi; Sasajima, Tadayuki; Nishiyama, Tomokazu; Yagyu, Jun-ichi; Ishige, Youichi; Suzuki, Hiroaki; Komuro, Kenichi; Sakasai, Akira; Ikeda, Yoshitaka
2014-03-01
The disassembly of JT-60 tokamak device and its peripheral equipments, where the total weight was about 5400 tons, started in 2009 and accomplished in October 2012. This disassembly was required process for JT-60SA project, which is the Satellite Tokamak project under Japan-EU international corroboration to modify the JT-60 to the superconducting tokamak. This work was the first experience of disassembling a large radioactive fusion device based on Radiation Hazard Prevention Act in Japan. The cutting was one of the main problems in this disassembly, such as to cut the welded parts together with toroidal field coils, and to cut the vacuum vessel into two. After solving these problems, the disassembly completed without disaster and accident. This report presents the outline of the JT-60 disassembly, especially tokamak device and ancillary facilities for tokamak device. (author)
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.209 Section 209.209 Transportation... TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES Compliance Orders § 209.209 Hearing. (a) When a respondent... and the respondent fail to agree upon an acceptable consent order, the hearing officer designated by...
Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats
Directory of Open Access Journals (Sweden)
Kohzad S
2013-03-01
Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.
Development of the pellet injector for JT-60
International Nuclear Information System (INIS)
Kawasaki, Kouzo; Hiratsuka, Hajimo; Takatsu, Hideyuki; Shimizu, Masatsugu; Onozuka, Masanori; Uchikawa, Takashi; Iwamoto, Syuichi; Hashiri, Nobuo
1989-01-01
The pneumatic 4-shot pellet injector has been installed and operated for JT-60 (JAERI Tokamak-60). The performance tests have proved that the device provides high speed hydrogen pellets just as planned. The maximum pellet velocity obtained in the hydrogen pellet tests is greater than 1.6 km/sec at 50 bar propellant gas. The device is now in use for JT-60 contributing to plasma study. In this paper the outline of features and performance of the device is presented. (author). 4 refs.; 8 figs
Tropical Veterinarian - Vol 20, No 4 (2002)
African Journals Online (AJOL)
Effect of organic contrast Media on the haematology and Serum Electrolytes in Xylazine Sedated Dogs · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RA Ajadi, O Ighalo, B Sarumoh, 209-217. http://dx.doi.org/10.4314/tv.v20i4.4486 ...
2011-12-29
... retained by the DAA. Parcel A includes portions of Parcels 209A (SOUTH OF THE Union Pacific Railroad, 231 (south of the Union Pacific Railroad) and all of Parcels 217, 218, 219, 220, 221, 314 and 315 as per the... AT THE FOUND CAST IRON MONUMENT MARKING THE WEST QUARTER CORNER OF SAID SECTION 18, PER DOCUMENT NO...
8 CFR 217.5 - Electronic System for Travel Authorization.
2010-01-01
...) Required elements. ESTA will collect such information as the Secretary deems necessary to issue a travel... changes his or her name; (3) The alien changes his or her gender; (4) The alien's country of citizenship...
Hacihamdioglu, Duygu Ovunc; Fidanci, Kursat; Kilic, Ayhan; Gok, Faysal; Topaloglu, Rezan
2013-10-01
QT dispersion and JT dispersion are simple noninvasive arrhythmogenic markers that can be used to assess the homogeneity of cardiac repolarization. The aim of this study was to assess QT and JT dispersion and their relation with left ventricular systolic and diastolic functions in children with Bartter syndrome (BS). Nine neonatal patients with BS (median age 9.7 years) and 20 controls (median age 8 years) were investigated at rest. Both study and control subjects underwent electrocardiography (ECG) in which the interval between two R waves and QT intervals, corrected QT, QT dispersion, corrected QT dispersion, JT, corrected JT, JT dispersion and corrected JT dispersion were measured with 12-lead ECG. Two-dimensional, Doppler echocardiographic examinations were performed. Patients and controls did not differ for gender and for serum levels of potassium, magnesium, and calcium (p > 0.05). Both study and control subjects had normal echocardiographic examination and baseline myocardial performance indexes. The QT dispersion and JT dispersion were significantly prolonged in patients with BS compared to those of the controls {37.5 ms [interquartile range (IQR) 32.5-40] vs. 25.5 ms (IQR 20-30), respectively, p = 0.014 and 37.5 ms (IQR 27.5-40) vs. 22.5 ms (IQR 20-30), respectively, p = 0.003}. Elevated QT and JT dispersion during asymptomatic and normokalemic periods may be risk factors for the development of cardiac complications and arrhythmias in children with BS. In these patients the need for systematic cardiac screening and management protocol is extremely important for effective prevention.
Nematodes from the genus Ascaridia parasitizing psittaciform birds: a review and determination key
Czech Academy of Sciences Publication Activity Database
Kajerová, V.; Baruš, Vlastimil; Literák, I.
2004-01-01
Roč. 49, č. 6 (2004), s. 217-223 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * parrots * morphometry Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-6-217.pdf
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Time. 209.12 Section 209.12 Protection... Issued Under Section 11(d) of the Noise Control Act § 209.12 Time. (a) In computing any period of time... period of time begins to run shall not be included, except as otherwise provided. Saturdays, Sundays, and...
Directory of Open Access Journals (Sweden)
Blessing O. Bọlọjẹ
2014-07-01
Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.
JT Bachman Leadership Framework
2017-07-01
DAHLGREN DIVISION NAVAL SURFACE WARFARE CENTER Dahlgren, Virginia 22448-5100 NSWCDD/MP-17/300 JT BACHMAN LEADERSHIP FRAMEWORK...REPORT TYPE Miscellaneous Publication 3. DATES COVERED (From - To) 27 Sept 2016 – 08 June 2017 4. TITLE AND SUBTITLE JT BACHMAN LEADERSHIP FRAMEWORK...distribution is unlimited. 13. SUPPLEMENTARY NOTES 14. ABSTRACT This document describes the leadership framework of a civil servant following
Mock-up test results of monoblock-type CFC divertor armor for JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Higashijima, S. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)], E-mail: higashijima.satoru@jaea.go.jp; Sakurai, S.; Suzuki, S.; Yokoyama, K.; Kashiwa, Y.; Masaki, K.; Shibama, Y.K.; Takechi, M.; Shibanuma, K.; Sakasai, A.; Matsukawa, M.; Kikuchi, M. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2009-06-15
The JT-60 Super Advanced (JT-60SA) tokamak project starts under both the Japanese domestic program and the international program 'Broader Approach'. The maximum heat flux to JT-60SA divertor is estimated to {approx}15 MW/m{sup 2} for 100 s. Japan Atomic Energy Agency (JAEA) has developed a divertor armor facing high heat flux in the engineering R and D for ITER, and it is concluded that monoblock-type CFC divertor armor is promising for JT-60SA. The JT-60SA armor consists of CFC monoblocks, a cooling CuCrZr screw-tube, and a thin oxygen-free high conductivity copper (OFHC-Cu) buffer layer between the CFC monoblock and the screw-tube. CFC/OFHC-Cu and OFHC-Cu/CuCrZr joints are essential for the armor, and these interfaces are brazed. Needed improvements from ITER engineering R and D are good CFC/OFHC-Cu and OFHC-Cu/CuCrZr interfaces and suppression of CFC cracking. For these purposes, metalization inside CFC monoblock is applied, and we confirmed again that the mock-up has heat removal capability in excess of ITER requirement. For optimization of the fabrication method and understanding of the production yield, the mock-ups corresponding to quantity produced in one furnace at the same time is also produced, and the half of the mock-ups could remove 15 MW/m{sup 2} as required. This paper summarizes the recent progress of design and mock-up test results for JT-60SA divertor armor.
Power and particle control in JT-60SA to support and supplement ITER and DEMO
International Nuclear Information System (INIS)
Sakurai, Shinji
2007-01-01
JT-60 is planned to be modified as a fully superconducting coil tokamak (JT-60 Super Advanced, JT-60SA). Divertor targets are water-cooled to handle heat flux up to 15 MW/m 2 . JT-60SA allows exploitation of high beta regime with stabilizing shell covered with ferritic plates and internal resistive wall mode (RWM) stabilizing coils. A remote handling system is equipped to maintain in-vessel components even for high dose rate due to a substantial annual neutron production. Divertor cassettes are introduced to be maintained by a remote handling. In the present design, a monoblock type carbon fibre composite (CFC) divertor target will be used to withstand a heat load of ∼15 MW/m 2 . CFC divertor targets and other bolted armor tiles will be mounted on the divertor cassette. All of the plasma facing components including the first wall armor are water-cooled to handle heat load during 100s or more. Divertor heat load and pumping efficiency for an ITER-like configuration has been evaluated, using 2D plasma fluid (SOLDOR) and neutral Monte-Carlo (NEUT2D) code. The pumping speed of 50 m 3 /s is specified at an albedo for neutrals in front of the in-vessel cryopanel. In the simulation for the divertor with a V -shaped corner' like as that in ITER, the plasma detachment occurs near the outer-strike point within the 'V-shaped corner', as well as near the inner-strike point, which results in low peak heat flux density 5.8 MW/m 2 for the case with additional gas puff of 5x10 21 /s compared to 11.4 MW/m 2 for the case without 'V-shaped corner'. (author)
Overview of engineering design, manufacturing and assembly of JT-60SA machine
Energy Technology Data Exchange (ETDEWEB)
Di Pietro, Enrico, E-mail: enrico.dipietro@jt60sa.org [JT-60SA EU Home Team, Fusion for Energy, Boltzmannstrasse 2, Garching 85748 (Germany); Barabaschi, Pietro [JT-60SA EU Home Team, Fusion for Energy, Boltzmannstrasse 2, Garching 85748 (Germany); Kamada, Yutaka [JT-60SA JA Home Team, Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Ishida, Shinichi [JT-60SA JA Project Team, Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2014-10-15
The JT-60SA experiment is one of the three projects to be undertaken in Japan as part of the Broader Approach Agreement, conducted jointly by Europe and Japan, and complementing the construction of ITER in Europe. The JT-60SA device is a fully superconducting tokamak capable of confining break-even equivalent deuterium plasmas with equilibria covering high plasma shaping with a low aspect ratio at a maximum plasma current of I{sub p} = 5.5 MA. This makes JT-60SA capable to support and complement ITER in all the major areas of fusion plasma development necessary to decide DEMO reactor construction. After a complex start-up phase due to the necessity to carry out a re-baselining effort with the purpose to fit in the original budget while aiming to retain the machine mission, performance, and experimental flexibility, in 2009 detailed design could start. With the majority of time-critical industrial contracts in place, in 2012, it was possible to establish a credible time plan, and now, the project is progressing on schedule towards the first plasma in March 2019. After careful and focused R and D and qualification tests, the procurement of the major components and plant is now well advanced in manufacturing design and/or fabrication. In the meantime the disassembly of the JT-60U machine has been completed and the engineering of the JT-60SA assembly process has been developed. The actual assembly of JT-60SA started in January 2013 with the installation of the cryostat base. The paper gives an overview of the present status of the engineering design, manufacturing and assembly of the JT-60SA machine.
Conceptual design of a new supervisory control system for JT-60SA
International Nuclear Information System (INIS)
Totsuka, Toshiyuki; Sakata, Shinya
2009-05-01
The functions of JT-60 discharge control computer system and the data processing computer system will be integrated into a new JT-60SA supervisory control system to improve the operational efficiency of the JT-60 control computer system. In this report, we first show the necessary requirements for the new JT-60SA supervisory control system that should have high cost performance and maintainability. Next, overall system image of the new JT-60SA supervisory control system is presented and the necessary functions and the issues to be solved in the development are shown. Finally, the necessary manpower for this development and performance of the computer hardware, and the expected reduction of maintenance cost of the computer system are described. (author)
40 CFR 209.22 - Other discovery.
2010-07-01
... PRACTICE GOVERNING PROCEEDINGS UNDER THE NOISE CONTROL ACT OF 1972 Rules of Practice Governing Hearings for Orders Issued Under Section 11(d) of the Noise Control Act § 209.22 Other discovery. (a) Further... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Other discovery. 209.22 Section 209.22...
Pionic 4f-3d X-rays from 208Pb and 209Bi
International Nuclear Information System (INIS)
Olin, A.; Forsman, J.W.; MacDonald, J.A.; Marshall, G.M.; Numao, T.; Poffenberger, P.R.; Van Esbroek, P.; Kunselman, A.R.; Olaniyi, B.H.
1985-01-01
The X-ray energies and widths of the pionic 4f-3d and 5g-4f transitions have been measured in 208 Pb and 209 Bi. The 3d widths obtained are in reasonable agreement with theory, and do not support the anomalously small values previously reported. (orig.)
40 CFR 209.24 - Default order.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Default order. 209.24 Section 209.24... Orders Issued Under Section 11(d) of the Noise Control Act § 209.24 Default order. (a) Default. Respondent may be found to be in default upon failure to comply with a prehearing or hearing ruling of the...
Czech Academy of Sciences Publication Activity Database
Hatalová, Hana; Radostová, Dominika; Pištíková, Adéla; Valeš, Karel; Stuchlík, Aleš
2017-01-01
Roč. 317, Jan 15 (2017), s. 210-217 ISSN 0166-4328 R&D Projects: GA MZd(CZ) NV15-34524A; GA MŠk(CZ) LH14053 Institutional support: RVO:67985823 Keywords : obsessive-compulsive disorder * antipsychotics * antidepressant * animal model * quinpirole * rat Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology Impact factor: 3.002, year: 2016
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK209 (Link to dictyBase) - - - Contig-U16260-1 VHK209P (Link to Original site) VHK2...09F 573 VHK209Z 765 VHK209P 1318 - - Show VHK209 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK209Q.Seq.d/ Representative seq. ID VHK2...09P (Link to Original site) Representative DNA sequence >VHK209 (VHK209Q) /CSM/VH/VHK2-A/VHK2...Sequences producing significant alignments: (bits) Value N ( BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k2
Directory of Open Access Journals (Sweden)
D. A. Fink
2015-02-01
Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.
Retention characteristics of hydrogen isotopes in JT-60U
International Nuclear Information System (INIS)
Masaki, K.; Sugiyama, K.; Hayashi, T.; Ochiai, K.; Gotoh, Y.; Shibahara, T.; Hirohata, Y.; Oya, Y.; Miya, N.; Tanabe, T.
2005-01-01
Erosion/deposition distribution and hydrogen isotope behavior in the JT-60U plasma-facing wall were investigated. Distribution of the tritium, which was produced by D-D nuclear reaction, was not correlated with erosion/deposition distribution. The tritium distribution can be explained by the distribution of high-energy tritium ion-implantation due to ripple loss. Deuterium distribution in the divertor region was different from the tritium distribution and not well correlated with the deposition. The highest D/C was ∼0.05 at the bottom of the outer dome wing, which is much less than that observed in other tokamaks. For the deuterium retention, at least two retention processes (ion-implantation and co-deposition) were found on the dome region. The systematic dust collection gave the small amount of dust (∼7 g: 0.2 mg/s production) in the whole vessel of JT-60U. Deposition was observed at the remote area of the outer divertor region
2011-03-02
... economic order quantity procurement, are merged into 217.170, General, and 217.172, Multiyear contracts for... guided by the following principles when entering into a multiyear contract for services: (1) The portion... authorized by law (10 U.S.C. 2306b and 10 U.S.C. 2306c). A multiyear supply contract may be authorized by an...
22 CFR 217.44 - Academic adjustments.
2010-04-01
..., manual, or speaking skills as will best ensure that the results of the evaluation represents the student... speaking skills (except where such skills are the factors that the test purports to measure). (d) Auxiliary... sensory, manual, or speaking skills. (2) Auxiliary aids may include taped texts, interpreters or other...
Zheng, Hao; Zhu, Zhangming; Ma, Rui
2017-07-01
This paper presents a fully integrated CMOS filterless class D amplifier that can directly hook up lithium battery in mobile application The proposed amplifier embodies a 2-order feedback path architecture instead of direct feedback of output to input of the integrator to decrease the high frequency intermodulation distortion associated with direct feedback and eliminate the integrator input common mode disturbance from the output in ternary modulation. The prototype class D amplifier realized in 0.35 μm digital technology achieves a THD+N of 0.02% when delivering 400 mW to an 8 {{Ω }} load from {V}{DD}=3.6 {{V}}. The PSRR of the prototype class D amplifier is 80 dB at 217 Hz. Furthermore a filterless method that can eliminate the external LC filter is employed which offers great advantages of saving PCB space and lowering system cost. In addition the prototype class D amplifier can operate in large voltage range with V DD range from 2.5 to 4.2 V in mobile application. The total area of the amplifier is 1.7 mm2. Project supported by the National Natural Science Foundation of China (Nos. 61234002, 61322405, 61306044).
Data Processing and Analysis Systems for JT-60U
International Nuclear Information System (INIS)
Matsuda, T.; Totsuka, T.; Tsugita, T.; Oshima, T.; Sakata, S.; Sato, M.; Iwasaki, K.
2002-01-01
The JT-60U data processing system is a large computer complex gradually modernized by utilizing progressive computer and network technology. A main computer using state-of-the-art CMOS technology can handle ∼550 MB of data per discharge. A gigabit ethernet switch with FDDI ports has been introduced to cope with the increase of handling data. Workstation systems with VMEbus serial highway drivers for CAMAC have been developed and used to replace many minicomputer systems. VMEbus-based fast data acquisition systems have also been developed to enlarge and replace a minicomputer system for mass data.The JT-60U data analysis system is composed of a JT-60U database server and a JT-60U analysis server, which are distributed UNIX servers. The experimental database is stored in the 1TB RAID disk of the JT-60U database server and is composed of ZENKEI and diagnostic databases. Various data analysis tools are available on the JT-60U analysis server. For the remote collaboration, technical features of the data analysis system have been applied to the computer system to access JT-60U data via the Internet. Remote participation in JT-60U experiments has been successfully conducted since 1996
Czech Academy of Sciences Publication Activity Database
Civiš, Svatopluk; Civiš, Martin; Rašín, R.; Kamas, Michal; Dryahina, Kseniya; Španěl, Patrik; Juha, Libor; Ferus, Martin
2009-01-01
Roč. 39, 3-4 (2009), s. 217-217 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : planetary atmosphere * lasers * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009
Studies on first wall and plasma wall interaction in JT-60
International Nuclear Information System (INIS)
Nakamura, Hiroo
1988-12-01
This paper describes studies on first wall and plasma wall interaction in JT-60. Main results are as follows; (1) To select JT-60 first wall material, various RandD were done in FY1975 ∼ 1976. Mo was selected as first wall materials of limiters and divertor plates because of its reliability under a high heat flux condition. (2) Development of low-Z material has been done to reduce impurity problem of Mo first wall. As a result, titanium carbide (TiC) was selected as a coating material on the Mo. High heat load testing has been done for TiC coated Mo limiter same as JT-60. This material can survive under the condition of 1 kW/cm 2 x 10 s, expected in JT-60 limiter design. (3) To reduce high heat load on the divertor plate, separatrix swing is proposed. Optimum frequency of the sweeping is evaluated to be 2 Hz in JT-60. For a discharge with heating power of 30 MW and duration time of 10 s, in addition to the separatrix swing, remote radiative cooling in the divertor region is necessary. Moreover, calculations of erosion thickness have been done for stainless steel, Mo, graphite, TiC and silicon caibide under high heat flux during plasma disruption. (4) In divertor experiments in JT-60, divertor functions on particle, heat load and impurity controls have been demonstrated. In elctron density of 6 x 10 19 m -3 , particle fueling rate of 20 MW NB heating (3 Pa m 3 /s) can be exhausted by divertor pumping system. Effectiveness of remote radiative cooling is demonstrated under the condition of 20 MW NB heating power. Also, separatrix swing is demonstrated to reduce heat load on the divertor plate. Total radiation in main plasma is 5 ∼ 10% of total absorbed power. (author) 120 refs
International Nuclear Information System (INIS)
Miya, Naoyuki; Masaki, Kei
1997-01-01
Tritium retention analysis and tritium concentration measurement have been made during the large Tokamak JT-60U deuterium operations. This work has been carried out to evaluate the tritium retention for graphite tiles inside the vacuum vessel and tritium release characteristics in the tritium cleanup operations. JT-60U has carried out D-D experiments since July 1991. In the deuterium operations during the first two years, about 1.7 x 10 19 D-D fusion neutrons were produced by D (d, p) T reactions in plasma, which are expected to produce ∼31 GBq of tritium. The tritium produced is evacuated by a pumping system. A part of tritium is, however, trapped in the graphite tiles. Several sample tiles were removed from the vessel and the retained tritium Distribution in the tiles was measured using a liquid scintillator. The results of poloidal distribution showed that the tritium concentration in the divertor tiles was higher than that in the first wall tiles and it peaked in the tiles between two strike points of divertor magnetic lines. Tritium concentration in the exhaust gas from the vessel have also been measured with an ion chamber during the tritium cleanup operations with hydrogen divertor discharges and He-GDC. Total of recovered tritium during the cleanup operations was ∼ 7% of that generated. The results of these measurements showed that the tritium of 16-23 GBq still remained in the graphite tiles, which corresponded to about 50-70% of the tritium generated in plasma. The vessel is ventilated during the in-vessel maintenance works, then the atmosphere is always kept lower than the legal concentration guide level of 0.7 Bq/cm 3 for radiation work permit requirements. (author)
A biokinetic study of {sup 209}Po in man
Energy Technology Data Exchange (ETDEWEB)
Henricsson, C.F.; Ranebo, Y. [Department of Medical Radiation Physics, Clinical Sciences in Lund, Lund University, Skane University Hospital in Lund (Sweden); Hansson, M. [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Raeaef, C.L., E-mail: Christopher.Raaf@med.lu.se [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Holm, E. [Norwegian Radiation Protection Authority, Osteras (Norway)
2012-10-15
Five adult volunteers participated in a biokinetic study of radioactive polonium. Portions of about 10 Bq of {sup 209}Po were orally administrated to four of the volunteers in a single ingestion. The fifth volunteer ingested a daily amount of 53 mBq of 209Po for 243 d to study the time to achieve equilibrium between intake and excretion for protracted intakes. For the subjects ingesting single intakes of {sup 209}Po complete sampling of urine and feces was subsequently collected the first few days upon the ingestion. The samples were processed with radiochemical extraction and analyzed with alpha spectrometry. In the study, the maximum daily excretion rates in feces were 18-50% of the ingested activity, observed within 3 d after intake. Regarding the urine excretion, the daily excretion peaked, on average, at 0.15-1% of the ingested activity within two days upon intake. These results indicate an average gastro-intestinal uptake fraction of 0.46 {+-} 0.08, which agrees well with earlier biokinetic studies of polonium in man. -- Highlights: Black-Right-Pointing-Pointer Human metabolism of an oral intake of polonium. Black-Right-Pointing-Pointer 4 individuals were administrated about 10 Bq polonium-209. Black-Right-Pointing-Pointer Gastro-intestinal uptake fraction, if orally administrated polonium-209 was investigated. Black-Right-Pointing-Pointer The biological half-time of polonium in human body was studied.
User's manual of JT-60 experimental data analysis system
International Nuclear Information System (INIS)
Hirayama, Takashi; Morishima, Soichi; Yoshioka, Yuji
2010-02-01
In the Japan Atomic Energy Agency Naka Fusion Institute, a lot of experiments have been conducted by using the large tokamak device JT-60 aiming to realize fusion power plant. In order to optimize the JT-60 experiment and to investigate complex characteristics of plasma, JT-60 experimental data analysis system was developed and used for collecting, referring and analyzing the JT-60 experimental data. Main components of the system are a data analysis server and a database server for the analyses and accumulation of the experimental data respectively. Other peripheral devices of the system are magnetic disk units, NAS (Network Attached Storage) device, and a backup tape drive. This is a user's manual of the JT-60 experimental data analysis system. (author)
Assembly work and transport of JT-60SA cryostat base
International Nuclear Information System (INIS)
Okano, Fuminori; Masaki, Kei; Yagyu, Jun-ichi; Shibama, Yusuke; Sakasai, Akira; Miyo, Yasuhiko; Kaminaga, Atsushi; Nishiyama, Tomokazu; Suzuki, Sadaaki; Nakamura, Shigetoshi; Shibanuma, Kiyoshi
2013-11-01
Japan Atomic Energy Agency started to construct a fully superconducting tokamak experiment device, JT-60SA, to support the ITER since January, 2013 at the Fusion Research and Development Directorate in Naka, Japan. The JT-60SA will be constructed with enhancing the previous JT-60 infrastructures, in the JT-60 torus hall, where the ex-JT-60 machine was disassembled. The JT-60SA Cryostat Base, for base of the entire tokamak structure, were assembly as the first step of this construction. The Cryostat Base (CB, 250tons) is consists of 7 main components made of stainless steel, in 12 m diameter and 3 m height. The CB was built in the Spain and transported to the Naka site, via Hitachi port. After pre-assembly work including preliminary measurements and sole plate adjustments of its height/flatness, the JT-60SA CB was carefully set on the sole plate. JT-60SA CB was assembled with high accuracy by using a laser tracker. The CB was adjusted in the height and flatness against the assembly reference position and determined by the absolute coordinates. This report introduces the concrete result of assembly work and transport of JT-60SA CB. (author)
International Nuclear Information System (INIS)
Kuriyama, M.; Akino, N.; Ebisawa, N.; Honda, A.; Itoh, T.; Kawai, M.; Mogaki, K.; Ohga, T.; Oohara, H.; Umeda, N.; Usui, K.; Yamamoto, M.; Yamamoto, T.; Matsuoka, M.
2002-01-01
The positive-ion based neutral beam injection (NBI) system for JT-60, which consists of 14 beamline units and has a beam energy of 70 to 100 keV, started operation in 1986 with hydrogen beams and injected a neutral beam power of 27 MW at 75 keV into the JT-60 plasma. In 1991, the NBI system was modified to be able to handle deuterium beams as part of the JT-60 upgrade modification. After executing some research and developments, deuterium beams of 40 MW at 95 keV were injected in 1996. As a result, NBI has contributed to the achievement of the highest performance plasmas, a DT-equivalent fusion power gain of 1.25 and a fusion triple product of 1.55 x 10 21 keVs/m 3 , in the world on JT-60U
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Civil rights. 59.209 Section 59.209 Public Health... Grants for Family Planning Service Training § 59.209 Civil rights. Attention is called to the requirements of Title VI of the Civil Rights Act of 1964 (78 Stat. 252, 42 U.S.C. 2000d et seq.) and in...
The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9
DEFF Research Database (Denmark)
Makovicky, Emil; Petricek, Vaclav; Dusek, Michal
2011-01-01
and forms a homologous pair with cylindrite, which has thinner Q slabs. The Q slabs in franckeite are four atomic layers thick. The two components have their own lattices and a common modulation. The Q slab of the refined franckeite structure, Pb21.74Sn9.34Fe3.95Sb8.08S56.87, is an MS layer (M = Pb2+, Sn2...... layer (M = Sn4+, Fe2+) with a = 3.665(8), b = 6.2575(16), c = 17.419(5) Å, a = 95.25(2)°, ß = 95.45(2)°, ¿ = 89.97(2)°; the modulation vector is q = –0.00087(8) a* + 0.13725(16) b* – 0.0314(4) c*. The a and b vectors of both subsystems are parallel; the c vectors diverge. (3+2)D superspace refinement...... was refined as Pb0.74(Sn,Sb)0.26, whereas that of cations, which are adjacent to the interspace with lone electron pairs, with a configuration analogous to that observed in orthorhombic SnS, corresponds to (Sn,Sb)0.73Pb0.27. Iron is dispersed over the octahedral Sn4+ sites in the H layer. Transversal...
Engineering study of the neutral beam and rf heating systems for DIII-D, MFTF-B, JET, JT-60 and TFTR
International Nuclear Information System (INIS)
Lindquist, W.B.; Staten, S.H.
1987-01-01
An engineering study was performed on the rf and neutral beam heating systems implemented for DIII-D, MFTF-B, JET, JT-60 and TFTR. Areas covered include: methodology used to implement the systems, technology, cost, schedule, performance, problems encountered and lessons learned. Systems are compared and contrasted in the areas studied. Summary statements were made on common problems and lessons learned. 3 refs., 6 tabs
The design study of the JT-60SU device. No. 3. The superconductor-coils of JT-60SU
International Nuclear Information System (INIS)
Ushigusa, Kenkichi; Mori, Katsuharu; Nakagawa, Syouji
1997-03-01
The superconducting coil systems and the cryogenic system for the JT-60 Super Upgrade (JT-60SU) has been designed. Both Nb 3 Al and NbTi as a superconducting wire material are employed in the toroidal coils (D-shaped 18 coils) to realize a high field magnet with a low cost. Significant reduction of the coil weight (150 tons/coil) without losing the coil rigidity has been achieved by connecting two toroidal coils with shear panels. Validity of this design is confirmed by the detailed structural analysis and thermohydraulic analysis. The poloidal coil system consists of 4 central solenoid coils with (NbTi) 3 Sn and 6 outer equilibrium field coils with NbTi. This system has an enough capability to supply the flux of 170Vs to produce a 10MA discharge with 200s of flat-top and to make various plasma configurations. The construction procedure of the poloidal coil system is also established under the constraint of the JT-60 site. Two sets of race-track shaped superconducting coils mounted on the top of the machine is designed to compensate the error field inside the vessel by supplying helical (m=2/n=1) magnetic field. By using cryogenic system with a 36kW of cooling capacity, the total cold weight of around 4000tons can be cooled down to 4.5K within one month, and steady heat load of 6.5kW and transient heat load of 9.0MJ can be removed within 30 minutes of discharge repetition rate. (author)
Search for Excited Leptons at LEP
Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; van Dalen, J.A.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hakobyan, R.S.; Hansen, J.M.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Hu, Y.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, Jasper; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Veszpremi, V.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wienemann, P.; Wilkens, H.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.
2003-01-01
A search for charged and neutral excited leptons is performed in 217 pb-1 of data collected with the L3 detector at LEP at centre-of-mass energies up to 209 GeV. The pair- and single-production mechanisms are investigated and no signals are detected. Combining with L3 results from searches at lower centre-of-mass energies, gives improved limits on the masses and couplings of excited leptons.
Bandos, Andriy I.; Ganott, Marie A.; Sumkin, Jules H.; Kelly, Amy E.; Catullo, Victor J.; Rathfon, Grace Y.; Lu, Amy H.; Gur, David
2013-01-01
Purpose: To compare the diagnostic performance of breast tomosynthesis versus supplemental mammography views in classification of masses, distortions, and asymmetries. Materials and Methods: Eight radiologists who specialized in breast imaging retrospectively reviewed 217 consecutively accrued lesions by using protocols that were HIPAA compliant and institutional review board approved in 182 patients aged 31–60 years (mean, 50 years) who underwent diagnostic mammography and tomosynthesis. The lesions in the cohort included 33% (72 of 217) cancers and 67% (145 of 217) benign lesions. Eighty-four percent (182 of 217) of the lesions were masses, 11% (25 of 217) were asymmetries, and 5% (10 of 217) were distortions that were initially detected at clinical examination in 8% (17 of 217), at mammography in 80% (173 of 217), at ultrasonography (US) in 11% (25 of 217), or at magnetic resonance imaging in 1% (2 of 217). Histopathologic examination established truth in 191 lesions, US revealed a cyst in 12 lesions, and 14 lesions had a normal follow-up. Each lesion was interpreted once with tomosynthesis and once with supplemental mammographic views; both modes included the mediolateral oblique and craniocaudal views in a fully crossed and balanced design by using a five-category Breast Imaging Reporting and Data System (BI-RADS) assessment and a probability-of-malignancy score. Differences between modes were analyzed with a generalized linear mixed model for BI-RADS–based sensitivity and specificity and with modified Obuchowski-Rockette approach for probability-of-malignancy–based area under the receiver operating characteristic (ROC) curve. Results: Average probability-of-malignancy–based area under the ROC curve was 0.87 for tomosynthesis versus 0.83 for supplemental views (P tomosynthesis, the false-positive rate decreased from 85% (989 of 1160) to 74% (864 of 1160) (P tomosynthesis, more cancers were classified as BI-RADS category 5 (39% [226 of 576] vs 33% [188
Analysis of ELM stability with extended MHD models in JET, JT-60U and future JT-60SA tokamak plasmas
Aiba, N.; Pamela, S.; Honda, M.; Urano, H.; Giroud, C.; Delabie, E.; Frassinetti, L.; Lupelli, I.; Hayashi, N.; Huijsmans, G.; JET Contributors, the; Research Unit, JT-60SA
2018-01-01
The stability with respect to a peeling-ballooning mode (PBM) was investigated numerically with extended MHD simulation codes in JET, JT-60U and future JT-60SA plasmas. The MINERVA-DI code was used to analyze the linear stability, including the effects of rotation and ion diamagnetic drift ({ω }* {{i}}), in JET-ILW and JT-60SA plasmas, and the JOREK code was used to simulate nonlinear dynamics with rotation, viscosity and resistivity in JT-60U plasmas. It was validated quantitatively that the ELM trigger condition in JET-ILW plasmas can be reasonably explained by taking into account both the rotation and {ω }* {{i}} effects in the numerical analysis. When deuterium poloidal rotation is evaluated based on neoclassical theory, an increase in the effective charge of plasma destabilizes the PBM because of an acceleration of rotation and a decrease in {ω }* {{i}}. The difference in the amount of ELM energy loss in JT-60U plasmas rotating in opposite directions was reproduced qualitatively with JOREK. By comparing the ELM affected areas with linear eigenfunctions, it was confirmed that the difference in the linear stability property, due not to the rotation direction but to the plasma density profile, is thought to be responsible for changing the ELM energy loss just after the ELM crash. A predictive study to determine the pedestal profiles in JT-60SA was performed by updating the EPED1 model to include the rotation and {ω }* {{i}} effects in the PBM stability analysis. It was shown that the plasma rotation predicted with the neoclassical toroidal viscosity degrades the pedestal performance by about 10% by destabilizing the PBM, but the pressure pedestal height will be high enough to achieve the target parameters required for the ITER-like shape inductive scenario in JT-60SA.
2012-12-31
... cost or pricing data'' in its place. PART 217--SPECIAL CONTRACTING METHODS 217.7401 [Amended] 0 11... Cost or Pricing Data (DFARS Case 2011-D040) AGENCY: Defense Acquisition Regulations System, Department... ``certified cost or pricing data'' and ``data other than certified cost or pricing data.'' The DFARS changes...
Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.
2004-01-01
Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies
2012-09-01
Emergence behavior. Herpetological Review 40(1):77. Radzio, T. A., J. C. Hackler, A. D. Walde, D. K. Delaney and M. G. Hinderliter. 2009...Terrapene carolina (Eastern Box Turtle) and Gopherus polyphemus (Gopher Tortoise). Interspecific Interaction. Herpetological Review. 40(2): 217. Evans...Several of the researchers led a University of Georgia herpetology class on a weekend field trip to the AGTHP in 2010. A local Boy Scout Troop also
DEFF Research Database (Denmark)
Adam, R.; Ade, P. A R; Aghanim, N.
2016-01-01
The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the d...
Low energy, high power injection in JT-60 NBI
International Nuclear Information System (INIS)
Mizuno, Makoto; Dairaku, Masayuki; Horiike, Hiroshi
1988-05-01
JT-60 neutral beam injector (JT-60 NBI) is designed to inject 20 MW neutral hydrogen beam at energies of 70 ∼ 100 keV and the injection power decreases significantly at low energies (∼40 keV). For the extention of operation region aiming at the low density plasma heating and achieving H-mode by plasma periphery heating, increment of the injection power at low beam energies was required. The single-stage acceleration system was investigated in advance at the Prototype Injector Unit. From this result, the total injection power of 17 MW at 40 keV, 48 A per source was expected at the JT-60 NBI. This system was adopted in the JT-60 NBI from June, 1987 to July, 1987 and 17.6 MW neutral beam injection power was achieved. In the NB heating experiment, the H-mode transition phenomena was observed in JT-60 plasma. (author)
Research and development of JT-60 tokamak
International Nuclear Information System (INIS)
Saito, Ryusei; Sato, Hiroshi; Murata, Toshifumi; Ito, Yoshiyasu.
1978-01-01
The development of nuclear fusion apparatuses for the purpose of utilizing energy due to nuclear fusion reaction has been forwarded in various countries, and in Japan, the critical plasma testing apparatus JT-60 is about to be constructed, centering around Japan Atomic Energy Research Institute. This is one of four large apparatuses to be constructed in the world, and it is expected to be completed in 1982. JT-60 is a nuclear fusion apparatus of tokamak type aiming at generating critical plasma. The features of JT-60 are the formation of the plasma with small aspect ratio, the equipment of a magnetic limiter, the arrangement of the first wall of molybdenum and high temperature baking as the measures to impurities. The large toroidal magnetic field coil of JT-60 is composed of 18 unit coils. The analyses of magnetic field, thermal behavior and structural strength, the selection of materials, and the development of manufacturing techniques regarding the toroidal coil are described. The vacuum container of JT-60 is composed of the main body of torus type comprising thickwalled rings and bellows, the first wall comprising liners, fixed limiter and magnetic limiter, and observation ports. It is large torus-form container with non-circular cross section, and baking at 500 deg. C is required as the measure to ultrahigh vacuum. Complex forces including electromagnetic force act on it. (Kako, I.)
Construction of negative-ion based NBI for JT-60U
International Nuclear Information System (INIS)
Kawai, Mikito; Akino, Noboru; Ebisawa, Noboru
2001-11-01
The world's first negative-ion based neutral beam injector (N-NBI) system has been developed for studies of non-inductive current drive and plasma core heating with high energy neutral beam injection in higher density plasma. Construction of the N-NBI system for JT-60U was completed in March 1996. The system is composed of a beamline with two ion sources, a set of ion source power supplies, control system and auxiliary sub-system such as cooling water, refrigeration and vacuum system. In July 2001, deuterium neutral beam injection of 400keV and 5.8MW into JT-60U plasma was achieved. In order to increase both beam power and energy we have to go on more improvement of the N-NBI. (author)
Energy Technology Data Exchange (ETDEWEB)
Arai, Takashi; Masaki, Kei; Miyachi, Kengo [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
1998-10-01
It needs to make low ultimate pressure to decrease impurities in a plasma in a nuclear fusion device. Baking technique is very effective method to decrease outgassing rate from first walls and inner surface of the vacuum vessel. However, in such large vacuum vessel, e.g. JT-60, the non-uniform heating and the deformation due to thermal expansion might be very important problems. The baking technique of JT-60 is described. Two baking systems were applied to JT-60 to solve the problem of non-uniform heating. One is a circulation system of the hot nitrogen gas which is located between the inner and outer skins of the double-skin structured vacuum vessel. The other is an electric heater which apply the thick of the vessel. In order to prevent the deformation, the difference of temperature was as small as possible. By both the baking at 300degC and the conditioning such as discharge cleaning, the ultimate pressure was achieved 7.9x10{sup -7} Pa. (author)
International Nuclear Information System (INIS)
Arai, Takashi; Masaki, Kei; Miyachi, Kengo
1998-01-01
It needs to make low ultimate pressure to decrease impurities in a plasma in a nuclear fusion device. Baking technique is very effective method to decrease outgassing rate from first walls and inner surface of the vacuum vessel. However, in such large vacuum vessel, e.g. JT-60, the non-uniform heating and the deformation due to thermal expansion might be very important problems. The baking technique of JT-60 is described. Two baking systems were applied to JT-60 to solve the problem of non-uniform heating. One is a circulation system of the hot nitrogen gas which is located between the inner and outer skins of the double-skin structured vacuum vessel. The other is an electric heater which apply the thick of the vessel. In order to prevent the deformation, the difference of temperature was as small as possible. By both the baking at 300degC and the conditioning such as discharge cleaning, the ultimate pressure was achieved 7.9x10 -7 Pa. (author)
Control of divertor configuration in JT-60
International Nuclear Information System (INIS)
Yoshino, R.; Kukuchi, M.; Ninomiya, H.; Yoshida, H.; Tsuji, S.; Hosogane, N.; Seki, S.
1985-01-01
The control algorithm of JT-60 divertor configuration is presented. JT-60 has five types of poloidal magnetic field coil with each power supply in order to regulate the control objectives mentioned above. However, if one controls each objective by each coil current independently, there must inevitably occur large interaction between control objectives. Because the relation between control objectives and coil currents is complicated. This situation may be the same with a fusion reactor device. For making it possible to control each objective independently without causing large interaction, the authors adopt the noninteracting control algorithm. Hence, this report demonstrates the availability of this method to the control of JT-60 divertor configuration
Energy Technology Data Exchange (ETDEWEB)
Ellegaard, C; Barnes, P D [Carnegie-Mellon Univ., Pittsburgh, Pa. (USA); Flynn, E R [Los Alamos Scientific Lab., N.Mex. (USA)
1976-03-22
The reactions /sup 210/Pb(t,..cap alpha..)/sup 209/Tl and /sup 210/Pb(t,d)/sup 211/Pb have been studied with 20 MeV tritons. Seven levels in /sup 209/Tl have been identified in the /sup 210/Pb(t,..cap alpha..)/sup 209/Tl reaction. Level spins have been suggested by comparing the observed spectrum with that of the corresponding reaction on /sup 208/Pb. Nineteen levels in /sup 211/Pb were identified in the /sup 210/Pb(t,d)/sup 211/Pb reaction. Angular distributions were measured and lsub(n) values and spectroscopic factors were extracted by DWBA calculations. In both cases the spectra are very similar to the spectra obtained with /sup 208/Pb as a target. The deviations from these simple spectra would appear to be amenable to a description in terms of a coupling of the extra particle or hole to the /sup 210/Pb core.
Study of neutral particle behavior and particle confinement in JT-60U
International Nuclear Information System (INIS)
Takenaga, Hidenobu; Shimizu, Katsuhiro; Asakura, Nobuyuki; Shimada, Michiya; Kikuchi, Mitsuru; Tsuji-Iio, Shunji; Uchino, Kiichiro; Muraoka, Katsunori.
1995-07-01
In order to understand the particle confinement properties in JT-60U, the particle confinement time was estimated through analyses of the neutral particle behavior. First, the neutral particle transport simulation code DEGAS using a Monte-Carlo technique was combined with the simple divertor code for calculating the edge plasma parameters, and was developed to calculate under the experimental conditions in JT-60U. Then, the charged particle source in the main plasma due to the ionization of the neutral particles was evaluated from the analyses of the neutral particle penetration to the main plasma based on results of the simulation code and measurements of D α emission intensities. Finally, the particle confinement time was estimated from the analysis of particle balance. The analyses were performed systematically for the L-mode plasma and H-mode plasma of JT-60U, and a data base of the particle confinement time was obtained. The dependence of the particle confinement time on the plasma parameters and the relationship between the properties of the particle confinement and the energy confinement were examined. (author)
Les déterminants socioéconomiques de l'adoption des technologies ...
African Journals Online (AJOL)
... 2) les taux moyens d'adoption par technologie sont de 74,9% pour les variétés améliorées, 57,2% pour les pesticides chimiques, 20% pour la combinaison fumure organique/NPK ; 21.7% pour l'engrais NPK seul, 7,4% pour les biopesticides à base de graines de Neem et 5,7% pour le respect de la densité de semis.
Operation and management manual of JT-60 experimental data analysis system
International Nuclear Information System (INIS)
Hirayama, Takashi; Morishima, Soichi
2014-03-01
In the Japan Atomic Energy Agency Naka Fusion Institute, a lot of experiments have been conducted by using the large tokamak device JT-60 aiming to realize fusion power plant. In order to optimize the JT-60 experiment and to investigate complex characteristics of plasma, JT-60 experimental data analysis system was developed and used for collecting, referring and analyzing the JT-60 experimental data. Main components of the system are a data analysis server and a database server for the analyses and accumulation of the experimental data respectively. Other peripheral devices of the system are magnetic disk units, NAS (Network Attached Storage) device, and a backup tape drive. This is an operation and management manual the JT-60 experimental data analysis system. (author)
Jacob, V Y P; Stallmach, A; Felber, J
2016-06-01
Changes in gastric and small bowel motility are a common clinical problem. Currently diagnostic options are limited because each method harbors certain disadvantages. It has been shown that the high-resolution three-dimensional magnetic detector system 3D-MAGMA is capable of reliably measuring gastric and small intestine motor activity. This system allows precise localization of a small magnetic marker and determination of its three-dimensional orientation inside a human body. The aim of the current study was to determine if 3D-MAGMA is reliably able to detect changes in gastric and small bowel motility under controlled conditions. MCP was used as a well known prokinetic agent to shorten the gastric and small bowel passage. 8 healthy volunteers (fasting) underwent motility testing of the stomach and small bowel by 3D-MAGMA with and without administration of MCP (10 mg orally). Among other data the time the capsule needed to pass through the stomach and the duodenum and the time the capsule needed to pass through the first 50 cm of the jejunum were recorded. The retention time of the capsule in the stomach under physiological conditions was 49.1 minutes (median; min. 18 min; max. 88.8 min). The median time the capsule needed to pass through the duodenum was 13.8 minutes (median; min. 1.7 min; max. 24.8 min). The time the capsule needed to pass through the first 50 cm of the jejunum under physiological conditions was 33.0 minutes (median; min. 20.2 min; max. 67.2 min). The retention time of the capsule in the stomach decreased significantly after administration of MCP to 20.9 minutes (median; min. 1.7 min; max. 62.8 min; p = 0.008). The time the capsule needed to pass through the duodenum was also reduced to 7.1 minutes (median; min. 3.1 min; max. 18.3 min; p = 0.055). The time the capsule needed to pass through the first 50 cm of the jejunum was also reduced to 21.7 minutes (median; min. 10.7 min; max. 31.2 min; p = 0.069). 3D-MAGMA is able
Design, fabrication and test of double-wall vacuum vessel for JT-60U
International Nuclear Information System (INIS)
Uchikawa, Takashi; Ioki, Kimihiro; Ninomiya, Hiromasa.
1994-01-01
A double-wall vacuum vessel was designed and fabricated for JT-60U (an upgraded machine of JT-60), which has a plasma current up to 6 MA and a large plasma volume (100 m 3 ). A new concept of Inconel 625 all-welded structure was adopted to the vessel, that comprises an inner plate, square tubes and an outer plate. The vacuum vessel with a multi-arc D-shaped cross section was fabricated by using hot-sizing press. The electromagnetic and structural analysis has been performed for plasma disruption loads. Dynamic responses of the vessel were measured during plasma disruptions, and the observed displacement had a good agreement with the result of FEM analysis. (author)
SU-D-217BCD-01: Corrupted DICOM Image Recovering: A Clinical Experience.
Chen, L; Walz-Flannigan, A; Langer, S
2012-06-01
Colored DICOM secondary capture images generated from CT perfusion studies were corrupted if they were sent directly from a Siemens acquisition workstation to a GE viewing workstation. However, those images were properly displayed in the GE viewing workstation if they were transferred through a GE PACS first. The purpose of this work is to investigate the cause of image corruption and determine why passing through PACS corrected it. DICOM headers of corrupted and non-corrupted (sent through the PACS) images were compared with a free DICOM software tool (http://DVTK.org); the differences were highlighted. Certain header tags were found in non-corrupted images, but not in corrupted images. These tags were sequentially removed until the non- corrupted image became corrupted. Once a candidate tag was found, fresh corrupt images were modified by adding a 'repair' tag and tested. It was found that the absence of Planar Configuration (0028, 0006) is the cause of image corruption. This attribute is used in the DICOM color image to specify whether the color pixel data are sent color-by-plane or color-by- pixel and should be present if the Sample per Pixel (0028, 0002) tag has a value greater than 1. In our DICOM color images, the values of (0028, 0002) and Photometric Interpretation (0028, 0004) are 3 and RGB, respectively. Thus (0028, 0006) should equal 0 (color-by-pixel), which is used for uncompressed or lossless compressed transfer syntaxes. Adding this tag and setting the value to zero manually repaired corrupt images. Using open source DICOM tools and following the described process can be a valuable ally in the search for causes of image corruption. Comparing the headers and finding the handful of different tags rapidly led to an explanation that could be used by the vendor for a permanent fix. © 2012 American Association of Physicists in Medicine.
Assembly study for JT-60SA tokamak
Energy Technology Data Exchange (ETDEWEB)
Shibanuma, K., E-mail: shibanuma.kiyoshi@jaea.go.jp [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan); Arai, T.; Hasegawa, K.; Hoshi, R.; Kamiya, K.; Kawashima, H.; Kubo, H.; Masaki, K.; Saeki, H.; Sakurai, S.; Sakata, S.; Sakasai, A.; Sawai, H.; Shibama, Y.K.; Tsuchiya, K.; Tsukao, N.; Yagyu, J.; Yoshida, K.; Kamada, Y. [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan); Mizumaki, S. [Toshiba Corporation, Minato-ku, Tokyo 105-8001 (Japan); and others
2013-10-15
The assembly scenarios and assembly tools of the major tokamak components for JT-60SA are studied in the following. (1) The assembly frame (with a dedicated 30-tonne crane), which is located around the JT-60SA tokamak, is adopted for effective assembly works in the torus hall and the temporary support of the components during assembly. (2) Metrology for precise positioning of the components is also studied by defining the metrology points on the components. (3) The sector segmentation for weld joints and positioning of the vacuum vessel (VV), the assembly scenario and tools for VV thermal shield (TS), the connection of the outer intercoil structure (OIS) and the installation of the final toroidal field coil (TFC) are studied, as typical examples of the assembly scenarios and tools for JT-60SA.
Electric quadruple moments of high-spin isomers in 209Po
International Nuclear Information System (INIS)
Ivanov, E.A.; Nicolescu, G.; Plostinaru, D.
1998-01-01
The electric quadrupole interaction of the 209 Po (17/2) - and (13/2) - isomers in a Bi single-crystal was measured. The results for the quadrupole moments are connected with studies of isomers in Po isotopes. A two level analysis procedure was employed for the combined data of (17/2) - and (13/2) - isomers. The quadrupole moments of the Po isotopes are of special interest for testing nuclear models because of supposed simple nuclear structure with two protons outside a closed magic number shell. While the g-factors are significant for the predominant few-particle structures often present at high spins, the quadrupole moments are sensitive to additional contributions arising from core deformation effects. A systematic study of quadrupole moments of 12 + isomers in Pb isotopes has indeed demonstrated that the valence neutron effective charge increases as more particle pairs are removed from the 208 Pb core. In the present work, quadrupole coupling constants were measured for the isomers by the time-differential perturbed angular distribution (TDPAD) technique, in the presence of quadrupole interactions from the internal electric field gradient (EFG) in Bi crystal. The experiments were performed using a pulsed deuteron-beam of 13 MeV. The (17/2) - isomer state (T 1/2 = 88 ns) and the (13/2) - isomer state (T 1/2 = 24 ns) were populated and aligned by the 209 Bi(d,2n) reaction. The repetition time of the pulse was 10 μs and the width was around 5 ns (FWHM). The rather low bombardment energy was chosen to reduce population of higher spin isomers and to optimize the population of 209 Po((17/2) - ) and 209 Po((13/2) - ). The 209 Po single crystal target was held at a temperature of 470 K in order to reduce possible radiation damage effects. The experiments have been performed with the c axis of the single crystal at 45 angle and 90 angle to the beam direction. We chose to use a calibration based on isomers with well-understood nuclear structure allowing a reliable
An algorithm for merging part nodes of JT models exported by FORAN
Directory of Open Access Journals (Sweden)
FANG Xiongbing
2017-05-01
Full Text Available Many cognominal parts exist in JT models exported by FORAN V70 R2.0 software, and this leads to an increase in time consumption and the space analysis results becoming hard to process when using clearance analysis software to perform distance computing for such JT models. Aiming at this problem, an algorithm for merging component nodes is put forward based on investigating the assembly configuration and inherent information (i.e. geometric and material information of JT models created by FORAN. The method is composed of four steps:coordinate transformation, model node renaming, node geometric data transferring and material attribute processing. Finally, the proposed method is implemented by C++ and JT Open Toolkit. The results show that the new JT models generated by the proposed method are comprised of only one assembly node, and they preserve the intrinsic information of the original JT models. Its validity is illustrated by a great deal of examples, and the content of the worked JT models are reduced by about 7% to 20%.
48 CFR 217.171 - Multiyear contracts for services.
2010-10-01
... services (e.g., ground maintenance, in-plane refueling, bus transportation, and refuse collection and... installation being closed or realigned under a base closure law as defined in 10 U.S.C. 2667(h)(2); or (C) A... Public Law 105-56 and similar sections in subsequent DoD appropriations acts); or (ii) A cancellation...
Resisting the author: JT LeRoy's fictional authorship
Loontjens, J.
2008-01-01
In the last decade, the interest in the relation between author and text, author and autobiography, seems to have grown. In my article, I use the story of the author JT LeRoy as a framework to analyse what this growing interest means for our understanding of the word "author." JT LeRoy’s work was
The archives of operational achievements in JT-60
International Nuclear Information System (INIS)
Seimiya, Munetaka
2007-08-01
Since the first plasma in JT-60 was achieved in April 1985, various experimental challenges have been successfully conducted, and currently producing many new findings. These achievements have been realized by large modifications for lower X-point divertor in 1987, for large plasma current upgrade in 1989-1991, for W-shaped divertor in 1997, and for long pulse discharge in 2002. Such developments contribute to have established JT-60 as the leading tokamak in the world. As a consequence of the 22-year operation, we have accumulated many operational and experimental data. This reports the operational records including troubles and availability, the outline of planning management, the safety control and the promotion procedure of operation in JT-60. (author)
Energy Technology Data Exchange (ETDEWEB)
Kuriyama, Masaaki [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
1997-02-01
The NBI (Neutral Beam Injection) apparatus used for negative ion at first in the world, has an aim to actually prove heating and electric current drive with high density plasma at the JT-60 and to constitute physical and technical bases for selection and design of heating apparatus of ITER (International Thermal Nuclear Fusion Experimental Reactor). Construction of 500 KeV negative ion NBI apparatus for the JT-60 started to operate on 1993 was completed at March, 1996. On the way, at a preliminary test on forming and acceleration of the negative ion beam using a portion of this apparatus, 400 KeV and 13.5 A/D of the highest deuterium negative ion beam acceleration in the world was obtained successfully, which gave a bright forecasting of the plasma heating and electric current drive experiment using the negative ion NBI apparatus. After March, 1996, some plans to begin beam incident experiment at the JT-60 using the negative ion NBI apparatus and to execute the heating and electric current drive experiment at the JT-60 under intending increase of beam output are progressed. (G.K.)
NCBI nr-aa BLAST: CBRC-PABE-26-1117 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-26-1117 ref|ZP_01033920.1| hypothetical protein ROS217_18782 [Roseovarius... sp. 217] gb|EAQ26601.1| hypothetical protein ROS217_18782 [Roseovarius sp. 217] ZP_01033920.1 2.5 28% ...
Review of JT-60 experiment (April-June, 1985)
International Nuclear Information System (INIS)
1986-11-01
Initial ohmic heating experiments in JT-60 were performed for a three month period of April-June 1985. A maximum plasma current of 1.6 MA was obtained for both divertor and limiter discharges. Low-q discharges of q eff = 2.5 and high density discharges of 4.8 x 10 19 m -3 were obtained in the divertor configuration. Typical divertor actions, i.e. particle exhaust, heat exhaust, impurity reduction and remote radiative cooling were demonstrated. (author)
DEFF Research Database (Denmark)
Kjærgaard, Peter C.
2008-01-01
Darwin-industrien i højt gear. Næste år bliver et 'Darwin-år' - både tilhængere og kritikere gør sig klar. Udgivelsesdato: 12. december......Darwin-industrien i højt gear. Næste år bliver et 'Darwin-år' - både tilhængere og kritikere gør sig klar. Udgivelsesdato: 12. december...
Grech, Sergio
1998-01-01
A series of programs where producer and presenter Sergio Grech explores the story of theatre in Malta and the contribution that various personalities gave to enrich it. Unfortunately, program 1 was lost.
Energy Technology Data Exchange (ETDEWEB)
Honjo, H.; Otsubo, K.; Yasuda, J.; Kitawaki, J.; Okada, H. (Department of Obstetrics and Gynaecology, Kyoto Prefectural University of Medicine, Kyoto); Ohkubo, T.; Nambara, T. (Pharmaceutical Institute, Tohoku University, Sendai, Japan)
1984-01-01
Early morning and 24 h urine samples and serum were collected daily throughout the menstrual cycle in women. Urinary oestradiol-17-glucosiduronate (E/sub 2/-17G) was measured with a direct radioimmunoassay whose antiserum has been prepared against E/sub 2/-17-G-(C-6)-bovine serum albumin conjugate and was very specific. On the average, E/sub 2/-17-G in early morning and 24 h urine samples showed a prominent peak one day before the peak of urinary LH. The time relationship between these urinary E/sub 2/-17-G and serum E/sub 2/ levels and peaks was also investigated.
Data management facility for JT-60
International Nuclear Information System (INIS)
Ohasa, K.; Kurimoto, K.; Mochizuki, O.
1983-01-01
This study considers the Data Management Facility which is provided for unified management of various diagnostics data with JT-60 experiments. This facility is designed for the purpose of data access. There are about 30 kinds of diagnostic devices that are classified by diagnostic objects equipped for JT-60 facility. It gathers the diagnostic date about 10 Mega Byte per each discharge. Those diagnostic data are varied qualitatively and quantitatively by experimental purpose. Other fundamental information like discharge condition, adjustive value for diagnostic devices is required to process those gathered data
Combined Brayton-JT cycles with refrigerants for natural gas liquefaction
Chang, Ho-Myung; Park, Jae Hoon; Lee, Sanggyu; Choe, Kun Hyung
2012-06-01
Thermodynamic cycles for natural gas liquefaction with single-component refrigerants are investigated under a governmental project in Korea, aiming at new processes to meet the requirements on high efficiency, large capacity, and simple equipment. Based upon the optimization theory recently published by the present authors, it is proposed to replace the methane-JT cycle in conventional cascade process with a nitrogen-Brayton cycle. A variety of systems to combine nitrogen-Brayton, ethane-JT and propane-JT cycles are simulated with Aspen HYSYS and quantitatively compared in terms of thermodynamic efficiency, flow rate of refrigerants, and estimated size of heat exchangers. A specific Brayton-JT cycle is suggested with detailed thermodynamic data for further process development. The suggested cycle is expected to be more efficient and simpler than the existing cascade process, while still taking advantage of easy and robust operation with single-component refrigerants.
Directory of Open Access Journals (Sweden)
Rafael da Costa Cervieri
2005-06-01
Full Text Available Objetivando-se estudar o efeito da somatotropina bovina recombinante (rbST sobre a freqüência de distribuição e o diâmetro das fibras musculares do músculo Semitendinosus, 36 bezerros mestiços ½Angus-Nelore, com idade inicial de 63 ± 17 dias e pesando 76,8 ± 14,7 kg, criados em pastagem de Brachiaria decumbens e suplementados em creep feeding, foram submetidos a dois tratamentos até a desmama (217 dias: 18 bezerros receberam 1,4 mg/kg de rbST (Boostin® a cada 14 dias e 18 receberam solução salina (controle. As amostras de músculo foram coletadas aos 117 (biópsia e aos 217 dias de idade, quando foram abatidos cinco animais por tratamento. Os animais suplementados apresentaram maior diâmetro para as fibras do tipo glicolítica de contração rápida (FG aos 117 dias e tendência de aumento aos 217 dias e não diferiram em relação ao grupo controle quanto ao diâmetro das fibras oxidativas-glicolíticas de contração rápida (FOG e oxidativas de contração lenta (SO e à frequência de FG, FOG e SO aos 117 e 217 dias de idade. Independentemente da aplicação de rbST, houve significativo aumento do diâmetro das fibras SO e FOG, tendência de aumento de diâmetro das fibras FG, maior frequência de SO e redução da frequência de FG entre 117 e 217 dias de idade. A utilização de somatotropina exógena possibilitou maior hipertrofia das fibras musculares brancas de contração rápida em bezerros suplementados em creep feeding durante a fase de cria, sem interferir na frequência de distribuição dos tipos de fibras no músculo Semitendinosus.The objective of this experiment was to study the effect of the recombinant bovine somatotropin (rbST on the percentage distribution and diameter of semitendinosus muscle fibers. Thirty-six ½ Angus-Nellore crossbred bull calves, 63 ± 17 days old and weighting 76.8 ± 14.7 kg, raised in Brachiaria decumbens pastures and creep fed, were assigned to one of two treatments until weaning
Dynamic design of gas sorption J-T refrigerator
International Nuclear Information System (INIS)
Chan, C.K.
1986-01-01
A long-life Joule-Thomson refrigerator which is heat powered, involves no sealing, and has few mechanical parts and is desirable for longterm sensor cooling in space. In the gas-sorption J-T refrigerator, cooling is achieved by gas sorption (either adsorption or absorption) processes. Currently, a modular, single-stage refrigerator is being designed and built to be operated at 20 K. The design was analyzed using a dynamic model, which is described here. The model includes the kinetics of the compressors and the heat switches, the heat transfer of the pre-coolers and the heat exchangers, the on/off ratio of the check valves, and the impedance of the J-T valve. The cooling power, the cycle time, and the operating conditions were obtained in terms of the power input, the heat sink temperature, and the J-T impedance
Dynamic design of gas sorption J-T refrigerator
Chan, C. K.
1986-01-01
A long-life Joule-Thomson refrigerator which is heat powered, involves no sealing, and has few mechanical parts is desirable for long-term sensor cooling in space. In the gas-sorption J-T refrigerator, cooling is achieved by gas sorption (either adsorption or absorption) processes. Currently, a modular, single-stage refrigerator is being designed and built to be operated at 20 K. The design was analyzed using a dynamic model, which is described here. The model includes the kinetics of the compressors and the heat switches, the heat transfer of the pre-coolers and the heat exchangers, the on/off ratio of the check valves, and the impedance of the J-T valve. The cooling power, the cycle time, and the operating conditions were obtained in terms of the power input, the heat sink temperature, and the J-T impedance.
3-D Numerical Simulations of Biofilm Dynamics with Quorum Sensing in a Flow Cell
2014-01-01
the reactive term proposed as follows gp = 3∑ i=1 Cpic kpi + c ϕbi ( 1− ϕp ϕp,max ) + αr4ϕb4 − rpkcp kcp + c ϕp − Cdpd kdp + d ϕp. (2.9) Here Cpj is...and Cdp, respectively. kpi , kap, kcp and kdp are the half saturation constants for the Monod models adopted. Because of the simplification assumption...1 rpic kpi + c ϕbi, (2.17) The first term in gc represents the nutrient consumption due to bacteria metabolism and the second term represents the
Bjorkman, M P; Sorva, A J; Tilvis, R S
2009-05-01
To elucidate the association between vitamin D status, C-reactive protein (CRP) and fibrinogen. Secondary analysis of a randomised double-blind placebo controlled trial. Four longterm care hospitals (1215 beds) in Helsinki, Finland. 218 long-term inpatients aged over 65 years. Eligible patients (n = 218) were randomized to receive 0 IU/d, 400 IU/d, or 1200 IU/d cholecalciferol for six months. Plasma 25-hydroxyvitamin D (25-OHD), parathyroid hormone (PTH), high sensitive CRP, fibrinogen, amino-terminal propeptide of type I procollagen (PINP), and carboxy-terminal telopeptide of type I collagen (ICTP) were measured. The patients were aged (84.5 +/- 7.5 years), vitamin D deficient (25-OHD = 23 +/- 10 nmol/l), chronically bedridden and in stable general condition. The mean baseline CRP and fibrinogen were 10.86 mg/l (0.12 mg/l - 125.00 mg/l) and 4,7 g/l (2.3 g/l - 8.6 g/l), respectively. CRP correlated with ICTP (r = 0.217, p = 0.001), but not with vitamin D status. Supplementation significantly increased 25-OHD concentrations, but the changes in CRP and fibrinogen were insignificant and inconsistent. The post-trial CRP concentrations (0.23 mg/l -138.00 mg/l) correlated with ICTP (r = 0.156, p bedridden older patients.
Discharge optimization in JT-60
International Nuclear Information System (INIS)
Ninomiya, H.; Hosogane, N.; Kikuchi, M.; Yoshino, R.; Seki, S.; Kurihara, K.; Kimura, T.; Shimada, R.; Matsukawa, M.
1986-01-01
For the optimization of the feedback control gains of the plasma control system in JT-60, the plasma modelling by the regression analysis, the matrix transfer function analysis and the simulation study are performed. The experimental results of plasma control are well consistent with these estimations and the usefulness of a modelling by the regression analysis, the matrix transfer function analysis and the simulation study is experimentally confirmed. It is also shown that the regression analysis is useful for development of the sensor algorithm of plasma shape and location of separatrix line in a feedback control system. Some topics are also presented about plasma engineering obtained in JT-60: possibility to suppress the uncontrollability of plasma density, αI/sub p/ control for plasma position and volt-sec consumption
General Aspects Regarding the Crime of Human Trafficking
Directory of Open Access Journals (Sweden)
Vasile Draghici
2016-01-01
Thus, according to article 210 of the Penal Code, the crime of human trafficking involves„recruiting, transportation, sheltering or receiving of a person with the purpose of exploiting.Forthe offense of human trafficking there may exist preparatory acts, but the law does not incriminatethese acts as crimes and does not punish them. The attempt is punished according to article 217 ofthe Penal Code, stating that the attempt to the offenses stipulated at articles 209- 211 and article213 paragraph 2 of the Penal Code shall be punished.
Structure design of the central solenoid in JT-60SA
International Nuclear Information System (INIS)
Asakawa, Shuji; Tsuchiya, Katsuhiko; Kuramochi, Masaya; Yoshida, Kiyoshi
2009-09-01
The upgrade of JT-60U magnet system to superconducting coils (JT-60SA: JT-60 Super Advanced) has been decided by parties of Japanese government (JA) and European commission (EU) in the framework of the Broader Approach (BA) agreement. The magnet system for JT-60SA consists of a central solenoid (CS), equilibrium field(EF) coils, toroidal field(TF) coils. The central solenoid consists the four winding pack modules. In order to counteract the thermal contraction as well as the electric magnetic repulsion and attraction together with other forces generated in each module, it is necessary to apply pre-loading to the support structure of the solenoid and to pursue a structure which is capable of sustaining such loading. In the present report, the structural design of the supporting structure of the solenoid and the jackets of the modules is verified analytically, and the results indicate that the structural design satisfies the 'Codes for Fusion Facilities - Rules on Superconducting Magnet Structure -'. (author)
African Journals Online (AJOL)
Administrator
National Environmental Engineering Research Institute, CSIR-complex, Taramani, ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic ... especially in developing countries, where factors such .... Table 1: Ambient physical parameters at the sampling location.
Development of a linear motion antenna for the JT-60SA ECRF system
International Nuclear Information System (INIS)
Moriyama, Shinichi; Kobayashi, Takayuki; Isayama, Akihiko; Hoshino, Katsumichi; Suzuki, Sadaaki; Hiranai, Shinichi; Yokokura, Kenji; Sawahata, Masayuki; Terakado, Masayuki; Hinata, Jun; Wada, Kenji; Sato, Yoshikatsu
2013-01-01
Highlights: ► Development of an antenna featuring linear motion (LM) concept for long pulse electron cyclotron range of frequency (ECRF) heating and current drive in JT-60SA is in progress. ► A mock-up using a metallic sliding bearing with solid lubricant was fabricated. ► A vacuum pumping test with mass analyzer showed evidence of some hydrocarbons during shaft motion. ► Injection beam profile in toroidal beam scan was checked by low power measurement with mock-up. ► Current drive characteristics with the LM antenna for typical experimental scenarios of JT-60SA have been investigated by calculation. -- Abstract: Development of an antenna that features the linear motion (LM) concept for long-pulse electron-cyclotron range of frequency heating and current drive for the JT-60SA is in progress. Combining a linearly movable first mirror and a fixed curved second mirror allows the injection-beam angle to be controlled. Cooling water is fed through the drive shaft for the first mirror and through the fixed support for the second mirror. The shaft support structure uses a metallic sliding bearing with a solid lubricant. The sliding bearing supports combined linear and rotational motion, whereas a conventional ball bearing supports either linear or rotational motion. Therefore, the sliding bearing offers the advantage of reducing the support-structure volume, which is important in the design of the relatively narrow port duct of the JT-60SA. Recently, the sliding bearing has been installed into the mockup. Results of a vacuum test with a mass analyzer indicate the presence of hydrocarbons during shaft motion. The injection-beam profile obtained from a toroidal beam scan is checked against low-power measurements taken on the mockup. Finally, for typical JT-60SA experimental scenarios, heating- and current-drive characteristics of the LM antenna are investigated theoretically
Present construction status and future plan of JT-60
Energy Technology Data Exchange (ETDEWEB)
Iso, Yasuhiko; Yoshikawa, Masaji [Japan Atomic Energy Research Inst., Tokai, Ibaraki. Tokai Research Establishment
1982-04-01
As for the critical plasma test facility JT-60, its detailed design was initiated in 1975, and the manufacture of the main body components was started in April, 1978, through the trial manufacture and development of important components. The manufacture of all the system equipment in factories is in progress. Especially, the essential components of main body have been almost completed, and ready to be installed in the building. The building is under construction, and a part of the equipment was brought in and installed since the beginning of 1982 fiscal year. JT-60 is composed of heating system, toroidal magnetic field coil power supply, poloidal magnetic field coil power supply, total control system, associated system for main body and various measuring equipment as well as the main body which consists of vacuum vessel, toroidal and poloidal magnetic field coils, base, primary cooling system, movable limiter and evacuating system. In this report, first the significance of JT-60 development and the outline of JT-60 are described, and the present construction status is reported. The specifications of the essential equipment of the main body and heating system and the measuring system configuration are listed in tables. The aims in JT-60 design are to make plasma generating pulse width longer, to obtain higher beta value in circular cross-section plasma, to install the magnetic limiter, and to realize compound second stage heating.
Minimal Representation and Decision Making for Networked Autonomous Agents
2015-08-27
University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S...Laboratory University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 tel: 217-333-1368, fax: 217-244-1653 email: voulgari@illinois.edu...a mobile sensor network (MSN) when some of the nodes in the network fail. We posed the problem as a multi-stage decision process, and used forward
1983-11-04
Federal Activities, U.S. Environmental Protection Agency, Washington, D.C. Sincerely yours,, PD k Whittington , P.E Regional Administrator Enclosure I I I I...many of the residents are deprived , disadvantaged; uninformed and part of a minority); nor is anyone certain the AF will make full restitUtion in light...only wash 217 our home away but would deprive to us of water for the pipelines that supply 217 water over the whole ranch. This reservoir has been here
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 8 PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD 217 ... PDG...LRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD Sbjct: 1 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHIS
Recent results of JT-60U ICRF antenna operation
International Nuclear Information System (INIS)
Fujii, T.; Saigusa, M.; Kimura, H.
1994-01-01
Ion cyclotron range of frequencies (ICRF) heating is one of attractive plasma heating methods for reactor grade tokamaks, because it is quite effective in the wide ranges of plasma density and temperature. An antenna which should inject high power into plasma has been developed intensively because the heating efficiency and the coupling properties depend on its design. The antenna was operated at a small antenna-plasma gap in the JT-60 in out of phase mode, which showed the high heating efficiency to obtain high loading resistance, and similarly to other tokamaks. However, in order to reduce heat load to the antenna from plasma, a wide gap is required in reactor grade tokamaks such as ITER, in which the gap is designed to be 0.15 m in CDA. Two new antennas were fabricated for the JT-60U, which were designed to obtain high loading resistance at a wide gap for (π,0) phasing. The JT-60U ICRF heating system is explained. Also the JT-60U antenna is described. Antenna conditioning has been conducted well in the initial operation period. The phasing mode was set at (π,0) phasing, in which high heating efficiency is expected. The procedure is explained. The coupling and radiation loss properties during ICRF heating are reported. The JT-60U ICRF antennas were conditioned quickly with about 70 shots. The maximum coupled power was 6.4 MW for (π,0) phasing, and the power density was 6.1 MW/m 2 . (K.I.)
Performance verification tests of JT-60SA CS model coil
Energy Technology Data Exchange (ETDEWEB)
Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Murakami, Haruyuki [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2015-11-15
Highlights: • The performance of the JT-60SA CS model coil was verified. • The CS model coil comprised a quad-pancake wound with a Nb{sub 3}Sn CIC conductor. • The CS model coil met the design requirements. - Abstract: As a final check of the coil manufacturing method of the JT-60 Super Advanced (JT-60SA) central solenoid (CS), we verified the performance of a CS model coil. The model coil comprised a quad-pancake wound with a Nb{sub 3}Sn cable-in-conduit conductor. Measurements of the critical current, joint resistance, pressure drop, and magnetic field were conducted in the verification tests. In the critical-current measurement, the critical current of the model coil coincided with the estimation derived from a strain of −0.62% for the Nb{sub 3}Sn strands. As a result, critical-current degradation caused by the coil manufacturing process was not observed. The results of the performance verification tests indicate that the model coil met the design requirements. Consequently, the manufacturing process of the JT-60SA CS was established.
Vacuum leak test technique of JT-60
International Nuclear Information System (INIS)
Kaminaga, Atsushi; Arai, Takashi; Kodama, Kozo; Sasaki, Noboru; Saidoh, Masahiro
1998-01-01
Since a vacuum vessel of JT-60 is very large (167 m 3 ) and is combined with many components, such as magnetic coils, neutral beam injection systems and RF heating systems, etc., the position of leak testing exceeds 700. The two kind of techniques for vacuum leak test used in JT-60 has been described. Firstly the probe helium gas can be fed remotely in the three-dimensionally sectioned 54 regions of the JT-60 torus. The leak test was very rapidly performed by using this method. Secondly the helium detector system has been modified by the additional installation of the cryopump, which reduced the background level of the deuterium gas. The sensitivity of vacuum leak test with the cryopump was two orders of magnitude larger than that of without it. The examples of the performed vacuum leak test are stated. The vacuum leaks during experiments were 9 times. They were caused by thermal strain and plasma discharge. The vacuum leaks just after maintenance are 36 times which mainly caused by mis-installation. (author)
International Nuclear Information System (INIS)
1987-01-01
In JT-60, after the finish of the first stage Joule experiment, the heating facilities were installed, and the heating experiment was started in August, 1986. As to neutral beam injection, the beam injection experiment at the maximum rating 20 MW carried out, and also as to RF, the injection experiment up to 1.4 MW was carried out in both ion cyclotron and low band hybrid waves. The results worthy of special mention in the heating experiment were the success in the current drive up to 1.7 MA at maximum using low band hybrid waves and the improvement of plasma confinement characteristics obtained by the compound heating of NBI and RF. In this paper, the main results of these heating experiments and their significance are explained. The JT-60 is the testing facilities for attaining the critical plasma condition by additionally heating the plasma which is generated by Joule electric discharge with NBI and RF heatings. The experimental operation cycle of the JT-60 consists of the unit cycle of two weeks, and the number of days in operation is nine days. The temperature of heated plasma rose to 70 million deg C in the 20 MW NBI heating. Hereafter, the improvement of confinement time by increasing the stored energy of plasma is attempted. (Kako, I.)
Pre-Exposure Prophylaxis YouTube Videos: Content Evaluation.
Kecojevic, Aleksandar; Basch, Corey; Basch, Charles; Kernan, William
2018-02-16
Antiretroviral (ARV) medicines reduce the risk of transmitting the HIV virus and are recommended as daily pre-exposure prophylaxis (PrEP) in combination with safer sex practices for HIV-negative individuals at a high risk for infection, but are underused in HIV prevention. Previous literature suggests that YouTube is extensively used to share health information. While pre-exposure prophylaxis (PrEP) is a novel and promising approach to HIV prevention, there is limited understanding of YouTube videos as a source of information on PrEP. The objective of this study was to describe the sources, characteristics, and content of the most widely viewed PrEP YouTube videos published up to October 1, 2016. The keywords "pre-exposure prophylaxis" and "Truvada" were used to find 217 videos with a view count >100. Videos were coded for source, view count, length, number of comments, and selected aspects of content. Videos were also assessed for the most likely target audience. The total cumulative number of views was >2.3 million, however, a single Centers for Disease Control and Prevention video accounted for >1.2 million of the total cumulative views. A great majority (181/217, 83.4%) of the videos promoted the use of PrEP, whereas 60.8% (132/217) identified the specific target audience. In contrast, only 35.9% (78/217) of the videos mentioned how to obtain PrEP, whereas less than one third addressed the costs, side effects, and safety aspects relating to PrEP. Medical and academic institutions were the sources of the largest number of videos (66/217, 30.4%), followed by consumers (63/217, 29.0%), community-based organizations (CBO; 48/217, 22.1%), and media (40/217, 18.4%). Videos uploaded by the media sources were more likely to discuss the cost of PrEP (PYouTube videos can be used to share reliable PrEP information with individuals. Further research is needed to identify the best practices for using this medium to promote and increase PrEP uptake. ©Aleksandar Kecojevic
International Nuclear Information System (INIS)
Takenaga, H.; Mahdavi, M.A.; Baker, D.R.
2001-01-01
Particle confinement was compared for the high confinement mode plasmas with the edge localized mode in the Japan Atomic Energy Research Institute Tokamak-60 Upgrade (JT-60U) [S. Ishida, JT-60 Team, Nucl. Fusion 39, 1211 (1999)] and the DIII-D tokamak [J. L. Luxon et al., Plasma Physics and Controlled Nuclear Fusion Research 1986 (International Atomic Energy Agency, Vienna, 1987), Vol. 1, p. 159] considering separate confinement times for particles supplied by neutral beam injection (NBI) (center fueling) and by recycling and gas-puffing (edge fueling). Similar dependence on the NBI power was obtained in JT-60U and DIII-D. The particle confinement time for center fueling in DIII-D was smaller by a factor of 4 in the low density discharges and by a factor of 1.8 in the high density discharges than JT-60U scaling, respectively, suggesting the stronger dependence on the density in DIII-D. The particle confinement time for edge fueling in DIII-D was comparable with JT-60U scaling in the low density discharges. However, it decreased to a much smaller value in the high density discharges
Maximum β limited by ideal MHD ballooning instabilites in JT-60
International Nuclear Information System (INIS)
Seki, Shogo; Azumi, Masashi
1986-03-01
Maximum β limited by ideal MHD ballooning instabilities is investigated on divertor configurations in JT-60. Maximum β against ballooning modes in JT-60 has strong dependecy on the distribution of the safety factor over the magnetic surfaces. Maximum β is ∼ 2 % for q 0 = 1.0, while more than 3 % for q 0 = 1.5. These results suggest that the profile control of the safety factor, especially on the magnetic axis, is attractive to the higher β operation in JT-60. (author)
Decomposition processes in soil of a healthy and a declining Phragmites australis stand
Czech Academy of Sciences Publication Activity Database
Šantrůčková, Hana; Picek, Tomáš; Šimek, Miloslav; Bauer, Václav; Kopecký, Jiří; Pechar, Libor; Lukavská, Jaroslava; Čížková, Hana
2001-01-01
Roč. 69, - (2001), s. 217-234 ISSN 0304-3770 R&D Projects: GA ČR GA206/96/0589 Institutional research plan: CEZ:AV0Z6066911 Keywords : decomposition * eutrophication * Phragmites australis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.361, year: 2001
Prototype ion source for JT-60 neutral beam injectors
International Nuclear Information System (INIS)
Akiba, M.
1981-01-01
A prototype ion source for JT-60 neutral beam injectors has been fabricated and tested. Here, we review the construction of the prototype ion source and report the experimental results about the source characteristics that has been obtained at this time. The prototype ion source is now installed at the prototype unit of JT-60 neutral beam injection units and the demonstration of the performances of the ion source and the prototype unit has just started
Schistura shuensis, a new species of loach from Myanmar (Teleostei: Nemacheilidae)
Czech Academy of Sciences Publication Activity Database
Bohlen, Jörg; Šlechtová, Vendula
2014-01-01
Roč. 24, č. 3 (2014), s. 217-223 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional support: RVO:67985904 Keywords : Schistura shuensis Subject RIV: EG - Zoology Impact factor: 1.400, year: 2014
Recent developments in the JT-60 data processing system
International Nuclear Information System (INIS)
Matsuda, T.; Saitoh, N.; Tsugita, T.; Oshima, T.; Sakata, S.; Sato, M.; Koiwa, M.; Watanabe, K.
1999-01-01
The JT-60 data processing system was originally a large computer complex system including a lot of micro-computers, several mini-computers, and a mainframe computer. Recently, several improvements have been made to the original system to modernize the system. Many sub-systems composed of aged mini-computers have been replaced with workstations by utilizing recent progress in computer and network technologies. The system can handle ∝300 MB of raw data per discharge, which is three times larger than the amount in the original system. These improvements have been applied to develop element technologies necessary to the remote participation in JT-60 experiments. A remote diagnostics control and monitoring system and a computer system for access to JT-60 data from the Internet are used together with video conferencing systems for a real-time communication. In 1996, the remote participation based on them was successfully demonstrated in collaboration with Japan Atomic Energy Research Institute, Los Alamos National Laboratory, and Princeton Plasma Physics Laboratory. (orig.)
Liu, Jia; He, Xiu-Feng; Wang, Gai-Hong; Merino, Emilio F; Yang, Sheng-Ping; Zhu, Rong-Xiu; Gan, Li-She; Zhang, Hua; Cassera, Maria B; Wang, He-Yao; Kingston, David G I; Yue, Jian-Min
2014-01-17
Aphadilactones A-D (1-4), four diastereoisomers possessing an unprecedented carbon skeleton, were isolated from the Meliaceae plant Aphanamixis grandifolia. Their challenging structures and absolute configurations were determined by a combination of spectroscopic data, chemical degradation, fragment synthesis, experimental CD spectra, and ECD calculations. Aphadilactone C (3) with the 5S,11S,5'S,11'S configuration showed potent and selective inhibition against the diacylglycerol O-acyltransferase-1 (DGAT-1) enzyme (IC50 = 0.46 ± 0.09 μM, selectivity index > 217) and is the strongest natural DGAT-1 inhibitor discovered to date. In addition, compounds 1-4 showed significant antimalarial activities with IC50 values of 190 ± 60, 1350 ± 150, 170 ± 10, and 120 ± 50 nM, respectively.
Design of distributed JT (Joule-Thomson) effect heat exchanger for superfluid 2 K cooling device
Jeong, S.; Park, C.; Kim, K.
2018-03-01
Superfluid at 2 K or below is readily obtained from liquid helium at 4.2 K by reducing its vapour pressure. For better cooling performance, however, the cold energy of vaporized helium at 2 K chamber can be effectively utilized in a recuperator which is specially designed in this paper for accomplishing so-called the distributed Joule-Thomson (JT) expansion effect. This paper describes the design methodology of distributed JT effect heat exchanger for 2 K JT cooling device. The newly developed heat exchanger allows continuous significant pressure drop at high-pressure part of the recuperative heat exchanger by using a capillary tube. Being different from conventional recuperative heat exchangers, the efficient JT effect HX must consider the pressure drop effect as well as the heat transfer characteristic. The heat exchanger for the distributed JT effect actively utilizes continuous pressure loss at the hot stream of the heat exchanger by using an OD of 0.64 mm and an ID of 0.4 mm capillary tube. The analysis is performed by dividing the heat exchanger into the multiple sub-units of the heat exchange part and JT valve. For more accurate estimation of the pressure drop of spirally wound capillary tube, preliminary experiments are carried out to investigate the friction factor at high Reynolds number. By using the developed pressure drop correlation and the heat transfer correlation, the specification of the heat exchanger with distributed JT effect for 2 K JT refrigerator is determined.
Z Boson Pair-Production at LEP
Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M
2003-01-01
Events stemming from the pair-production of Z bosons in e^+e^- collisions are studied using 217.4 pb^-1 of data collected with the L3 detector at centre-of-mass energies from 200 GeV up to 209 GeV. The special case of events with b quarks is also investigated. Combining these events with those collected at lower centre-of-mass energies, the Standard Model predictions for the production mechanism are verified. In addition, limits are set on anomalous couplings of neutral gauge bosons and on effects of extra space dimensions.
Study of grounding system of large tokamak device JT-60
International Nuclear Information System (INIS)
Arakawa, Kiyotsugu; Shimada, Ryuichi; Kishimoto, Hiroshi; Yabuno, Kohei; Ishigaki, Yukio.
1982-01-01
In the critical plasma testing facility JT-60 constructed by the Japan Atomic Energy Research Institute, high voltage, large current is required in an instant. Accordingly, for the protection of human bodies and the equipment, and for realizing the stable operation of the complex, precise control and measurement system, a large scale facility of grounding system is required. In case of the JT-60 experimental facility, the equipments with different functions in separate buildings are connected, therefore, it is an important point to avoid high potential difference between buildings. In the grounding system for the JT-60, a reticulate grounding electrode is laid for each building, and these electrodes are connected with a low impedance metallic duct called grounding trunk line. The power supply cables for various magnetic field coils, control lines and measurement lines are laid in the duct. It is a large problem to grasp quantitatively the effect of a grounding trunk line by analysis. The authors analyzed the phenomenon that large current flows into a grounding system by lightning strike or grounding. The fundamental construction of the grounding system for the JT-60, the condition for the analysis and the result of simulation are reported. (Kako, I.)
Subtyping Cryptosporidium ubiquitum, a Zoonotic Pathogen Emerging in Humans
Czech Academy of Sciences Publication Activity Database
Li, N.; Alderisio, K.; Elwin, K.; Cebelinski, E.; Chalmers, R.; Santin, M.; Fayer, R.; Kváč, Martin; Ryan, U.; Sak, Bohumil; Stanko, M.; Guo, Y.; Wang, L.; Zhang, L.; Cai, J.; Roellig, D.; Feng, Y.
2014-01-01
Roč. 20, č. 2 (2014), s. 217-224 ISSN 1080-6040 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : cervine genotype * source tracking * small mammals Subject RIV: EE - Microbiology, Virology Impact factor: 6.751, year: 2014
JT-60SA vacuum vessel manufacturing and assembly
Energy Technology Data Exchange (ETDEWEB)
Masaki, Kei, E-mail: masaki.kei@jaea.go.jp [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan); Shibama, Yusuke K.; Sakurai, Shinji; Shibanuma, Kiyoshi; Sakasai, Akira [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan)
2012-08-15
Highlights: Black-Right-Pointing-Pointer The design of the JT-60SA vacuum vessel body was completed with the demonstration of manufacturing procedure by the mock-up fabrication of the 20 Degree-Sign upper half of VV. Black-Right-Pointing-Pointer The actual VV manufacturing has started since November 2009. Black-Right-Pointing-Pointer The first product of the VV 40 Degree-Sign sector was completed in May 2011. Black-Right-Pointing-Pointer A basic VV assembly scenario and procedure were studied to complete the 360 Degree-Sign VV including positioning method and joint welding. - Abstract: The JT-60SA vacuum vessel (VV) has a D-shaped poloidal cross section and a toroidal configuration with 10 Degree-Sign segmented facets. A double wall structure is adopted to ensure high rigidity at operational load and high toroidal one-turn resistance. The material is 316L stainless steel with low cobalt content (<0.05%). The design temperatures of the VV at plasma operation and baking are 50 Degree-Sign C and 200 Degree-Sign C, respectively. In the double wall, boric-acid water is circulated at plasma operation to reduce the nuclear heating of the superconducting magnets. For baking, nitrogen gas is circulated in the double wall after draining of the boric-acid water. The manufacturing of the VV started in November 2009 after a fundamental welding R and D and a trial manufacturing of 20 Degree-Sign upper half mock-up. The manufacturing of the first VV 40 Degree-Sign sector was completed in May 2011. A basic concept and required jigs of the VV assembly were studied. This paper describes the design and manufacturing of the vacuum vessel. A plan of VV assembly in torus hall is also presented.
Střední prvek a Aristotelova katalogizace přírodních filosofů
Czech Academy of Sciences Publication Activity Database
Hobza, Pavel
-, č. 27 (2004), s. 51-74 ISSN 0862-6901 R&D Projects: GA ČR GP401/04/P217 Institutional research plan: CEZ:AV0Z9009908 Keywords : Aristotle * Middle Element * Anaximander Subject RIV: AA - Philosophy ; Religion
48 CFR 217.7101 - Definitions.
2010-10-01
... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... master agreement. (2) Is not a contract. (b) Job order— (1) Is a fixed price contract incorporating, by... pertaining to subjects not covered by the master agreement; but applicable to the job order being awarded...
2010-01-01
... that is considered to be a deposit under § 204.2(a) of the Board's Regulation D—Reserve Requirements of... bank under § 204.2(o) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM PROHIBITION AGAINST THE...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.321 Section 209.321 Transportation... TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES Disqualification Procedures § 209.321 Hearing. (a) Upon receipt of a hearing request complying with § 209.311, an administrative hearing for review of a notice of...
8 CFR 1240.40 - Proceedings commenced prior to April 1, 1997.
2010-01-01
..., DEPARTMENT OF JUSTICE IMMIGRATION REGULATIONS PROCEEDINGS TO DETERMINE REMOVABILITY OF ALIENS IN THE UNITED STATES Proceedings To Determine Deportability of Aliens in the United States: Hearing and Appeal (for... case of an alien admitted to the United States under the provisions of section 217 of the Act. All...
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
For the application to hydrogen combustion turbines, the R and D were continued of heat resistant alloys, ceramic composite materials, and carbonaceous composite materials. In the development of highly efficient super alloy single crystal materials, as to the single crystal alloy (Ni-5.3Al-0.5Ti-6.0Mo-4.8W-6.0Re) and an alloy made by adding 0.15%Si to the above alloy and an alloy made by adding 2.0%Hf to the above alloy, data on high temperature tensile property and creep rupture property were obtained, and it was confirmed that Hf added alloys were excellent in strength. Relating to the development of fiber reinforced ceramics, materials for trial fabrication were fabricated by the CVI method using SiC fiber, and the evaluation test was conducted to obtain the basic data. Besides, the following were carried out: study of coating for heat resistant alloy cooled blades, development of ceramic composite materials, development of ceramic multi-structure materials and analysis of fracture behaviors under the ultra-high composite environment, development of 3D fiber reinforced composite materials, development of technology to evaluate basic properties of ultra-high temperature materials, etc. 46 refs., 217 figs., 43 tabs.
34 CFR 682.209 - Repayment of a loan.
2010-07-01
... combined into one account and repaid under one repayment schedule. In that event, the word “loan” in this... 34 Education 3 2010-07-01 2010-07-01 false Repayment of a loan. 682.209 Section 682.209 Education..., DEPARTMENT OF EDUCATION FEDERAL FAMILY EDUCATION LOAN (FFEL) PROGRAM General Provisions § 682.209 Repayment...
Research Program in Tropical Infectious Diseases
1994-02-10
valence of HBsAg (0-64%) was found in Costa Rica Worker, Cowpen, Belize, for assisting with the field investiga - (SALOM et al., 1990). Throughout the...technical expertise in performing laboratory tests; from 0-3% in the USA to 8-0% in Amazonia . The cour- DrsChiaoCh Huangand Patrice Yarbough, Cenelabs Incor... Amazonia . PAHO Bull. 25:210-217. duras, with some comments on malaria, and on ar- Roberts, D. R., W. D. Alecrim, A. M. Tavares and M. bovirus
2010-10-01
... contract to the cost of an annual procurement approach, using a present value analysis. Do not award the multiyear contract unless the analysis shows that the multiyear contract will result in the lower cost (10 U...
2010-04-01
..., structures, equipment, roads, walks, parking lots, or other real or personal property or interest in such... property or the safety of others. (ii) Major life activities means functions such as caring for one's self... vocational education services, a handicapped person who meets the academic and technical standards requisite...
Progress in JT-60 joint research
International Nuclear Information System (INIS)
Kimura, Haruyuki; Kikuchi, Mitsuru; Inutake, Masaaki
2007-01-01
It consists of five chapters; 1) introduction, 2) management system of joint plan and researches, 3) progress of joint researches, 4) results of researches and 5) summary. The second chapter stated the structure of management system of JT-60 joint researches, progress of management of the JT-60 experimental theme system, invitation the public to joint researches and selection of the subjects. The progress of joint researches contained the number of subjects, research members and organizations, change of joint research fields, remote control system of experiments, analysis code group, and number of reports. The main results of researches such as development of operation without center solenoid, Magneto-Hydro-Dynamics (MHD) control by electron cyclotron wave, plasma-wall interaction, application of laser technologies to plasma measurement, and comparison between tokamak and helical are reported. (S.Y.)
Improvement of voltage holding capability in the 500 keV negative ion source for JT-60SA.
Tanaka, Y; Hanada, M; Kojima, A; Akino, N; Shimizu, T; Ohshima, K; Inoue, T; Watanabe, K; Taniguchi, M; Kashiwagi, M; Umeda, N; Tobari, H; Grisham, L R
2010-02-01
Voltage holding capability of JT-60 negative ion source that has a large electrostatic negative ion accelerator with 45 cm x 1.1 m acceleration grids was experimentally examined and improved to realize 500 keV, 22 A, and 100 s D- ion beams for JT-60 Super Advanced. The gap lengths in the acceleration stages were extended to reduce electric fields in a gap between the large grids and at the corner of the support flanges from the original 4-5 to 3-4 kV/mm. As a result, the voltage holding capability without beam acceleration has been successfully improved from 400 to 500 kV. The pulse duration to hold 500 kV reached 40 s of the power supply limitation.
2010-01-01
... compatible disk. Carriers wishing to use a different ADP procedure or e-mail must obtain written approval to... aircraft type— B-1—Aircraft type code B-2—Revenue aircraft departures B-3—Revenue passengers transported B-4—Revenue freight transported (kg) Sum of all aircraft types— C-1-Total revenue passengers in market...
2012-05-04
Hinderliter. 2009. Gopherus polyphemus (Gopher Tortoise). Emergence behavior. Herpetological Review 40(1):77. Radzio, T. A., J. C. Hackler, A. D...Interaction. Herpetological Review. 40(2): 217. Evans, D., S. Roberts, J. Jones, K. Edwards, H. Alexis Londo, D. Nicholson, S. Tweddale, and D...Workshops and events (date, location, audience, organizer): Several of the researchers led a University of Georgia herpetology class on a weekend field
Fuel briquettes from wood and agricultural residues
Energy Technology Data Exchange (ETDEWEB)
Natividad, R.A.
1982-01-01
A short review of the production and uses of briquettes and of machinery available for briquetting fine dry, coarse dry and coarse wet raw materials. The potential of a fuel briquette industry in the Philippines with an estimated annual production of 217 million ton of sawdust, 2.09 billion ton of rice hulls and 2.87 million ton of coconut husks is discussed. Studies at the Forest Products Research and Development Institute (FPRDI) have shown that sawdust, coir dust rice hulls briquettes with 1-2% resin binder have heating values of 6882, 5839 and 3913 cal/g respectively.
High Mach flow associated with plasma detachment in JT-60U
International Nuclear Information System (INIS)
Hatayama, A.; Hoshino, K.; Miyamoto, K.
2003-01-01
Recent new results of the high Mach flows associated with plasma detachment are presented on the basis of numerical simulations by a 2-D edge simulation code (the B2-Eirene code) and their comparisons with experiments in JT-60U W-shaped divertor plasma. High Mach flows appear near the ionization front away from the target plate. The plasma static pressure rapidly drops, while the total pressure is kept almost constant near the ionization front, because the ionization front near the X-point is clearly separated from the momentum loss region near the target plate. Redistribution from static to dynamic pressure without a large momentum loss is confirmed to be a possible mechanism of the high Mach flows. It has been also shown that the radial structure of the high Mach flow near the X point away from the target plate has a strong correlation with the DOD (Degree of Detachment) at the target plate. Also, we have made systematic analyses on the high Mach flows for both the 'Open' geometry and the 'W-shaped' geometry of JT-60U in order to clarify the geometric effects on the flows. (author)
Results of the H-mode experiments with JT-60 outer and lower divertors
International Nuclear Information System (INIS)
Nakamura, Hiroo; Tsuji, Shunji; Nagami, Masayuki
1989-08-01
In JT-60, hydrogen H-mode experiments with outer and lower divertors were performed. In the outer divertor, H-mode were obtained, similar to the ones observed in the other lower/upper divertors. Its threshold absorbed power and electron density were 16 MW and 1.8 x 10 19 m -3 . In the two combined heatings with NB+ICRF and NB+LHRF, H-mode discharges are also obtained. Moreover, in new configuration of lower divertor, H-mode phases without and with ELM are obtained. Typical results of the lower divertor are shown to compare the H-mode characteristics between the two configurations. Improvement of the energy confinement time in the two divertors was limited to 10 %. Analyses on ballooning/interchange instabilities were carried out with precise equlibria of JT-60. These results showed that the both modes were enough stable. (author)
Manufacturing of central control system of 'JT-60' a plasma feasibility experiment device
International Nuclear Information System (INIS)
Kondo, Ikuo; Kimura, Toyoaki; Murai, Katsuji; Iba, Daizo; Takemaru, Koichi.
1984-01-01
For constructing a critical-plasma-experiment apparatus JT-60, it was necessary to develop a new control system which enables to operate safely and smoothly a large scale nuclear fusion apparatus and to carry out efficient experiment. For the purpose, the total system control facility composed of such controllers as CAMAC system, timing system and protective interlock panel with multi-computer system as the core was developed. This system generalizes, keeps watch on and controls the total facilities as the key point of the control system of JT-60, and allows flexible operation control corresponding to the diversified experimental projects. At the same time, it carries out the fast real-time control of high temperature, high density plasma. In this paper, the system constitution, function and the main contents of development of the total system control facility are reported. JT-60 is constructed to attain the critical plasma condition as the premise of nuclear fusion reactors and to scientifically verify controlled nuclear fusion. Plasma expe riment will be started in April, 1985. The real-time control of plasma for carrying out high beta operation is planned, intending to develop future economical practical reactors. (Kako, I.)
International Nuclear Information System (INIS)
Qi Bujia; Tang Hongqing; Zhou Zuying
1995-01-01
Double differential cross sections of 238 U, 209 Bi, Fe and 9 Be around 10 MeV are measured at 5 or 6 or 8 angles between 35 degree and 120 degree by means of both normal and abnormal TOF spectrometers using T(d,n) neutron source. The present result of 9 Be is compared with existing experimental data. The data of 238 U and 209 Bi are compared with theoretical calculations. A good agreement is achieved
International Nuclear Information System (INIS)
Coletti, A.; Baulaigue, O.; Cara, P.; Coletti, R.; Ferro, A.; Gaio, E.; Matsukawa, M.; Novello, L.; Santinelli, M.; Shimada, K.; Starace, F.; Terakado, T.; Yamauchi, K.
2011-01-01
The paper describes the main features of the Superconducting Magnets Power Supply to generate the toroidal and poloidal magnetic fields in JT-60SA tokamak, with special regard to coil current regulation mode and magnets protection.
Design of the movable limiters for JT-60
International Nuclear Information System (INIS)
Takashima, Tetsuo; Yamamoto, Masahiro; Nakamura, Hiroo; Ohkubo, Minoru; Ohta, Mitsuru
1976-07-01
Two fast-acting movable rail limiters will be used in JT-60 to suppress skin effect of the plasma current with a large radius. They travel safely through a stroke of about 1 m for 0.1 sec in the build-up phase of plasma current. The movable limiter system consists of a driving mechanism, a vacuum seal, a bearing used at high temperatures in a vacuum, a molybdenum rail limiter weighing 200 kg and its auxiliary members. Many problems are involved in construction of the system because the design specifications exceed the present technology. Described are design of the movable limiter system for JT-60 and problems in the mechanical, electrical and vacuum aspects. (auth.)
Gclust Server: 173731 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 173731 TET_217.m00049 Cluster Sequences - 82 hypothetical protein chr_0_8254489_217...; no annotation 1 1.00e-40 0.0 11.11 0.0 0.0 0.0 0.0 Show 173731 Cluster ID 173731 Sequence ID TET_217.m0004
J.T. van der Kemp and Eighteenth century coded subjectivity | Smit ...
African Journals Online (AJOL)
It then proceeds to an analysis of the impact of J.T. van der Kemp, 1799-1804. Theoretically I draw on the distinction between morality and ethics by Michel Foucault as well as his theorising of eighteenth century representational thought. Keywords: J.T. van der Kemp, morality, ethics, models for missionary engagement, ...
Sutter, Jean-Pascal; Dhers, Sébastien; Rajamani, Raghunathan; Ramasesha, S; Costes, Jean-Pierre; Duhayon, Carine; Vendier, Laure
2009-07-06
Assembling bimetallic {Ni-Ln}(3+) units and {W(CN)(8)}(3-) is shown to be an efficient route toward heteronuclear {3d-4f-5d} compounds. The reaction of either the binuclear [{L(Me2)Ni(H(2)O)(2)}{Ln(NO(3))(3)}] complexes or their mononuclear components [L(Me2)Ni] and Ln(NO(3))(3) with (HNBu(3))(3){W(CN)(8)} in dmf followed by diffusion of tetrahydrofuran yielded the trinuclear [{L(Me2)NiLn}{W(CN)(8)}] compounds 1 (Ln = Y), 2a,b (Gd), 3a,b (Tb), 4 (Dy), 5 (Ho), and 6 (Er) as crystalline materials. All of the derivatives possess the trinuclear core resulting from the linkage of the {W(CN)(8)} to the Ni center of the {Ni-Ln} unit. Differences are found in the solvent molecules acting as ligands and/or in the lattice depending on the crystallization conditions. For all the compounds ferromagnetic {Ni-W} and {Ni-Ln} (Ln = Gd, Tb, Dy, and Er} interactions are operative resulting in high spin ground states. Parameterization of the magnetic behaviors for the Y and Gd derivatives confirmed the strong cyano-mediated {Ni-W} interaction (J(NiW) = 27.1 and 28.5 cm(-1)) compared to the {Ni-Gd} interaction (J(NiGd) = 2.17 cm(-1)). The characteristic features for slow relaxation of the magnetization are observed for two Tb derivatives, but these are modulated by the crystal phase. Analysis of the frequency dependence of the alternating current susceptibility data yielded U(eff)/k(B) = 15.3 K and tau(0) = 4.5 x 10(-7) s for one derivative whereas no maxima of chi(M)'' appear above 2 K for the second one.
A radiographic study of solitary bone cysts
Energy Technology Data Exchange (ETDEWEB)
Kim, Kyung Rak; Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral and Maxillofacial Radiology, Division of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)
1994-02-15
The aim of this study was to evaluate the clinical, radiographic and histopathologic features of 23 cases of solitary bone cyst by means of the analysis of radiographs and biopsy specimens in 23 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chunbuk National University. The obtained results were as follows; 1. The incidence of solitary bone cyst was almost equal in males (52.2%) and in females(42.8%) and the prevalent age of the solitary bone cyst were the second decade (47.8%) and the third decade (21.7%). 2. In the signs and symptoms of solitary bone cyst, pain or tenderness revealed in 17.4%, swelling revealed in 13.0%, pain and swelling revealed in 21.7%, paresthesia revealed in 4.4% and 43.5% were a symptom and the tooth vitality involved in the solitary bone cyst, 76.5% were posterior and 23.5% were either positive or negative. 3. In the location of the solitary bone cyst, 47.8% present posterior region, 21.7% present anterior region, 21.6% present anterior and posterior region, 4.4% present condylar process area. 4. In the hyperostotic border of the solitary bone cyst, 47.8% were seen entirely, 21.8% were seen partially, and 30.4% were not seen. 5. In the change of tooth, 59.1% were loss of the alveolar lamina dura, 13.6% were root resorption 4.55% were tooth displacement, 4.55% were root resorption and tooth displacement. 6. In the change of cortical bone of the solitary bone cyst, 39.1% were intact and 60.9% were thinning and expansion of cortical bone. 7. In the histopathologic findings of 9 cases, 33.3% were thin connective tissue wall, 11.1% were thickened myxo-fibromatous wall, 55.6% were thickened myxofibromatous wall with dysplastic bone formation.
A radiographic study of solitary bone cysts
International Nuclear Information System (INIS)
Kim, Kyung Rak; Hwang, Eui Hwan; Lee, Sang Rae
1994-01-01
The aim of this study was to evaluate the clinical, radiographic and histopathologic features of 23 cases of solitary bone cyst by means of the analysis of radiographs and biopsy specimens in 23 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chunbuk National University. The obtained results were as follows; 1. The incidence of solitary bone cyst was almost equal in males (52.2%) and in females(42.8%) and the prevalent age of the solitary bone cyst were the second decade (47.8%) and the third decade (21.7%). 2. In the signs and symptoms of solitary bone cyst, pain or tenderness revealed in 17.4%, swelling revealed in 13.0%, pain and swelling revealed in 21.7%, paresthesia revealed in 4.4% and 43.5% were a symptom and the tooth vitality involved in the solitary bone cyst, 76.5% were posterior and 23.5% were either positive or negative. 3. In the location of the solitary bone cyst, 47.8% present posterior region, 21.7% present anterior region, 21.6% present anterior and posterior region, 4.4% present condylar process area. 4. In the hyperostotic border of the solitary bone cyst, 47.8% were seen entirely, 21.8% were seen partially, and 30.4% were not seen. 5. In the change of tooth, 59.1% were loss of the alveolar lamina dura, 13.6% were root resorption 4.55% were tooth displacement, 4.55% were root resorption and tooth displacement. 6. In the change of cortical bone of the solitary bone cyst, 39.1% were intact and 60.9% were thinning and expansion of cortical bone. 7. In the histopathologic findings of 9 cases, 33.3% were thin connective tissue wall, 11.1% were thickened myxo-fibromatous wall, 55.6% were thickened myxofibromatous wall with dysplastic bone formation.
Conceptual design of JT-60SA cryostat
International Nuclear Information System (INIS)
Shibama, Y.K.; Sakurai, S.; Masaki, K.; Sukekawa, A.M.; Kaminaga, A.; Yoshida, K.; Matsukawa, M.
2007-01-01
JT-60U modification program to fully superconducting device has been proceeded, namely ''JT-60SA'', toward early realization of fusion energy based on tokamak concept. The design of JT-60SA cryostat is expected to achieve a vacuum thermal insulation for super conducting coils, a bio-shielding boundary and structural gravity support. The cryostat is required to cover JT-60SA tokamak device, which is 15 m of total height and 7 m of radius, but there is geometrical limit due to surrounding devices reutilized. Although the cryostat consists of vessel body and gravity support, and the structural material is low cobalt 304 stainless steel (Co: 2 , and the design of the leaf spring is considered to reduce thermal stress, and to withstand the mechanical loads of plasma disruption and seismic loads. The coolant is 80 K gas helium and both sides of panel are covered with multi-layers super insulation (SI) to reduce heat load (radiation) up to 1/100. Fraction of non-covered region is assumed to be 2% due to many port-joints and supports for the vacuum vessel. Total heat load for inner surface of cryostat (600 m 2 ) is 9kW and the heat load for the port-joints (-300 m 2 ) is assumed up to 9 kW. The operational pressure of the cryostat is required to keep less than 10 -2 Pa and about 100,000 m 2 of structural surfaces is considered for exhaust system specification. Another role of the cryostat is the radiation protection. Biological shielding up to 10 micro-Sv/h (for maintenance acceptance) is required of the cryostat surface after the 10 years operation. Thus the cryostat consists of boron (2 wt%) doped concrete of 220 mm thickness and structural SS304 of total 40 mm thickness. The concrete reduces the air activation (41Ar) in the torus hall by 90% rather than the normal one by the thermal neutron absorption of boron. (orig.)
Role of low order rational q values on the ITB-events in JT-60U plasmas
International Nuclear Information System (INIS)
Neudatchin, S.V.; Takizuka, T.; Hayashi, N.; Shirai, H.; Fujita, T.; Isayama, A.; Kamada, Y.; Koide, Y.; Suzuki, T.
2003-01-01
The formation of internal transport barriers (ITBs) near q=2,3 surfaces in normal (NrS) or optimized shear discharges of JT-60U and JET is well known. In reverse shear (RS) JT-60U plasmas, the role of q minimum (q min ) equal to 3, 5, 3, 2, 5, 2 is not obvious for ITB formation. ITB-events (non-local confinement bifurcations inside and around ITB in a ms timescale) are found in various JT-60U NrS and RS plasmas. Under sufficient power, ITB-events are seen at rational and not rational values of q min . The space-time evolution of T e and T i is similar even being strongly varied in space and time, suggesting same mechanism(s) of T e and T i transport. The temporal formation of strong ITB in H-mode under passing of q min =3 (after periodical improvements and degradations via ITB-events with 8ms period) in RS mode with P nbi =8MW is presented. Under smaller power, ITB-events are observed only at rational values of q min . In a weak RS shot with P nbi =4MW, abrupt rise of T e is seen at q min =3.5, while more cases of T i rise are observed. The difference of the T e and T i evolution seen regularly under the low power, suggests decoupling of T e and T i transport. (author)
Role of low order rational q values in the ITB-events in JT-60U plasmas
International Nuclear Information System (INIS)
Neudatchin, S.V.
2002-01-01
The formation of internal transport barriers (ITBs) near q=2,3 surfaces in normal (NrS) or optimized shear discharges of JT-60U and JET is well known. In reverse shear (RS) JT-60U plasmas, the role of q minimum (q min ) equal to 3.5, 3, 2.5, 2 is not obvious for ITB evolution. ITB-events (non-local confinement bifurcations inside and around ITB in a ms timescale) are found in various JT-60U NrS and RS plasmas. (a) Under sufficient power, ITB-events are seen at rational and not rational values of q min . The space-time evolution of Te and Ti is similar. The temporal creation of stronger ITB in H-mode (after periodical improvements and degradations via ITB-events with 8 ms period) under passing of q min = 3 is presented (P nbi = 8 MW, 1.5 MA / 3.7 T). (b) Under smaller power, the influence of some rational q min is seen clearly for ITB-events on T e . In 1.3MA/3.7T shot with very weak RS (Pnbi = 4 MW), abrupt rise of T e is seen at q min 3:5, while more cases of T i rise are observed. (c) The possible role of MHD-activity as ITB-events trigger (ms time scale correlation in some NrS and RS cases) is under investigation. (author)
Czech Academy of Sciences Publication Activity Database
Eitzinger, J.; Šťastná, M.; Žalud, Z.; Dubrovský, Martin
2003-01-01
Roč. 61, - (2003), s. 195-217 ISSN 0378-3774 R&D Projects: GA ČR GA521/99/D040 Institutional research plan: CEZ:AV0Z3042911 Keywords : water stress effect * soil water balance * DSSAT crop model Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.865, year: 2003
Energy Technology Data Exchange (ETDEWEB)
Akasaka, Hiromi; Sueoka, Michiharu; Takano, Shoji; Totsuka, Toshiyuki; Yonekawa, Izuru; Kurihara, Kenichi; Kimura, Toyoaki [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
2002-01-01
The JT-60 discharge control system, which had used HIDIC-80E 16 bit mini-computers and CAMAC systems since the start of JT-60 experiment in 1985, was renewed in March, 2001. The new system consists of a UNIX workstation and a VME-bus system, and features a distributed control system. The workstation performs message communication with a VME-bus system and controllers of JT-60 sub-systems and processing for discharge control because of its flexibility to construction of a new network and modifications of software. The VME-bus system performs discharge sequence control because it is suitable for fast real time control and flexible to the hardware extension. The replacement has improved the control function and reliability of the discharge control system and also has provided sufficient performance necessary for future modifications of JT-60. The new system has been running successfully since April 2001. The data acquisition speed was confirmed to be twice faster than the previous one. This report describes major functions of the discharge control system, technical ideas for developing the system and results of the initial operation in detail. (author)
Lateral Epicondylitis and Tobacco Use: A Case-Control Study.
Michienzi, Avery E; Anderson, Christopher P; Vang, Sandy; Ward, Christina M
2015-01-01
Although lateral epicondylitis (LE) is a very common tendinopathy, we understand little about the etiology of the disease. Tobacco use has been associated with other tendinopathies, and the purpose of this study is to determine if there is an association between the incidence of lateral epicondylitis and tobacco use. We performed a retrospective cohort study of adult patients diagnosed with lateral epicondylitis. Patients from a single orthopaedic surgeon's practice with LE were matched to control patients with other common upper extremity conditions based on age, gender, and occupation. A total of 65 case patients and 217 control patients were included in the study. The incidence of smoking in patients with lateral epicondylitis was compared to the incidence of smoking in the control group. Of the LE patients, 30/65 (46.2%) were non-smokers, 23/65 (35.4%) were former smokers, and 12/65 (18.5%) were current smokers. Of the control patients, 121/217 (55.8%) were non-smokers, 45/217 (20.7%) were former smokers, and 51/217 (23.5%) were current smokers. The odds of LE patients being former or current smokers compared to control patients were 1.45 times higher, but this was not statistically significant. Among people who did not smoke at the time of presentation, the odds of being a former smoker were 2.28 times higher in LE patients than in controls, which was statistically significant. The odds of being a former smoker were significantly higher in patients with lateral epicondylitis compared to patients with other upper extremity conditions. Although it did not reach statistical significance, the odds of being former or current smokers were also higher in the LE group. These results suggest a relationship between smoking history and incidence of lateral epicondylitis, though more research is needed to determine the exact nature of the relationship. Prognostic, Level III.
Parametric thermo-hydraulic analysis of the TF system of JT-60SA during fast discharge
International Nuclear Information System (INIS)
Polli, Gian Mario; Lacroix, Benoit; Zani, Louis; Besi Vetrella, Ugo; Cucchiaro, Antonio
2013-01-01
Highlights: • We modeled the central clock-wise pancake of JT-60SA TF magnet at the EOB. • We simulated a quench followed by a fast discharge. • We evaluated the temperature and pressure rises in the nominal configuration. • We evaluated the effect of several parameter changes on the thermal-hydraulic response of the system. -- Abstract: The evolution of the conductor temperature and of the helium pressure of the central pancake of the TF superconducting magnet of the JT-60SA tokamak in a quench scenario are here discussed. The quench is triggered by a heat disturbance applied at the end of burning and followed by a fast safety discharge. A parametric study aimed at assessing the robustness of the calculation is also addressed with special regard to the voltage threshold, used to define the occurrence of the quench, and to the time delay, that cover all the possible delays in the fast discharge after quench detection. Finally, due to sensitivity analyses the influences of different parameters were assessed: the material properties of the strands (RRR, copper fraction), the magnitude and the spatial length of the triggering disturbance and the magnetic field distribution. The numerical evaluations were performed in the framework of the Broader Approach Agreement in collaboration with CEA, ENEA and the JT-60SA European Home Team using the 1D code Gandalf [1
Directory of Open Access Journals (Sweden)
Garraffo H Martin
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines constitute the largest class of poison-frog alkaloids. Some alkaloids have been shown to act as noncompetitive blockers at nicotinic acetylcholine receptors but the proposed structures and the biological activities of most of the 5,8-disubstituted indolizidines have not been determined because of limited supplies of the natural products. We have therefore conducted experiments to confirm proposed structures and determine biological activities using synthetic compounds. Recently, we reported that one of this class of alkaloids, (--235B', acts as a noncompetitive antagonist for α4β2 nicotinic receptors, and its sensitivity is comparable to that of the classical competitive antagonist for this receptor, dihydro-β-erythroidine. Results The enantioselective syntheses of (--209B, (--231C, (--233D, (--235B", (--221I, and what proved to be an epimer of natural 193E, starting from common chiral lactams have been achieved. When we performed electrophysiological recordings to examine the effects of the synthetic alkaloids on two major subtypes of nicotinic receptors (α4β2 and α7 expressed in Xenopus laevis oocytes, (--231C effectively blocked α4β2 receptor responses (IC50 value, 1.5 μM with a 7.0-fold higher potency than for blockade of α7 receptor responses. In contrast, synthetic (--221I and (--epi-193E were more potent in blocking α7 receptor responses (IC50 value, 4.4 μM and 9.1 μM, respectively than α4β2 receptor responses (5.3-fold and 2.0-fold, respectively. Conclusion We achieved the total synthesis of (--209B, (--231C, (--233D, (--235B", (--221I, and an epimer of 193E starting from common chiral lactams, and the absolute stereochemistry of natural (--233D was determined. Furthermore, the relative stereochemistry of (--231C and (--221I was also determined. The present asymmetric synthesis of the proposed structure for 193E revealed that the C-8 configuration of natural 193E
Genetically deprived vitamin D exposure predisposes to atrial fibrillation.
Chan, Yap-Hang; Yiu, Kai-Hang; Hai, Jo Jo; Chan, Pak-Hei; Lam, Tai-Hing; Cowling, Ben J; Sham, Pak-Chung; Lau, Chu-Pak; Lam, Karen Siu-Ling; Siu, Chung-Wah; Tse, Hung-Fat
2017-12-01
Low vitamin D level is associated with atrial fibrillation (AF) and may be implicated in its pathogenesis. We studied single nucleotide polymorphisms (SNPs) of vitamin D mechanistic pathways and serum 25-hydroxyvitamin D [25(OH)D] levels in an age- and gender-matched case-control study (controls without AF: mean age 68.6 ± 8.7 years, female 25%; n = 1019; with AF: mean age 69.7 ± 9.5 years, female 30%; n = 156) recruited from a Chinese clinical cohort of patients with stable coronary artery disease. Twelve SNPs involved in the vitamin D mechanistic pathways were studied [biosynthetic: rs4646536, rs10877012, rs3829251, rs1790349; activation: rs2060793, rs1993116; vitamin D-binding protein (VBP)/group-specific component (GC): rs4588, rs7041, rs2282679, rs1155563; and vitamin D receptor: rs1544410, rs10735810]. A genetic risk score (GRS) (0-8) was constructed from SNPs associated with serum 25(OH)D as a proxy to lifelong vitamin D-deficient state. All 4 SNPs involved in the VBP/GC were significantly associated with serum 25(OH)D (rs4588, P 0.05). Vitamin D GRS (points 0-8) generated from these 4 SNPs was independently predictive of serum 25(OH)D [B = 0.54, 95% confidence interval (CI) 0.30-0.79; P < 0.001]. Genetically deprived vitamin D status as denoted by a low GRS (0-3) independently predicted an increased risk of AF, compared to a high GRS (4-8) (odds ratio = 1.848, 95% CI 1.217-2.805; P = 0.004). Genetically deprived vitamin D exposure predisposes to increased AF among patients with coronary artery disease. Whether VBP/GC may alter the risk of AF via alternative mechanisms warrants further studies. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2017. For permissions, please email: journals.permissions@oup.com.
Energy Technology Data Exchange (ETDEWEB)
Yoshida, M., E-mail: yoshida.masafumi@jaea.go.jp [Japan Atomic Energy Agency, Mukoyama 801-1, Naka-shi, Ibaraki-ken 311-0193 (Japan); Tanabe, T.; Adachi, A. [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Hayashi, T.; Nakano, T.; Fukumoto, M.; Yagyu, J.; Miyo, Y.; Masaki, K.; Itami, K. [Japan Atomic Energy Agency, Mukoyama 801-1, Naka-shi, Ibaraki-ken 311-0193 (Japan)
2013-07-15
Fuel retention rates and carbon re-deposition rates in the plasma shadowed areas, or tile gaps and remote areas, in JT-60U were measured. The total fuel retention rate in the plasma shadowed areas was more than two times higher than that in the carbon re-deposited layers on the plasma facing surfaces, or the divertor tiles. This is because of lower temperature in the plasma shadowed areas than in the plasma facing surfaces, which leads to high hydrogen saturation concentration, although the amount of the carbon re-deposited on the plasma shadowed areas was only 60% of that on the plasma facing surfaces. The total fuel retention rate in JT-60U, including previously determined for all the plasma facing areas, was evaluated to be 1.3 × 10{sup 20} H + D s{sup −1}, and this retention rate was lower than that in the other devices, due probably to high baking temperature operation in JT-60U. Distributions of the fuel retention and the carbon re-deposition in the whole in-vessel of a large tokamak were determined for the first time in the world.
International Nuclear Information System (INIS)
Yoshida, M.; Tanabe, T.; Adachi, A.; Hayashi, T.; Nakano, T.; Fukumoto, M.; Yagyu, J.; Miyo, Y.; Masaki, K.; Itami, K.
2013-01-01
Fuel retention rates and carbon re-deposition rates in the plasma shadowed areas, or tile gaps and remote areas, in JT-60U were measured. The total fuel retention rate in the plasma shadowed areas was more than two times higher than that in the carbon re-deposited layers on the plasma facing surfaces, or the divertor tiles. This is because of lower temperature in the plasma shadowed areas than in the plasma facing surfaces, which leads to high hydrogen saturation concentration, although the amount of the carbon re-deposited on the plasma shadowed areas was only 60% of that on the plasma facing surfaces. The total fuel retention rate in JT-60U, including previously determined for all the plasma facing areas, was evaluated to be 1.3 × 10 20 H + D s −1 , and this retention rate was lower than that in the other devices, due probably to high baking temperature operation in JT-60U. Distributions of the fuel retention and the carbon re-deposition in the whole in-vessel of a large tokamak were determined for the first time in the world
Waveguide circuit for LHRF heating in 'JT-60'
International Nuclear Information System (INIS)
Uehara, Kazuya; Saegusa, Mikio; Mizuno, Takenori; Sano, Keigo; Hara, Mitsuru; Oishi, Isamu; Kanai, Takao.
1985-01-01
As the heating method for attaining the critical condition in the critical plasma experiment apparatus 'JT-60' in the Japan Atomic Energy Research Institute, in addition to Joule heating, as the second heating method, neutral beam injection heating and high frequency heating have been adopted. For this high frequency heating, several tens to 200 MHz band of ICRF heating, several hundreds MHz to several GHz band of LHRF heating and several tens to 200 GHz band of ECR heating were considered, and in the JT-60, 100 MHz band (ICRF) and 2 GHz band (LHRF) have been adopted. Furukawa Electric Co., Ltd. has engaged in the development and manufacture of the waveguides of transmission system used for this high frequency heating through NEC Corp. This high frequency heating is to heat plasma by injecting high frequency radio waves into plasma proper, and reaches 10 MW for the whole high frequency heating. The system efficiently transmitting the radio waves of large power from a Klystron as a high frequency source to the JT-60 is the transmission system. The outline of the waveguides of the 2 GHz band transmission system and the individual performance of respective waveguides are reported. (Kako, I.)
Energy Technology Data Exchange (ETDEWEB)
Chatrchyan, Serguei; et al.,
2013-12-01
Measurements of the differential and double-differential Drell-Yan cross sections are presented using an integrated luminosity of 4.5(4.8) inverse femtobarns in the dimuon (dielectron) channel of proton-proton collision data recorded with the CMS detector at the LHC at sqrt{s} = 7 TeV. The measured inclusive cross section in the Z-peak region (60-120 GeV) is \\sigma(\\ell \\ell) = 986.4 +/- 0.6 (stat.) +/- 5.9 (exp. syst.) +/- 21.7 (th. syst.) +/- 21.7 (lum.) pb for the combination of the dimuon and dielectron channels. Differential cross sections $d\\sigma/dm$ for the dimuon, dielectron, and combined channels are measured in the mass range 15 to 1500 GeV and corrected to the full phase space. Results are also presented for the measurement of the double-differential cross section d^2\\sigma/dm d |y| in the dimuon channel over the mass range 20 to 1500 GeV and absolute dimuon rapidity from 0 to 2.4. These measurements are compared to the predictions of perturbative QCD calculations at next-to-leading and next-to-next-to-leading orders using various sets of parton distribution functions.
Recent results on steady state and confinement improvement research on JT-60U
International Nuclear Information System (INIS)
Ide, Shunsuke
2000-01-01
On the JT-60U tokamak, fusion plasma research for realization of a steady state tokamak reactor has been pursued. Towards that goal, confinement improved plasmas such as H-mode, high β p , reversed magnetic shear (RS) and latter two combined with H-mode edge pedestal have been developed and investigated intensively. A key issue to achieve non-inductive current drive relevant to a steady state fusion reactor is to increase the fraction of the bootstrap current and match the spatial profile to the optimum. In 1999, as the result of the optimization, the equivalent deuterium-tritium (D-T) fusion gain (Q DT eq ) of 0.5 was sustained for 0.8 s, which is roughly equal to the energy confinement time, in a RS plasma. In order to achieve a RS plasma in steady state two approach have been explored. One is to use external current driver such as lower hybrid current drive (LHCD), and by optimizing LHCD a quasi-steady RS discharge was obtained. The other approach is to utilize bootstrap current as much as possible, and with highly increased fraction of the bootstrap current, a confinement enhancement factor of 3.6 was maintained for 2.7 s in a RS plasma with H-mode edge. A heating and current drive system in the electron cyclotron range of frequency for localized heating and current drive has been installed on JT-60U, and in initial experiments a clear increase of the central electron temperature in a RS high density central region was confirmed only with injected power of 0.75 MW. (author)
Development of a pellet cutting and loading device for the JT-60 repetitive pellet injector
International Nuclear Information System (INIS)
Hiratsuka, Hajime; Ichige, Hisashi; Kizu, Kaname; Iwahashi, Takaaki; Honda, Masao
2001-03-01
In JT-60, a pellet injector that repetitively injects deuterium pellets is under development to supply fuel to high temperature plasmas and sustain high-density plasmas. The pellet injector generates cubic pellets and accelerates them with a straight-arm rotor by centrifugal force. In this acceleration method, it is important to supply pellets reliably and stably, to prevent pellet orbits from disordering and to stabilize the launching direction. To achieve higher performance of the injector, a pellet cutting and loading device that cuts a deuterium ice rod into cubic pellets and loads them to the pellet injector successively and stably has been developed. The pellet cutting and loading device can cut a deuterium ice rod produced at low temperature of -8 Pam 3 /s, cutting time of <3 ms, cutting frequency of 1-20 Hz and cutter stroke of 2.5 mm were confirmed in the device test. In the operation test after assembling this device to the centrifugal pellet injector, the operational performance of pellet injection frequency of ∼10 Hz, pellet speed of ∼690 m/s and pellet injection duration time of ∼3.5 s was achieved. Thus, the development of the pellet cutting and loading device contributed to the upgrade of the JT-60 pellet injector. (author)
Present status of the JT-60 control system
International Nuclear Information System (INIS)
Kimura, T.
1992-01-01
The present status of the control system for a large fusion device of the JT-60 upgrade tokamak is reported including its original design concept, the progress of the system in the past five-year operation and modification for the upgrade. The control system has the features of hierarchical structure, computer control, adoption of CAMAC interfaces and protective interlock by both software and hard-wired systems. Plant monitoring and control are performed by an efficient data communication via CAMAC highways. Sequential discharge control of is executed by a combination of computers and a timing system. A plasma feedback control system with fast 32-bit microprocessors and a man/machine interface with modern workstations have been newly developed for the operation of the JT-60 upgrade. (author)
Novel PSEN1 G209A mutation in early-onset Alzheimer dementia supported by structural prediction.
An, Seong Soo A; Bagyinszky, Eva; Kim, Hye Ryoun; Seok, Ju-Won; Shin, Hae-Won; Bae, SeunOh; Kim, SangYun; Youn, Young Chul
2016-05-20
Three main genes are described as causative genes for early-onset Alzheimer dementia (EOAD): APP, PSEN1 and PSEN2. We describe a woman with EOAD had a novel PSEN1 mutation. A 54-year-old right-handed woman presented 12-year history of progressive memory decline. She was clinically diagnosed as familial Alzheimer's disease due to a PSEN1 mutation. One of two daughters also has the same mutation, G209A in the TM-IV of PS1 protein. Her mother had unspecified dementia that began at the age of 40s. PolyPhen2 and SIFT prediction suggested that G209A might be a damaging variant with high scores. 3D modeling revealed that G209A exchange could result significant changes in the PS1 protein. We report a case of EOAD having probable novel PSEN1 (G209A) mutation verified with structural prediction.
Development of multilayer piezoelectric actuator valve for JT-60
International Nuclear Information System (INIS)
Miyo, Yasuhiko; Hiratsuka, Hajime; Masui, Hiroshi; Hosogane, Nobuyuki; Miya, Naoyuki
2001-11-01
In order to improve the gas injection valve used for the operation of JT-60, a new type of valve (multilayer piezoelectric actuator valve) was developed. The conventional valve (bimorph piezoelectric valve) has been used for 15 years since the beginning of experimental operation in April, 1985. However, it came to be hard to keep the performance of the valve because of the deterioration of the driving source, i.e. piezoelectric element. Developments of the new valve were carried out based on experiences through experimental operations in JT-60. Requirements for the design are: (1) to be hard structure for making a sheet leak, (2) to allow a repair work at atmosphere side without an air vent of the vacuum vessel, (3) to be more smaller and lighter compared with the conventional one, and (4) to have a high maintenance efficiency by utilizing of the commercial piezoelectric elements and power supplies. The newly developed valve was examined with various tests such as gas flow characteristic test, high magnetic field proof test, high temperature proof test and gas flow rate test for aged deterioration. Results, confirm that the performance of the valve is applicable for JT-60 operations. (author)
African Journals Online (AJOL)
User
1Department of Microbiology, Faculty of Science, Bayero University, PMB 3011, ... information to evaluate health risks for consumers. ... Kano Teaching Hospital, Kano, Nigeria, after seeking .... present in members of the Listeria genus with.
2010-10-01
... maximum extent practicable (also see paragraph (b) of this section): (1) UCAs for foreign military sales...) Congressionally mandated long-lead procurement contracts. (b) If the contracting officer determines that it is...
2010-10-01
... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and... contractors located outside the United States and its outlying areas. (c) Activities may issue job orders... government in the solicitation and job order. [56 FR 36345, July 31, 1991, as amended at 70 FR 35544, June 21...
49 CFR 107.209 - Determination.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Determination. 107.209 Section 107.209... PROGRAM PROCEDURES Preemption Preemption Determinations § 107.209 Determination. (a) Upon consideration of the application and other relevant information received, the Chief Counsel issues a determination. (b...
2. Interferometry and polarimetry. 2.3. Polarimetry on JT-60U
International Nuclear Information System (INIS)
Kawano, Yasunori
2000-01-01
In order to establish an electron density measurement method with high reliability and stability for magnetic-confinement fusion devices, studies on infrared polarimetry have been carried out in JT-60U. Electron density measurement based on tangential Faraday rotation has been verified using a CO 2 laser polarimeter developed for JT-60U. In this article, basic ideas of studies, results from polarimetry experiments, and suggestions for future devices are presented. (author)
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Discovery. 209.313 Section 209.313 Transportation... TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES Disqualification Procedures § 209.313 Discovery. (a... parties. Discovery is designed to enable a party to obtain relevant information needed for preparation of...
Economos, Christina D; Moore, Carolyn E; Hyatt, Raymond R; Kuder, Julia; Chen, Tai; Meydani, Simin Nikbin; Meydani, Mohsen; Klein, Ellen; Biancuzzo, Rachael M; Holick, Michael F
2014-05-01
Provision of fortified juices may provide a convenient method to maintain and increase blood fat-soluble vitamins. To determine whether children consuming orange juice fortified with calcium and combinations of vitamins D, E, and A could increase serum 25-hydroxyvitamin D [25(OH)D], α-tocopherol, and retinol levels. A 12-week randomized, double-blind, controlled trial. One hundred eighty participants (aged 8.04±1.42 years) were recruited at Tufts (n=70) and Boston University (n=110) during 2005-2006. Of those recruited, 176 children were randomized into three groups: CaD (700 mg calcium+200 IU vitamin D), CaDEA (700 mg calcium+200 IU vitamin D+12 IU vitamin E+2,000 IU vitamin A as beta carotene), or Ca (700 mg calcium). Children consumed two 240-mL glasses of CaD, CaDEA, or Ca fortified orange juice daily for 12 weeks. Serum 25(OH)D, α-tocopherol, and retinol concentrations. Changes in 25(OH)D, α-tocopherol, retinol, and parathyroid hormone concentrations were examined. Covariates included sex, age, race/ethnicity, body mass index, and baseline 25(OH)D, α-tocopherol, retinol, or parathyroid hormone levels. Multivariate models and repeated measures analysis of variance tested for group differences with pre-post measures (n=141). Baseline 25(OH)D was 68.4±27.7 nmol/L (27.4±11.10 ng/mL) ), with 21.7% of participants having inadequate 25(OH)D (vitamin D and 12 IU vitamin E increased 25(OH)D and α-tocopherol concentrations in young children within 12 weeks. Copyright © 2014 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Mehta, R. N. [Mechanical Engineering Department, Indian Institute of Technology Bombay, Mumbai - 400076, India and Government Engineering College Bharuch, Gujarat - 392002 (India); Bapat, S. L.; Atrey, M. D. [Mechanical Engineering Department, Indian Institute of Technology Bombay, Mumbai - 400076 (India)
2014-01-29
The need of a cooler with no electromagnetic interference and practically zero vibration has led to sorption compressor based Joule-Thomson (J-T) coolers. These are useful for sophisticated electronic, ground based and space borne systems. In a Sorption compressor, adsorbed gases are desorbed into a confined volume by raising temperature of the sorption bed resulting in an increase in pressure of the liberated gas. In order to have the system (compressor) functioning on a continuous basis, with almost a constant gas flow rate, multiple cells are used with the adaptation of Temperature Swing Adsorption (TSA) process. As the mass of the desorbed gas dictates the compressor throughput, a combination of sorbent material with high adsorption capacity for a chosen gas or gas mixture has to be selected for efficient operation of the compressor. Commercially available (coconut-shell base) activated carbon has been selected for the present application. The characterization study for variation of discharge pressure is used to design the Four-cell sorption compressor based cryocooler with a desired output. Apart from compressor, the system includes a) After cooler b) Return gas heat exchanger c) capillary tube as the J-T expansion device and d) Evaporator.
Harish Kruthiventi, S. S.; Venkatarathnam, G.
2017-10-01
Capillary tube expansion devices are used extensively in small closed cycle J-T refrigerators operating with refrigerant mixtures due to its low cost and the absence of any moving parts. It is possible for J-T refrigerators operating with mixtures that the velocity of refrigerant mixture at capillary tube outlet reaches a value where it equals the speed of sound at certain conditions. The variation of the speed of sound of nitrogen-hydrocarbon mixtures used in J-T refrigerators has been studied in two phase (vapour-liquid) and three-phase (Vapour-liquid-liquid) region as a function of temperature and pressure in this work. Also the conditions under which choking occurs in practical J-T refrigerators is investigated.
Behaviour of tritium in the vacuum vessel of JT-60U
International Nuclear Information System (INIS)
Kobayashi, K.; Miya, N.; Ikeda, Y.; Torikai, Y.; Saito, M.; Alimov, V.
2015-01-01
The disassembly of the JT-60U torus started in 2010 after 18 years of deuterium plasma operations. The vessel is made of Inconel 625. Therefore, it was very important to study the hydrogen isotope (particularly tritium) behavior in Inconel 625 from the viewpoint of the clearance procedure. Inconel 625 specimen was exposed to the D 2 (92.8 %) - T 2 (7.2 %) gas mixture at 573 K for 5 hours. The tritium release from the specimen at 298 K was controlled for about 1 year. After that a part of tritium remaining in the specimen was released by heating up to 1073 K. Other part of tritium trapped in the specimen was measured by chemical etching method. Most of the chemical form of the released tritium was HTO. The contaminated specimen by tritium was released continuously the diffusible tritium under the ambient condition. In the tritium release experiment, the amount of desorbed tritium was about 99% during 1 year. It was considered that the tritium in Inconel 625 was released easily
Behaviour of tritium in the vacuum vessel of JT-60U
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, K.; Miya, N.; Ikeda, Y. [JT-60 Safety Assessment Group, JAEA, Mukoyama (Japan); Torikai, Y. [Hydrogen Isotope Research Center, University of Toyama, Gofuku (Japan); Saito, M.; Alimov, V. [ITER Project Management Group, JAEA, Mukoyama (Japan)
2015-03-15
The disassembly of the JT-60U torus started in 2010 after 18 years of deuterium plasma operations. The vessel is made of Inconel 625. Therefore, it was very important to study the hydrogen isotope (particularly tritium) behavior in Inconel 625 from the viewpoint of the clearance procedure. Inconel 625 specimen was exposed to the D{sub 2} (92.8 %) - T{sub 2} (7.2 %) gas mixture at 573 K for 5 hours. The tritium release from the specimen at 298 K was controlled for about 1 year. After that a part of tritium remaining in the specimen was released by heating up to 1073 K. Other part of tritium trapped in the specimen was measured by chemical etching method. Most of the chemical form of the released tritium was HTO. The contaminated specimen by tritium was released continuously the diffusible tritium under the ambient condition. In the tritium release experiment, the amount of desorbed tritium was about 99% during 1 year. It was considered that the tritium in Inconel 625 was released easily.
49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.
2010-10-01
... piece of window glazing and each surrounding window frame when tested in accordance with the procedure... of the rear emergency door or doors shall be 45 inches high, 22 inches wide, and six inches deep. S5...
Injection control development of the JT-60U electron cyclotron heating system
Energy Technology Data Exchange (ETDEWEB)
Hiranai, Shinichi; Shinozaki, Shin-ichi; Yokokura, Kenji; Moriyama, Shinichi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment; Sato, Fumiaki [Nippon Advanced Technology Co., Ltd., Tokai, Ibaraki (Japan); Suzuki, Yasuo [Atomic Energy General Service Co., Ltd., Tokai, Ibaraki (Japan); Ikeda, Yoshitaka [Japan Atomic Energy Research Inst., Kashiwa, Chiba (Japan)
2003-03-01
The JT-60U electron cyclotron heating (ECH) System injects a millimeteric wave at 110 GHz into the JT-60 Plasma, and heats the plasma or drives a current locally to enhance the confinement performance of the JT-60 plasma. The system consists of four sets of high power gyrotrons, high voltage power supplies and transmission lines, and two antennas that launch electron cyclotron (EC) beams toward the plasma. The key features of the injection control system are streering of the direction of the EC beam by driving the movable mirror in the antenna, and capability to set any combination of polarization angle and ellipticity by rotating the two grooved mirrors in the polarizers. This report represents the design, fabrication and improvements of the injection control system. (author)
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.115 Section 209.115 Transportation... Hearing. (a) When a hearing is requested and scheduled under § 209.113, a hearing officer designated by the Chief Counsel convenes and presides over the hearing. If requested by respondent and if...
Canopy structure in savannas along a moisture gradient on Kalahari sands
CSIR Research Space (South Africa)
Scholes, RJ
2004-03-01
Full Text Available .07 3 Brachystegia spiciformis 56.3 25.3 11.85 0.76 3 Schinzophyton rautennii 90.0 49.8 8.08 0.93 4 Bauhinia petersiana 42.2 39.3 11.32 1.17 6 Pterocarpus angolensis 57.8 29.3 12.15 0.31 6 Baikieia plurijuga 45.2 21.7 11.05 1.70 6 Baphia massaiensis 79...
Development of a VME and CAMAC based data acquisition and transfer system for JT-60 control
International Nuclear Information System (INIS)
Totsuka, Toshiyuki
1993-08-01
Development of a VME and CAMAC based data acquisition and transfer system for JT-60 Control is reported. The present data acquisition and transfer system in JT-60 control is basically composed of CAMAC devices. Since the system equipped with 16-bit microcomputers was manufactured more than ten years ago, the performance and program development environment of the system are apparently worse than those of modern 32-bit microcomputers. To improve these disadvantages, a new data acquisition and transfer system using VME-based 32-bit microcomputers and CAMAC drivers is under design. Corresponding to this design, a CAMAC handler, which runs on the microcomputer, for the VME based CAMAC driver was newly developed. Moreover, the functions of the driver and data transfer performance of the VME and CAMAC complex system were tested. The test results shown that the VME based microcomputer and CAMAC serial driver can be applied for the fast and reliable acquisition and transfer system for JT-60 control. (author)
23 CFR 650.209 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 650.209 Section 650.209 Highways FEDERAL..., STRUCTURES, AND HYDRAULICS Erosion and Sediment Control on Highway Construction Projects § 650.209 Construction. (a) Permanent erosion and sediment control measures and practices shall be established and...
Wang, Xue-Ping; Liu, Ya-Lan; Mei, Ling-Yun; He, Chu-Feng; Niu, Zhi-Jie; Sun, Jie; Zhao, Yu-Lin; Feng, Yong; Zhang, Hua
2018-05-01
Mutation in the gene encoding microphthalmia-associated transcription factor (MITF) lead to Waardenburg syndrome 2 (WS2), an autosomal dominantly inherited syndrome with auditory-pigmentary abnormalities, which is clinically and genetically heterogeneous. Haploinsufficiency may be the underlying mechanism for WS2. However, the mechanisms explaining the genotypic and phenotypic variations in WS2 caused by MITF mutations are unclear. A previous study revealed that MITF interacts with LEF-1, an important factor in the Wnt signaling pathway, to regulate its own transcription through LEF-1-binding sites on the MITF promoter. In this study, four different WS2-associated MITF mutations (p.R217I, p.R217G, p.R255X, p.R217del) that are associated with highly variable clinical features were chosen. According to the results, LEF-1 can activate the expression of MITF on its own, but MITF proteins inhibited the activation. This inhibition weakens when the dosage of MITF is reduced. Except for p.R217I, p.R255X, p.R217G, and p.R217del lose the ability to activate TYR completely and do not inhibit the LEF-1-mediated activation of the MITF-M promoter, and the haploinsufficiency created by mutant MITF can be overcome; correspondingly, the mutants' associated phenotypes are less severe than that of p.R217I. The dominant negative of p.R217del made it have a second-most severe phenotype. This study's data imply that MITF has a negative feedback loop of regulation to stabilize MITF gene dosage that involves the Wnt signaling pathway and that the interaction of MITF mutants with this pathway drives the genotypic and phenotypic differences observed in Waardenburg syndrome type 2 associated with MITF mutations.
Development of upgraded pellet injector for JT-60
International Nuclear Information System (INIS)
Onozuka, M.; Shimomura, T.; Tanaka, N.; Iwamoto, S.; Hashiri, N.; Oda, Y.; Minami, M.; Hiratsuka, H.; Kawasaki, K.; Takatsu, H.; Shimizu, M.
1989-01-01
The pneumatic 4-shot pellet injector had been in use for JT-60 (JAERI Tokamak-60) contributing to plasma studies in 1988. It could propel the pellets up to 1.6 km/sec at 50 bar propellant gas. In 1989, the new gun assembly has been reinstalled in the upgraded system to provide higher performance and reliability. The supply pressure of the propellant gas is to be raised to 100 bar to obtain higher pellet velocity up to 2.3 km/sec. The device is now in use for JT-60, and is expected to contribute to further plasma studies. In this paper the outline of features and performance of the device is presented. 5 refs., 9 figs
Energetic particle physics in JT-60U and JFT-2M
Energy Technology Data Exchange (ETDEWEB)
Shinohara, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Takechi, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ishikawa, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kusama, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tsuzuki, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Urata, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kawashima, H [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tobita, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Fukuyama, A [Department of Nuclear Engineering, Kyoto University, 606-8501, (Japan); Cheng, C Z [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Darrow, D S [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Kramer, G J [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Gorelenkov, N N [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Nazikian, R [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Todo, Y [National Institute for Fusion Science, Oroshi-cho, Toki, Gifu, 509-5292, (Japan); Miura, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ozeki, T [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan)
2004-07-01
Recent energetic particle physics research in JT-60U and JFT-2M is reported. Alfven eigenmodes (AEs) are investigated in reversed-shear (RS) plasmas in JT-60U where frequency sweeping (FS) modes are observed to follow the q-profile evolution. The RS-induced AE model can explain the FS of the modes within the context of an evolving q-profile. Enhanced energetic ion transport is also investigated with the appearance of modes in the toroidicity-induced AE range of frequency in JT-60U using a multi-channel neutron profile monitor and in JFT-2M using a lost ion probe. Additionally, the ripple loss in the complex toroidal field ripple due to ferritic steel inserts in JFT-2M is shown and compared with model analysis. The simulation code developed to predict ripple loss in JFT-2M will be of use in estimating the heat flux in the complex ripple field of a future device such as ITER.
The plasma movie database system for JT-60
International Nuclear Information System (INIS)
Sueoka, Michiharu; Kawamata, Yoichi; Kurihara, Kenichi; Seki, Akiyuki
2007-01-01
The real-time plasma movie with the computer graphics (CG) of plasma shape is one of the most effective methods to know what discharge have been made in the experiment. For an easy use of the movie in the data analysis, we have developed the plasma movie database system (PMDS), which automatically records plasma movie according to the JT-60 discharge sequence, and transfers the movie files on request from the web site. The file is compressed to about 8 MB/shot small enough to be transferred within a few seconds through local area network (LAN). In this report, we describe the developed system from the technical point of view, and discuss a future plan on the basis of advancing video technology
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Publication. 209.335 Section 209... ADMINISTRATIVE PROCEDURE § 209.335 Publication. (a) Section 4 of the Administrative Procedure Act requires publication of general notice of proposed rule making in the Federal Register (unless all persons subject...
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Hearing. 2200.209 Section 2200.209 Labor Regulations... Simplified Proceedings § 2200.209 Hearing. (a) Procedures. As soon as practicable after the conclusion of the pre-hearing conference, the Judge will hold a hearing on any issue that remains in dispute. The...
Numerical analysis of gas puff modulation experiment on JT-60U
International Nuclear Information System (INIS)
Nagashima, Keisuke; Sakasai, Akira
1992-03-01
In tokamak transport physics, source modulation experiments are one of the most effective methods. For an analysis of these modulation experiments, a simple numerical method was developed to solve the general transport equations. This method was applied to gas puff modulation experiments on JT-60U. From the comparison between the measured and calculated density perturbations, it was found that the particle diffusion coefficient is about 0.8 m 2 /sec in the edge region and 0.1-0.2 m 2 /sec in the central region. (author)
Ion transport analysis of a high beta-poloidal JT-60U discharge
International Nuclear Information System (INIS)
Horton, W.; Tajima, T.; Dong, J.-Q.; Kim, J.-Y.; Kishimoto, Y.
1997-01-01
The high beta-poloidal discharge number 17110 in JT-60U (JT-60 Team, IAEA, Vienna, 1993) that developes an internal transport barrier is analysed for the transport of ion energy and momentum. First, the classical ion temperature gradient stability properties are calculated in the absence of sheared plasma flows to establish the L-mode transport level prior to the emergence of the transport barrier. Then the evolving toroidal and poloidal velocity profiles reported by Koide et al (1994 Phys. Rev. Lett. 72 3662) are used to show how the sheared mass flows control the stability and transport. Coupled energy-momentum transport equations predict the creation of a transport barrier. The balance of the steep ion temperature gradient against the magnetic shear and sheared mass flow is calculated for the profiles in the 17110 discharge. (Author)
A new workstation based man/machine interface system for the JT-60 Upgrade
International Nuclear Information System (INIS)
Yonekawa, I.; Shimono, M.; Totsuka, T.; Yamagishi, K.
1992-01-01
Development of a new man/machine interface system was stimulated by the requirements of making the JT-60 operator interface more 'friendly' on the basis of the past five-year operational experience. Eleven Sun/3 workstations and their supervisory mini-computer HIDIC V90/45 are connected through the standard network; Ethernet. The network is also connected to the existing 'ZENKEI' mini-computer system through the shared memory on the HIDIC V90/45 mini-computer. Improved software, such as automatic setting of the discharge conditions, consistency check among the related parameters and easy operation for discharge result data display, offered the 'user-friendly' environments. This new man/machine interface system leads to the efficient operation of the JT-60. (author)
Review of JT-60U experimental results from March to October, 1991
International Nuclear Information System (INIS)
1992-06-01
Experimental results achieved in the initial operation of JT-60U are described in this paper. Experiments of JT-60U were initiated in March 1991, and deuterium experiments started in the middle of July. Multivariable non-interacting control, H-mode experiments, the high-q and high-β p regime with hot ion enhanced confinement, the divertor heat flux, etc. are reported. Achieved values of the first experiment of the JT-60U LHCD in 1991 were P LH = 1.5 MW, driven current I RF = 2MA, current drive efficiency η CD (=n-bar e R p I RF /P LH ) = 0.25 x 10 20 m -2 A/W and current driven product CDP(=n-bar e R p I RF ) = 3 x 10 20 m -2 MA. (J.P.N.)
Wijnen, Hugo; Salemink, Dayenne; Roovers, Lian; Taekema, Diana; de Boer, Hans
2015-05-01
Supplementation of cholecalciferol 800 IU daily appears to be insufficient to raise vitamin D levels to >75 nmol/l in nursing home (NH) patients. Our objective was to compare the efficacy of an individualized cholecalciferol loading dose (LD) regimen and a daily dose (DD) regimen of cholecalciferol 800 IU in reaching 25-OH vitamin D (25OHD) levels >75 nmol/l. A total of 30 NH patients with 25OHD levels 50 nmol/l were included. Patients were randomized using the minimization method in the LD or DD group. The cholecalciferol LD, calculated with an algorithm based on serum 25OHD level and body weight, was administered in divided doses of 50,000 IU twice a week, followed by a monthly maintenance dose of either 50,000 or 25,000 IU. The DD regimen consisted of cholecalciferol 800 IU daily for 26 weeks. Serum 25OHD, calcium, creatinine, phosphate, and parathyroid hormone were measured, and 2-minute walking test, handgrip strength, and timed get up and go test were assessed at baseline (T 0), after 5 weeks (T 5), 12 weeks (T 12), and 26 weeks (T 26). The primary endpoint was the percentage of patients with 25OHD levels >75 nmol/l at T 5. Secondary endpoints were the proportion of patients with 25OHD levels >75 nmol/l at T 26, safety of LD regimen, and improvement of performance tests with normalization of vitamin D levels. Median baseline 25OHD levels (interquartile range) were comparable between the 14 DD and 16 LD patients: 20.9 (15.9-29.6) and 21.7 (16.4-32.8) nmol/l, respectively. Levels of 25OHD >75 nmol/l at T 5 were reached in 79 % of the 14 LD patients, but in none of the 13 DD patients (p 75 nmol/l were reached in 83 % of the 12 LD patients and in 30 % of the ten DD patients (p tests was observed. In NH patients with severe 25OHD deficiency, an individualized calculated cholecalciferol LD is likely to be superior to a DD of cholecalciferol 800 IU in terms of the ability to rapidly normalize vitamin D levels.
Czech Academy of Sciences Publication Activity Database
van Dijk, P.; Kirschner, Jan; Štěpánek, Jan; Baitulin, I. O.; Černý, Tomáš
2010-01-01
Roč. 83, č. 2 (2010), s. 217-219 ISSN 1613-9216 R&D Projects: GA MŠk 7E09053 Institutional research plan: CEZ:AV0Z60050516 Keywords : Taraxacum * species * overcollecting Subject RIV: EF - Bot anics Impact factor: 0.391, year: 2010
Divertor pumping system with NBI cryopump for JT-60
International Nuclear Information System (INIS)
Akino, Noboru; Kuriyama, Masaaki; Ohga, Tokumichi; Seki, Hiroshi; Tanai, Yutaka
1998-08-01
The pumping system for JT-60 W-shape divertor with the NBI cryopump have been developed. The pumping speed achieved in the divertor region was 13-15 m 3 /s for deuterium gas with three units of the NBI cryopumps. In a simulation experiment of helium ash exhaust through the divertor, pumping of a mixed gas of helium and deuterium has been demonstrated using the NBI cryosorption pumps covered with an argon condensed layer. Control of neutral particle pressure in the divertor region became possible by having remodeled an aperture of the existing fast shutter, which is installed between the JT-60 vacuum vessel and NBI beam-line, to be regulated. (author)
Radioisotope space power generator annual report, July 1, 1974--June 30, 1975
International Nuclear Information System (INIS)
Elsner, N.B.; Chin, J.; Staley, H.G.
1976-01-01
The Isotec Technology Program for FY-75 concentrated on materials development efforts in two areas: TPM-217 P-type material and SiGe technology. TPM-217 P-type material is a 3M proprietary thermoelectric material whose principal components are Cu, Ag, and Se. The usefulness of TPM-217 P-type selenide in thermoelectric converters depends on its dimensional, electrical, and thermal stability at high temperature and its compatibility with other converter component materials in a low-pressure environment. Experimental efforts were directed toward determining (1) the vapor species above TPM-217 from 700 0 to 1100 0 C, (2) the weight loss rate for TPM-217 at 900 0 C in vacuo, and (3) the stability of TPM-217 material in contact with Mo, Fe, 316 stainless steel, and pyrocarbon. The Si-Ge program is a continuation of the experimental work performed during FY-74. The development of coatings to suppress the vaporization of SiMo and SiGe continued. Techniques for applying ion-plated and chemical-vapor-deposited coatings of Si 3 N 4 and (Si,Al)N alloys on SiMo were examined. Methods of controlling morphology and the chemical composition of these coatings were developed. Rates of vaporization for coated samples at 1100 0 C were measured
: tous les projets | Page 217 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...
Adenomyosis uteri in infertile women: experience in a tropical community teaching hospital
International Nuclear Information System (INIS)
Adesiyun, A.G.; Kolawole, A.; Samaila, M.O.
2008-01-01
To determine the demographic pattern and clinical presentation of 23 infertile women with intraoperative diagnosis of adenomyosis followed by histopathologic confirmation. A review of 23 consecutive infertile women that underwent surgery due to preoperative misdiagnosis for uterine fibroids over a period of 5 years. The patients mean age was 37.3 years with age range of 26 to 47 years. Only five patients (21.7%) had delivered before. Eighteen patients (78.3%) had had abortion(s) in the past. Secondary infertility accounted for 78.3% and 21.7% had primary infertility. Past gynaecological procedures included dilatation and curettage or manual vacuum aspiration in 17 (73.9%) patients, previous adhesiolysis for uterine synaechiae in 3 (13.1%) patients and past history of myomectomy in 5 (21.7%) patients. Preoperative hysterosalpingogram showed only 2 patients (8.7%) with bilateral tubal patency and 17 patients (73.9%) had bilateral tubal blockage. Unilateral patency of the fallopian tube was observed in 4 (17.4%) patients. Amongst patients with bilateral tubal blockage, cornual blockages were mostly encountered in 15 (88.2%) of the 17 patients. The modes of clinical presentation were abdominopelvic mass 100%, dymenorrhoea 82.6%, menorrhagia 60.9%, dyspareunia 47.8% and metrorrhagia in 34.8% of cases. Intraoperatively adenomyosis encountered were diffuse adenomyosis in 13 (56.5%) patients, multiple focal adenomyosis in 7 (30.4%) patients and unifocal adenomyosis in 3 (13.1%) patients. Co-existing uterine fibroid were found in 17 (73.9%) of the 23 patients. Two patients (8.7%) had coexisting endometriosis. At surgery, significant pelvic adhesion was encountered in 7 (30.4%) patients. In infertile women, adenomyosis is significantly associated with proximal tubal occlusion and tends to co-exist with insignificant uterine fibroids. (author)
International Nuclear Information System (INIS)
Salam, A.; Sezgin, E.
1984-10-01
SU(2) gauged N=2 supergravity in d=8 is constructed by generalized dimensional reduction of d=11 supergravity on SU(2) group manifold. The relation between the field equations of the d=8 and those of d=11 supergravities is established. As a byproduct of this, it is shown that certain compactifications of d=11 supergravity give rise to anti-de Sitter space-time (AdS)xS 4 or AdSxCP 2 (with or without SU(2) instanton) or AdSxS 2 xS 2 compactifications of d=8 supergravity. The latter two solutions have no supersymmetry, while AdSxS 4 has N=0 or N=1 supersymmetry. (author)
Conceptual design of JT-60SA cryostat
International Nuclear Information System (INIS)
Shibama, Y.K.; Sakurai, S.; Masaki, K.; Sukekawa, A.M.; Kaminaga, A.; Sakasai, A.; Matsukawa, M.
2008-01-01
This paper describes the conceptual design of cryostat for the JT-60SA, which is a research device for the commercial production of electricity from the controlled fusion reaction in the future. JT-60SA is designed to be a fully superconducting device and cryostat is one of the main components to allow the normal operation. Cryostat covers up the tokamak device, which is 15 m of total height and 7 m of radius, and supports the total weight of 25 MN. Cryostat components consist of vessel body, gravity support and auxiliary systems, such as 80 K thermal shield and vacuum exhaust. The functions required of cryostat are these three, thermal insulation for superconducting magnets, gravity support for the tokamak device, and bio-shielding. The design conditions for each cryostat component are outlined and the features of auxiliary systems such as capacity of vacuum exhaust related to 80 K thermal shield design are summarized
Sample Results from the Interim Salt Disposition Program Macrobatch 8 Tank 21H Qualification Samples
Energy Technology Data Exchange (ETDEWEB)
Peters, T. B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Washington, A. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2015-01-01
Savannah River National Laboratory (SRNL) analyzed samples from Tank 21H in support of qualification of Macrobatch (Salt Batch) 8 for the Interim Salt Disposition Program (ISDP). An Actinide Removal Process (ARP) and several Extraction-Scrub- Strip (ESS) tests were also performed. This document reports characterization data on the samples of Tank 21H as well as simulated performance of ARP and the Modular Caustic Side Solvent Extraction (CSSX) Unit (MCU). No issues with the projected Salt Batch 8 strategy are identified. A demonstration of the monosodium titanate (MST) (0.2 g/L) removal of strontium and actinides provided acceptable average decontamination factors for plutonium of 2.62 (4 hour) and 2.90 (8 hour); and average strontium decontamination factors of 21.7 (4 hour) and 21.3 (8 hour). These values are consistent with results from previous salt batch ARP tests. The two ESS tests also showed acceptable performance with extraction distribution ratios (D(Cs)) values of 52.5 and 50.4 for the Next Generation Solvent (NGS) blend (from MCU) and NGS (lab prepared), respectively. These values are consistent with results from previous salt batch ESS tests. Even though the performance is acceptable, SRNL recommends that a model for predicting extraction behavior for cesium removal for the blended solvent and NGS be developed in order to improve our predictive capabilities for the ESS tests.
Sample results from the Interim Salt Disposition Program Macrobatch 8 Tank 21H qualification samples
Energy Technology Data Exchange (ETDEWEB)
Peters, T. B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Washington, II, A. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2015-01-13
Savannah River National Laboratory (SRNL) analyzed samples from Tank 21H in support of qualification of Macrobatch (Salt Batch) 8 for the Interim Salt Disposition Program (ISDP). An Actinide Removal Process (ARP) and several Extraction-Scrub-Strip (ESS) tests were also performed. This document reports characterization data on the samples of Tank 21H as well as simulated performance of ARP and the Modular Caustic Side Solvent Extraction (CSSX) Unit (MCU). No issues with the projected Salt Batch 8 strategy are identified. A demonstration of the monosodium titanate (MST) (0.2 g/L) removal of strontium and actinides provided acceptable average decontamination factors for plutonium of 2.62 (4 hour) and 2.90 (8 hour); and average strontium decontamination factors of 21.7 (4 hour) and 21.3 (8 hour). These values are consistent with results from previous salt batch ARP tests. The two ESS tests also showed acceptable performance with extraction distribution ratios (D(Cs)) values of 52.5 and 50.4 for the Next Generation Solvent (NGS) blend (from MCU) and NGS (lab prepared), respectively. These values are consistent with results from previous salt batch ESS tests. Even though the performance is acceptable, SRNL recommends that a model for predicting extraction behavior for cesium removal for the blended solvent and NGS be developed in order to improve our predictive capabilities for the ESS tests.
International Nuclear Information System (INIS)
Li, Jing; Zhang, Wei; Chen, Lin; Liang, Jun; Lin, Kuangfei
2015-01-01
BDE209 and Pb are ubiquitous contaminants at e-waste recycling sites (EWRSs). This study aimed to determine acute and sub-acute toxicity to earthworm Eisenia fetida induced by BDE209 and Pb in natural soil. Results demonstrated that the inhibition of Pb on growth and reproduction of earthworms followed a dose-dependent pattern. Earthworms exposed to 100 mg kg −1 of BDE209 displayed avoidance responses, while the soil indicated a more obvious decline of habitat function with the increase of Pb level. Comet assay suggested that increasing concentrations of Pb exposure resulted in a gradual increase in the tail length and olive tail moment, which meant that the degree of DNA damage was promoted. BDE209 addition could reduce the damage; therefore the joint effects of both chemicals showed antagonistic. These results revealed that joint exposure (BDE209-Pb) could elicit pronounced biochemical and physiological responses in earthworms, and the DNA damage might be potential molecular biomarker of the two pollutants. - Highlights: • 48 h and 14 d LC 50 values of BDE209 were lower than that of Pb, suggesting Pb was more toxic to earthworms. • Inhibition of Pb on the growth and reproduction of earthworms followed certain dose–response relationships. • Joint effects of BDE209 and Pb on earthworms might be antagonistic in comet assay. - This study demonstrated the biological effects of BDE209-Pb joint exposure on earthworm Eisenia fetida in a soil system for the first time.
International Nuclear Information System (INIS)
Itoh, Yasuhiro; Kurihara, Kenichi; Kimura, Toyoaki.
1987-07-01
The JT-60 central control system, ''ZENKEI'' collects the control and instrumentation data relevant to discharge and device status data for plant monitoring. The former of the engineering data amounts to about 3 Mbytes per shot of discharge. The ''ZENKEI'' control system which consists of seven minicomputers for on-line real-time control has little performance of handling such a large amount of data for physical and engineering analysis. In order to solve this problem, it was planned to establish the experimental database on the Front-end Processor (FEP) of general purpose large computer in JAERI Computer Center. The database management system (DBMS), therefore, has been developed for creating the database during the shot interval. The engineering data are shipped up from ''ZENKEI'' to FEP through the dedicated communication line after the shot. The hierarchical data model has been adopted in this database, which consists of the data files with tree structure of three keys of system, discharge type and shot number. The JT-60 DBMS provides the data handling packages of subroutines for interfacing the database with user's application programs. The subroutine packages for supporting graphic processing and the function of access control for security of the database are also prepared in this DBMS. (author)
JT-60 configuration parameters for feedback control determined by regression analysis
Energy Technology Data Exchange (ETDEWEB)
Matsukawa, Makoto; Hosogane, Nobuyuki; Ninomiya, Hiromasa (Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment)
1991-12-01
The stepwise regression procedure was applied to obtain measurement formulas for equilibrium parameters used in the feedback control of JT-60. This procedure automatically selects variables necessary for the measurements, and selects a set of variables which are not likely to be picked up by physical considerations. Regression equations with stable and small multicollinearity were obtained and it was experimentally confirmed that the measurement formulas obtained through this procedure were accurate enough to be applicable to the feedback control of plasma configurations in JT-60. (author).
JT-60 configuration parameters for feedback control determined by regression analysis
International Nuclear Information System (INIS)
Matsukawa, Makoto; Hosogane, Nobuyuki; Ninomiya, Hiromasa
1991-12-01
The stepwise regression procedure was applied to obtain measurement formulas for equilibrium parameters used in the feedback control of JT-60. This procedure automatically selects variables necessary for the measurements, and selects a set of variables which are not likely to be picked up by physical considerations. Regression equations with stable and small multicollinearity were obtained and it was experimentally confirmed that the measurement formulas obtained through this procedure were accurate enough to be applicable to the feedback control of plasma configurations in JT-60. (author)
Czech Academy of Sciences Publication Activity Database
Setničková, Kateřina; Petričkovič, Roman; Řezníčková Čermáková, Jiřina; Uchytil, Petr
2016-01-01
Roč. 58, JAN 2016 (2016), s. 49-56 ISSN 1876-1070 R&D Projects: GA ČR GA104/09/1165 Institutional support: RVO:67985858 Keywords : membrane separation * pervaporation * propanol/water mixture Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.217, year: 2016
Requirements for tokamak remote operation: Application to JT-60SA
International Nuclear Information System (INIS)
Innocente, Paolo; Barbato, Paolo; Farthing, Jonathan; Giruzzi, Gerardo; Ide, Shunsuke; Imbeaux, Frédéric; Joffrin, Emmanuel; Kamada, Yutaka; Kühner, Georg; Naito, Osamu; Urano, Hajime; Yoshida, Maiko
2015-01-01
Highlights: • We analyzed the data management system (DMS) appropriate for international collaboration. • We define the principal requirements for all components of the DMS. • We evaluated application of DMS requirements to the JT-60SA experiment. • We evaluated the role network bandwidth and time delay between EU and Japan. - Abstract: Remote operation and data analysis are becoming key requirements of any fusion devices. In this framework a well-conceived data management system integrated with a suite of analysis and support tools are essential components for an efficient remote exploitation of any fusion device. The following components must be considered: data archiving data model architecture; remote data and computers access; pulse schedule, data analysis software and support tools; remote control room specifications and security issues. The definition of a device-generic data model plays also important role in improving the ability to share solution and reducing learning time. As for the remote control room, the implementation of an Operation Request Gateway has been identified as an answer to security issues meanwhile remotely proving all the required features to effectively operate a device. Previous requirements have been analyzed for the new JT-60SA tokamak device. Remote exploitation is paramount in the JT-60SA case which is expected to be jointly operated between Japan and Europe. Due to the geographical distance of the two parties an optimal remote operation and remote data-analysis is considered as a key requirement in the development of JT-60SA. It this case the effects of network speed and delay have been also evaluated and tests have confirmed that the performance can vary significantly depending on the technology used.
Requirements for tokamak remote operation: Application to JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Innocente, Paolo, E-mail: paolo.innocente@igi.cnr.it [Consorzio RFX, Corso Stati Uniti 4, 35127 Padova (Italy); Barbato, Paolo [Consorzio RFX, Corso Stati Uniti 4, 35127 Padova (Italy); Farthing, Jonathan [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Giruzzi, Gerardo [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Ide, Shunsuke [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan); Imbeaux, Frédéric; Joffrin, Emmanuel [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Kamada, Yutaka [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan); Kühner, Georg [Max-Planck-Institute for Plasma Physics, EURATOM Association, Wendelsteinstr. 1, 17491 Greifswald (Germany); Naito, Osamu; Urano, Hajime; Yoshida, Maiko [Japan Atomic Energy Agency, Naka, Ibaraki-ken 311-0193 (Japan)
2015-10-15
Highlights: • We analyzed the data management system (DMS) appropriate for international collaboration. • We define the principal requirements for all components of the DMS. • We evaluated application of DMS requirements to the JT-60SA experiment. • We evaluated the role network bandwidth and time delay between EU and Japan. - Abstract: Remote operation and data analysis are becoming key requirements of any fusion devices. In this framework a well-conceived data management system integrated with a suite of analysis and support tools are essential components for an efficient remote exploitation of any fusion device. The following components must be considered: data archiving data model architecture; remote data and computers access; pulse schedule, data analysis software and support tools; remote control room specifications and security issues. The definition of a device-generic data model plays also important role in improving the ability to share solution and reducing learning time. As for the remote control room, the implementation of an Operation Request Gateway has been identified as an answer to security issues meanwhile remotely proving all the required features to effectively operate a device. Previous requirements have been analyzed for the new JT-60SA tokamak device. Remote exploitation is paramount in the JT-60SA case which is expected to be jointly operated between Japan and Europe. Due to the geographical distance of the two parties an optimal remote operation and remote data-analysis is considered as a key requirement in the development of JT-60SA. It this case the effects of network speed and delay have been also evaluated and tests have confirmed that the performance can vary significantly depending on the technology used.
Indian Academy of Sciences (India)
All reagents were purchased from TCI and Sigma Aldrich and used without further purification. All the products ... General procedure for the four component synthesis of compounds 13 and 14: A solution of 4-chloro-3-formyl coumarin (1 mmol), morpholine/ thiomorpholine (2 mmol) were refluxed for 2 min in benzene. To this ...
Czech Academy of Sciences Publication Activity Database
Ricard, Daniel; Zimmermann, F.; Heino, M.
2016-01-01
Roč. 547, April (2016), s. 211-217 ISSN 0171-8630 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : cannibalism * intra-specific competition * recruitment * population dynamics * Atlantic Ocean Subject RIV: EH - Ecology, Behaviour Impact factor: 2.292, year: 2016
Review of JT-60U experimental results in 1997
International Nuclear Information System (INIS)
Adachi, H.; Akasaka, H.; Akino, N.
1998-08-01
The JT-60U experiments in 1997 focused mainly on the steady-state tokamak research with the newly installed W-shaped pumped divertor and the negative ion based neutral beam (NNB) in addition to the existing profile and shape control techniques developed in JT-60U. In particular, the research on divertor physics was accelerated under the new divertor system with many of fine diagnostics: Detachment characteristics, pumping control, impurity control, recycling characteristics, etc. in the W-shaped divertor were investigated in detail. The main purpose of confinement and stability studies in 1997 was to improve steadiness of high confinement plasmas with the new divertor. Researches progressed also for the formation conditions of the internal and the surface transport barriers in the high-β p mode, the reversed shear mode and the H-mode. Toward the advanced feedback controls of multiple parameters, the JT-60U started new feedback controls of central line density and divertor neutral gas pressure in addition to the existing controls of off-axis line density, radiation power and neutron production rate. The JT-60U team also carefully studied characteristics of halo current during disruptions. Optimization of NNB operation progressed steadily and injection power increased up to 4.2MW. The NNB-driven current was identified directly from the internal magnetic measurement and driven current profile was confirmed to be consistent with the ACCOME calculation. The current profile control with LHCD successfully sustained the internal transport barrier in reversed shear plasmas. Continuous TAE modes were observed with NNB for the first time as beam-driven TAE modes. (J.P.N.)
Review of JT-60U experimental results in 1997
Energy Technology Data Exchange (ETDEWEB)
Adachi, H.; Akasaka, H.; Akino, N. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment] [and others
1998-08-01
The JT-60U experiments in 1997 focused mainly on the steady-state tokamak research with the newly installed W-shaped pumped divertor and the negative ion based neutral beam (NNB) in addition to the existing profile and shape control techniques developed in JT-60U. In particular, the research on divertor physics was accelerated under the new divertor system with many of fine diagnostics: Detachment characteristics, pumping control, impurity control, recycling characteristics, etc. in the W-shaped divertor were investigated in detail. The main purpose of confinement and stability studies in 1997 was to improve steadiness of high confinement plasmas with the new divertor. Researches progressed also for the formation conditions of the internal and the surface transport barriers in the high-{beta}{sub p} mode, the reversed shear mode and the H-mode. Toward the advanced feedback controls of multiple parameters, the JT-60U started new feedback controls of central line density and divertor neutral gas pressure in addition to the existing controls of off-axis line density, radiation power and neutron production rate. The JT-60U team also carefully studied characteristics of halo current during disruptions. Optimization of NNB operation progressed steadily and injection power increased up to 4.2MW. The NNB-driven current was identified directly from the internal magnetic measurement and driven current profile was confirmed to be consistent with the ACCOME calculation. The current profile control with LHCD successfully sustained the internal transport barrier in reversed shear plasmas. Continuous TAE modes were observed with NNB for the first time as beam-driven TAE modes. (J.P.N.)
Valley Fever (Coccidioidomycosis) Statistics
... States, 1998-2012, MMWR 62(12);217-221. Valdivia L, Nix D, Wright M, Lindberg E, Fagan T, Lieberman D, et al. Coccidioidomycosis as a common cause of community-acquired pneumonia. Emerg Infect Dis. 2006 Jun;12(6):958-62. Chang DC, Anderson S, ...
JT-60U high performance regimes
International Nuclear Information System (INIS)
Ishida, S.
1999-01-01
High performance regimes of JT-60U plasmas are presented with an emphasis upon the results from the use of a semi-closed pumped divertor with W-shaped geometry. Plasma performance in transient and quasi steady states has been significantly improved in reversed shear and high- βp regimes. The reversed shear regime elevated an equivalent Q DT eq transiently up to 1.25 (n D (0)τ E T i (0)=8.6x10 20 m-3·s·keV) in a reactor-relevant thermonuclear dominant regime. Long sustainment of enhanced confinement with internal transport barriers (ITBs) with a fully non-inductive current drive in a reversed shear discharge was successfully demonstrated with LH wave injection. Performance sustainment has been extended in the high- bp regime with a high triangularity achieving a long sustainment of plasma conditions equivalent to Q DT eq ∼0.16 (n D (0)τ E T i (0)∼1.4x10 20 m -3 ·s·keV) for ∼4.5 s with a large non-inductive current drive fraction of 60-70% of the plasma current. Thermal and particle transport analyses show significant reduction of thermal and particle diffusivities around ITB resulting in a strong Er shear in the ITB region. The W-shaped divertor is effective for He ash exhaust demonstrating steady exhaust capability of τ He */τ E ∼3-10 in support of ITER. Suppression of neutral back flow and chemical sputtering effect have been observed while MARFE onset density is rather decreased. Negative-ion based neutral beam injection (N-NBI) experiments have created a clear H-mode transition. Enhanced ionization cross- section due to multi-step ionization processes was confirmed as theoretically predicted. A current density profile driven by N-NBI is measured in a good agreement with theoretical prediction. N-NBI induced TAE modes characterized as persistent and bursting oscillations have been observed from a low hot beta of h >∼0.1-0.2% without a significant loss of fast ions. (author)
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 240.209 Section 240.209 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.209 Safety. ...
Effect of decabromodiphenyl ether (BDE-209) on a soil-biota system: Role of earthworms and ryegrass.
Feng, Mingbao; He, Qun; Shi, Jiaqi; Qin, Li; Zhang, Xuesheng; Sun, Ping; Wang, Zunyao
2016-06-01
In the present study, the toxic effect of decabromodiphenyl ether (BDE-209), an important brominated fire retardant, on soil was evaluated by amending with different concentrations (0 mg/kg, 1 mg/kg, 10 mg/kg, and 500 mg/kg dry wt) for 40 d. The activities of 3 soil enzymes (urease, catalase, and alkaline phosphatase) were measured as the principal assessment endpoints. Meanwhile, the effects of natural environmental factors, such as light conditions and soil biota, on BDE-209 intoxication were studied. For the latter, 30 earthworms (Metaphire guillelmi) with fully matured clitella or ryegrass (Lolium perenne) with fully matured leaves were exposed in soil amended with BDE-209. The activities of the soil enzymes were adversely affected by BDE-209, especially for the high-concentration treatments, with greater adverse effects in the dark than in the light. The presence of earthworms reduced toxicity to BDE-209, whereas ryegrass did not. The calculated integrated biomarker response index, which provides a general indicator of the health status of test species by combining different biomarker signals, further validated these findings. Moreover, the antioxidant status (oxidant-antioxidant balance) of these 2 biota was assessed. Results indicated that BDE-209 significantly affected the activities of antioxidant enzymes (superoxide dismutase and catalase) and enhanced the levels of malondialdehyde in both species. The present study may facilitate a better understanding of the toxicity of BDE-209 toward the soil environment. Environ Toxicol Chem 2016;35:1349-1357. © 2015 SETAC. © 2015 SETAC.
Design study of a new P-NBI control system for 100-s injection in JT-60SA
International Nuclear Information System (INIS)
Honda, Atsushi; Okano, Fuminori; Shinozaki, Shinichi; Ooshima, Katsumi; Ikeda, Yoshitaka; Numazawa, Susumu
2007-03-01
The modification of the JT-60U to a fully superconducting coil tokamak, JT-60SA (Super Advanced), has been programmed as the satellite devise for the ITER (International Thermonuclear Experimental Reactor) and as the national centralized tokamak. The present positive-ion-based NBI system (P-NBI), which has been operated for 20 years and will be the main heating system on JT-60SA, is required to manage the long pulse injection extended from 30 s to 100 s at the power of 24 MW with 12 units. To realize such a requirement, the original control system handling more than 4000 digital data is to be fully remodeled. Design study of the new control system has been conducted from viewpoint of market availability, system extensibility, cost-effectiveness and independent development in programming. It has been concluded that a distributed control system using PLC (Programmable Logic Controller) could be applied to the large-scale control system for 100-s operations with satisfaction of the evaluation viewpoints. (author)
Goldsmith, I. M.
1981-01-01
The feasibility of the propfan relative to the turbofan is summarized, using the Douglas DC-9 Super 80 (DS-8000) as the actual operational base aircraft. The 155 passenger economy class aircraft (31,775 lb 14,413 kg payload), cruise Mach at 0.80 at 31,000 ft (8,450 m) initial altitude, and an operational capability in 1985 was considered. Three propfan arrangements, wing mounted, conventional horizontal tail aft mounted, and aft fuselage pylon mounted are selected for comparison with the DC-9 Super 80 P&WA JT8D-209 turbofan powered aircraft. The configuration feasibility, aerodynamics, propulsion, structural loads, structural dynamics, sonic fatigue, acoustics, weight maintainability, performance, rough order of magnitude economics, and airline coordination are examined. The effects of alternate cruise Mach number, mission stage lengths, and propfan design characteristics are considered. Recommendations for further study, ground testing, and flight testing are included.
Comparison of transient electron heat transport in LHD helical and JT-60U tokamak plasmas
International Nuclear Information System (INIS)
Inagaki, S.; Ida, K.; Tamura, N.; Shimozuma, T.; Kubo, S.; Nagayama, Y.; Kawahata, K.; Sudo, S.; Ohkubo, K.; Takenaga, H.; Isayama, A.; Takizuka, T.; Kamada, Y.; Miura, Y.
2005-01-01
Transient transport experiments are performed in plasmas with and without Internal Transport Barrier (ITB) on LHD and JT-60U. The dependence of χ e on electron temperature, T e , and electron temperature gradient, ∇T e , is analyzed by an empirical non-linear heat transport model. In plasmas without ITB, two different types of non-linearity of the electron heat transport are observed from cold/heat pulse propagation. The χ e depends on T e and ∇T e in JT-60U, while the ∇T e dependence is weak in LHD. Inside the ITB region, there is no or weak ∇T e dependence both in LHD and JT-60U. A cold pulse growing driven by the negative T e dependence of χ e is observed inside the ITB region (LHD) and near the boundary of the ITB region (JT-60U). (author)
Vitamin D Status in Small Vessel and Large Vessel Ischemic Stroke Patients: A Case–control Study
Directory of Open Access Journals (Sweden)
Navid Manouchehri
2017-01-01
Full Text Available Background: Vitamin D insufficiency is a globally widespread issue. Recent studies have reported a high prevalence of Vitamin D deficiency in Middle-East countries. Studies have shown negative effects of Vitamin D deficiency on endothelium and related diseases such as ischemic brain stroke. Here, we assessed Vitamin D status in patients with different types of ischemic brain stroke and control group. Materials and Methods: Seventy-five patients (49.3% small vessel, 50.7% large vessel and 75 controls, matched for age (68.01 ± 10.94 vs. 67.64 ± 10.24 and sex (42 male and 33 female were recruited. 25(OH D levels were measured by Chemiluminescence immunoassay. 25(OH D status was considered as severely, moderately, or mildly deficient and normal with 25(OH D levels of less than 5, 5-10, 10-16, and> 16 ng/ml, respectively. Results: Mean ± standard error concentration of 25(OH D in cases and controls were 17.7 ± 1.5 and 26.9 ± 1.6 (P = 0.0001, respectively. Mild, moderate, and severe Vitamin D deficiency were observed in 10.8%, 32.4%, 8.1% vs. 34.3%, 31.5%, 9.5% of small vessel and large vessel group, respectively. 21.7% of the controls were Vitamin D deficient. Vitamin D deficiency was significantly associated with higher risk for ischemic stroke, (P = 0.000, OR = 7.17, 95% confidence interval: 3.36–15.29. 25(OH D levels were significantly higher in control group comparing to small vessel (26.9 ± 1.6 vs. 20.59 ± 2.6 P < 0.05 and large vessel (26.9 ± 1.6 vs. 13.4 ± 1.3 P < 0.001 stroke patients. Small vessel group had significantly higher levels of Vitamin D than large vessel (P < 0.05. Conclusion: Vitamin D deficiency significantly increases the risk of ischemic stroke, favoring the types with the pathogenesis of large vessel strokes.
Pneumatic pellet injector for JT-60
International Nuclear Information System (INIS)
Onozuka, Masanori; Hiratsuka, Hajime; Kawasaki, Kouzo.
1990-01-01
The pneumatic 4-shot pellet injector has been installed and operated for JT-60 (JAERI Tokamak-60). The performance tests have proven that the device provides high speed pellets as planned. The maximum pellet velocity obtained in the hydrogen pellet tests is greater than 2.3km/s at 100 bar propellant gas. (author)
Pneumatic pellet injector for JT-60
Energy Technology Data Exchange (ETDEWEB)
Onozuka, Masanori (Mitsubishi Heavy Industries Ltd., Tokyo (Japan)); Hiratsuka, Hajime; Kawasaki, Kouzo
1990-11-01
The pneumatic 4-shot pellet injector has been installed and operated for JT-60 (JAERI Tokamak-60). The performance tests have proven that the device provides high speed pellets as planned. The maximum pellet velocity obtained in the hydrogen pellet tests is greater than 2.3km/s at 100 bar propellant gas. (author).
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.209 Section 868.209 Agriculture... Application of Standards § 868.209 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved devices, and...
20 CFR 217.8 - When one application satisfies the filing requirement for other benefits.
2010-04-01
.... Therefore a claimant does not need to file another application to be entitled to any of the following types of benefits: (a) An employee age annuity if— (1) The employee's application for a disability annuity... (2) The employee is entitled to a disability annuity in the month before the month he or she is 65...
A tale of three cities: Insight into the impacts of holiday rentals in ...
African Journals Online (AJOL)
In Paris, the rented accommodation spend by tourists is estimated to be as much as €217 140 000. Côte d'Azur in rented properties generates an average accommodation expenditure of €105 840 000, and in Haute-Savoie generated a direct accommodation spend of €29 148 000. Keywords: vacation rentals, Paris, Côte ...
International Nuclear Information System (INIS)
Kawano, Y.; Yoshino, R.; Neyatani, Y.; Nakamura, Y.; Tokuda, S.; Tamai, H.
2002-01-01
Intensive studies on the physics of disruptions and developments of avoidance/mitigation methods of disruption-related phenomena have being carried out in JT-60U. The characteristics of the disruption sequence were well understood from the observation of the relationship between the heat pulse onto divertor plates during thermal quench and the impurity influx into the plasma, which determined the speed of the following current quench. A fast shutdown was first demonstrated by injecting impurity ice pellets to the plasma and intensively reducing the heat flux on first wall. The halo current and its toroidal asymmetry were precisely measured, and the halo current database was made for ITER in a wide parameter range. It was found that TPF x I h /I p0 was 0.52 at the maximum in a large tokamak like the JT-60U, whereas the higher factor of 0.75 had been observed in medium-sized tokamaks such as Alcator C-Mod and ASDEX-Upgrade. The vertical displacement event (VDE) at the start of the current quench was carefully investigated, and the neutral point where the VDE hardly occurs was discovered. MHD simulations clarified the onset mechanisms of the VDE, in which the eddy current effect of the up-down asymmetric resistive shell was essential. The real-time Z j measurement was improved for avoiding VDEs during slow current quench, and plasma-wall interaction was avoided by a well-optimized plasma equilibrium control. Magnetic fluctuations that were spontaneously generated at the disruption and/or enhanced by the externally applied helical field have been shown to avoid the generation of runaway electrons. Numerical analysis clarified an adequate rate of collisionless loss of runaway electrons in turbulent magnetic fields, which was consistent with the avoidance of runaway electron generation by magnetic fluctuations observed in JT-60U. Once generated, runaway electrons were suppressed when the safety factor at the plasma surface was reduced to 3 or 2
47 CFR 13.209 - Examination procedures.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Examination procedures. 13.209 Section 13.209 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL RADIO OPERATORS Examination System § 13.209 Examination procedures. (a) Each examination for a commercial radio operator license must be administered at a...
Braem, G; Stijlemans, B; Van Haken, W; De Vliegher, S; De Vuyst, L; Leroy, F
2014-05-01
To explore antibacterial activities of coagulase-negative staphylococci (CoNS) from teat apices of dairy cows towards mastitis-causing pathogens. Of 254 CoNS, 38 displayed bacteriocin-like activity after a first screening. Seven of these strains displayed activity against at least one mastitis-related pathogen (Streptococcus uberis, Streptococcus dysgalactiae and Staphylococcus aureus). Staphylococcus chromogenes L217 displayed the strongest inhibitory effect, being active against all tested mastitis-related pathogens and most tested CoNS. Based on cation exchange and reversed-phase chromatography, in addition to N-terminal Edman degradation and PCR, the antibacterial peptide was identified as a nukacin-type bacteriocin and named nukacin L217. Although staphylococcal bacteriocins are generally found in the cell-free supernatants of liquid cultures, Staph. chromogenes L217 only led to detectable activity when grown on agar medium. Bacteriocin-like activities are not uncommon among CoNS from teat apices and may inhibit mastitis-causing pathogens, as found for nukacin L217 production by Staph. chromogenes L217. Nukacin L217 is the first identified bacteriocin of the species Staph. chromogenes and displays unusual production kinetics, that is, requiring surface growth of its producer. The fact that nukacins are produced by different CoNS species suggests a role in the teat skin ecosystem. © 2014 The Society for Applied Microbiology.
Review of JT-60 experiment (March 1986)
International Nuclear Information System (INIS)
1986-11-01
Results of JT-60 experiment with ohmic heating in March 1986 are summarized. A maximum plasma current of 2 MA, an average plasma density of 5.7 x 10 19 m -3 and energy confinement time of 0.4 - 0.5 sec were obtained. Detailed characteristics of ohmic plasmas are discussed. (author)
Publications | Page 217 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity ... Through books, articles, research publications, and studies, we aim to widen the ... Case study : SIRCA; building evaluation capacity - a review of awarding, ... Behind the Scenes at a Climate Change Knowledge Sharing Network: IDS ...
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Delegation. 209.2 Section 209.2 Energy DEPARTMENT OF ENERGY OIL INTERNATIONAL VOLUNTARY AGREEMENTS General Provisions § 209.2 Delegation. To the extent otherwise permitted by law, any authority, duty, or responsibility vested in DOE or the Administrator under...
47 CFR 53.209 - Biennial audit.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Biennial audit. 53.209 Section 53.209... PROVISIONS CONCERNING BELL OPERATING COMPANIES Separate Affiliate; Safeguards § 53.209 Biennial audit. (a) A... obtain and pay for a Federal/State joint audit every two years conducted by an independent auditor to...
Valor de la laparoscopia en las enfermedades de la cavidad abdominal
Directory of Open Access Journals (Sweden)
Milton Argüello
1972-07-01
Full Text Available Se practicaron 223 Laparoscopias de las cuales se analizan 217: 115 en pacientes de sexo femenino, y 102 en pacientes de sexo masculino, con edades entre 13 y 80 años. De los 217 exámenes estudiados, en 208 (95.8% se encontraron alteraciones patológicas con predominio de cirrosis, carcinoma de vías biliares y lesiones metastásicas a hígado. Se puntualiza la utilidad de la endoscopia en los diferentes tipos de lesiones de la cavidad peritoneal, las que se ilustran con imágenes fotográficas de casos representativos. Se presentaron cuatro (4 complicaciones que evolucionaron satisfactoriamente.
Publications | Page 217 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Knowledge integration and the adoption of new agricultural technologies: Kenyan perspectives (restricted access). The study aims to identify and better understand the barriers to knowledge integration for improved agricultural technologies and their adoption. Results suggest a potential link between farmers'' levels of ...
Motorcycle limb injuries in a developing Country | Oluwadiya | West ...
African Journals Online (AJOL)
42.2% were due to collision with automobiles, 22% pedestrian while 8.7% were collisions between motorcycles. The use of protective/safety devices was practically non-existent. Seventy-six (66.1%) patients had lower limbs injuries, 25 (21.7%) patients had upper limb injuries while the remaining 14 (12.2%) injured both ...
14 CFR 120.217 - Tests required.
2010-01-01
... best available information at the time of the determination, that the covered employee's performance... involving the performance of safety-sensitive functions). (2) You must treat all safety-sensitive employees... employee for alcohol if that employee's performance of a safety-sensitive function either contributed to...
Publications | Page 217 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
As reliable and timely health information is essential for public health action and ... proposals from the findings towards revising and developing the livelihoods inquiry. ... Kebijakan kawasan tanpa rokok : peluang dan hambatan (restricted access) ... This case study provides a summary of the Utilization Focused Evaluation ...
Erectile dysfunction and type 2 diabetes mellitus in northern Pakistan
International Nuclear Information System (INIS)
Ahmed, I.; Anwar, E.; Ali, S.S.; Ali, A.
2013-01-01
Objective: To determine the frequency of erectile dysfunction in married male Type-2 diabetic patients. Methods: The cross-sectional observational study was carried out at the Endocrinology, Diabetes and Metabolic Diseases Unit Hayatabad Medical Complex, Peshawar, from July 2011 to Apr 2012, comprising 217 male married Type-2 diabetic patients. Serum samples were assayed for blood glucose, lipid profile and glycated haemoglobin A1c. Body mass index and waist-to-hip ratio was calculated. Erectile dysfunction was assessed by Sexual Health Inventory for Men questionnaire. SPSS 18 was used for statistical analysis. Results: A total of 217 patients were initially interviewed. The mean age was 43.1+-8.160 years. The frequency of drectile dysfunction increased with age, duration of patients and increased body mass index. Overall, 6 (2.8%) patients had no erectile dysfunction, 37 (17.1%) had mild, 82 (37.8%) mild to moderate; 47 (21.7%) moderate; and 45 (20.7%) severe. Higher HbA1c levels and atherogenic dyslipidaemia were associated with erectile dysfunction. Conclusion: Poor glycaemic control was associated with increased erectile dysfunction risk. Duration of diabetes, older age, increased body mass index are associated with increased incidence of the condition in patients with diabetes. Intensive lifestyle changes in the beginning can add to the better management of Type-2 diabetes and prevention of erectile dysfunction. (author)
22 CFR 217.5 - Assurances required.
2010-04-01
... benefits. (2) In the case of Federal financial assistance extended to provide personal property, the... or recording this transfer shall contain a covenant running with the land to assure nondiscrimination... services or benefits. (2) Where no transfer of property is involved but property is purchased or improved...
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit. 941.209 Section 941.209... HOUSING DEVELOPMENT PHA Eligibility and Program Requirements § 941.209 Audit. All PHAs that receive funds under this part for the development of low-income housing shall comply with audit requirements in 24 CFR...
2010-10-01
... performance of a job order shall vest in the Government upon delivery at the location specified for the performance of the work. (b) Upon completion of the job order, or with the approval of the Contracting Officer during performance of the job order, all Contractor-furnished materials and equipment not incorporated in...
Impurity and particle recycling reduction by boronization in JT-60U
International Nuclear Information System (INIS)
Higashijima, S.; Sugie, T.; Kubo, H.; Tsuji, S.; Shimada, M.; Asakura, N.; Hosogane, N.; Kawano, Y.; Nakamura, H.; Itami, K.; Sakasai, A.; Shimizu, K.; Ando, T.; Saidoh, M.
1995-01-01
In JT-60U boronization using decaborane was carried out. Boronization reduced the oxygen impurity in OH discharges and shortened the wall conditioning after the vacuum vessel vent and consequently enabled JT-60U to produce clean plasmas easily except for NB heated plasmas. After boronization, particle recycling was reduced drastically in OH and NB discharges. High confinement plasmas were obtained including high β p mode and H-mode discharges. In the latest boronization part of divertor plates were replaced with B 4 C coated tiles with a B 4 C thickness similar 300 μm. After introducing B 4 C divertor tiles, an explosive generation of boron particles from the tiles was observed. By the combined effects of boronization with decaborane and boron generation from B 4 C tiles, oxygen impurity was so low that oxygen line signals were reduced to noise levels after the latest boronization. On the other hand, boron burst from the B 4 C tiles restricted the operation of JT-60U. ((orig.))
48 CFR 252.217-7007 - Payments.
2010-10-01
... Officer shall approve progress payments based on the value, computed on the price of the job order, of... Contracting Officer may require. (c) The Government will retain until final completion and acceptance of all... direct that progress payments be based on the price of the job order as adjusted as a result of change...
49 CFR 190.209 - Response options.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Response options. 190.209 Section 190.209 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PROCEDURES Enforcement § 190.209 Response options. Within 30 days of receipt of a notice of probable...
Czech Academy of Sciences Publication Activity Database
Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Blabolil, Petr; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Muška, Milan; Peterka, Jiří; Prchalová, Marie; Říha, Milan; Tušer, Michal; Kubečka, Jan
2014-01-01
Roč. 724, č. 1 (2014), s. 217-234 ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : horizontal migration * Římov reservoir * trawling * seining * fry distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014
Maisonneuve, Jenny J; Semrau, Katherine E A; Maji, Pinki; Pratap Singh, Vinay; Miller, Kate A; Solsky, Ian; Dixit, Neeraj; Sharma, Jigyasa; Lagoo, Janaka; Panariello, Natalie; Neal, Brandon; Kalita, Tapan; Kara, Nabihah; Kumar, Vishwajeet; Hirschhorn, Lisa R
2018-04-30
Evaluate the impact of a World Health Organization Safe Childbirth Checklist coaching-based intervention (BetterBirth Program) on availability and procurement of essential childbirth-related supplies. Matched pair, cluster-randomized controlled trial. Uttar Pradesh, India. 120 government-sector health facilities (60 interventions, 60 controls). Supply-availability surveys were conducted quarterly in all sites. Coaches collected supply procurement sources from intervention sites. Coaching targeting implementation of Checklist with data feedback and action planning. Mean supply availability by study arm; change in procurement sources for intervention sites. At baseline, 6 and 12 months, the intervention sites had a mean of 20.9 (95% confidence interval (CI): 20.2-21.5); 22.4 (95% CI: 21.8-22.9) and 22.1 (95% CI:21.4-22.8) items, respectively. Control sites had 20.8 (95% CI: 20.3-21.3); 20.9 (95% CI: 20.3-21.5) and 21.7 (95% CI: 20.8-22.6) items at the same time-points. There was a small but statistically significant higher availability in intervention sites at 6 months (difference-in-difference (DID) = 1.43, P supply availability was seen at 6 months (DID = 4.0, P = 0.0002), with no significant difference by 12 months (DID = 1.5, P = 0.154). No change was seen in procurement sources with ~5% procured by patients with some rates as high as 29% (oxytocin). Implementation of the BetterBirth Program, incorporating supply availability, resulted in modest improvements with catch-up by control facilities by 12 months. Supply-chain coaching may be most beneficial in sites starting with lower supply availability. Efforts are needed to reduce reliance on patient-funding for some critical medications. ClinicalTrials.gov #NCT02148952; Universal Trial Number: U1111-1131-5647.
Overview of JT-60U results toward high integrated performance in reactor-relevant regime
International Nuclear Information System (INIS)
Fujita, T.
2002-01-01
Toward steady sustainment of high integrated performance, we have developed weak magnetic shear (high β p mode) and reversed magnetic shear plasmas. As a large-sized tokamak equipped with a variety of devices for heating, current drive and profile/shape control, JT-60U has high ability to approach the conditions required in reactors: low values of normalized Larmor radius and collisionality, high temperatures with T e > or approx. T i , etc. This paper reviews recent JT-60U results with the emphasis on the projection to the reactor-relevant regime. Full non-inductive current drive has been achieved in a 1.8 MA high β p H-mode plasma with β N 2:4, HH y2 =1.2 and high fusion triple product (3 x 10 20 m -3 keVs) owing to increased N-NB power. In a reversed shear plasma, HH y2 =1.4 at n e /n GW 0.8 under the full non-inductive current drive has been achieved with injection of LHRF and N-NB. In box-type ITBs with reversed shear, barriers for ions and electrons were sustained in a regime with T e > or approx. T i . The pedestal pressure was doubled with increased total poloidal beta in pellet-injected high triangularity plasmas with type I and II ELMs. Stable existence of current hole was demonstrated. (author)
22 CFR 209.6 - Compliance information.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 209.6 Section 209.6... § 209.6 Compliance information. (a) Cooperation and assistance. The Administrator shall to the fullest... and accurate compliance reports at such times, and in such form and containing such information, as...
Munang'andu, Hetron M; Fredriksen, Børge N; Mutoloki, Stephen; Brudeseth, Bjørn; Kuo, Tsun-Yung; Marjara, Inderjit S; Dalmo, Roy A; Evensen, Øystein
2012-06-08
Two strains of IPNV made by reverse genetics on the Norwegian Sp strain NVI-015 (GenBank AY379740) backbone encoding the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs were used to prepare inactivated whole virus (IWV), nanoparticle vaccines with whole virus, Escherichia coli subunit encoding truncated VP2-TA and VP2-PT, VP2-TA and VP2-PT fusion antigens with putative translocating domains of Pseudomonas aeruginosa exotoxin, and plasmid DNA encoding segment A of the TA strain. Post challenge survival percentages (PCSP) showed that IWV vaccines conferred highest protection (PCSP=42-53) while nanoparticle, sub-unit recombinant and DNA vaccines fell short of the IWV vaccines in Atlantic salmon (Salmo salar L.) postsmolts challenged with the highly virulent Sp strain NVI-015 (TA strain) of IPNV after 560 degree days post vaccination. Antibody levels induced by these vaccines did not show antigenic differences between the virulent and avirulent motifs for vaccines made with the same antigen dose and delivery system after 8 weeks post vaccination. Our findings show that fish vaccinated with less potent vaccines comprising of nanoparticle, DNA and recombinant vaccines got infected much earlier and yielded to higher infection rates than fish vaccinated with IWV vaccines that were highly potent. Ability of the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs to limit establishment of infection showed equal protection for vaccines made of the same antigen dose and delivery systems. Prevention of tissue damage linked to viral infection was eminent in the more potent vaccines than the less protective ones. Hence, there still remains the challenge of developing highly efficacious vaccines with the ability to eliminate the post challenge carrier state in IPNV vaccinology. Copyright © 2012 Elsevier Ltd. All rights reserved.
Fast neutron-gamma discrimination on neutron emission profile measurement on JT-60U
International Nuclear Information System (INIS)
Ishii, K.; Okamoto, A.; Kitajima, S.; Sasao, M.; Shinohara, K.; Ishikawa, M.; Baba, M.; Isobe, M.
2010-01-01
A digital signal processing (DSP) system is applied to stilbene scintillation detectors of the multichannel neutron emission profile monitor in JT-60U. Automatic analysis of the neutron-γ pulse shape discrimination is a key issue to diminish the processing time in the DSP system, and it has been applied using the two-dimensional (2D) map. Linear discriminant function is used to determine the dividing line between neutron events and γ-ray events on a 2D map. In order to verify the validity of the dividing line determination, the pulse shape discrimination quality is evaluated. As a result, the γ-ray contamination in most of the beam heating phase was negligible compared with the statistical error with 10 ms time resolution.
International Nuclear Information System (INIS)
Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.
2014-01-01
This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D 2 16 O, D 2 17 O, and D 2 18 O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm −1 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. For D 2 16 O, D 2 17 O, and D 2 18 O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm −1 , from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D 2 O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels
The first report of myeloma with IgD κ and free κ in Indonesia
Directory of Open Access Journals (Sweden)
Riadi Wirawan
2011-08-01
Full Text Available IgD κ myeloma is a rare plasma cell neoplasm case and has never been reported before in Indonesia. In normal condition, IgD level in blood is very low, therefore increase of IgD level in myeloma could be missed by serum protein electrophoresis. A case of a 59 years old female with severe bone pain is reported. In radiology evaluation, there were thoracal compression fracture and thoracal foramen narrowing. For this patient, the myeloma diagnosis was based on WHO criteria, the stage IIIb was based on Durie and Salmon criteria, and bad prognosis with prognostic index stage III diagnosis was based on International Prognostic Index from International Myeloma Working Group, respectively. In serum protein electrophoresis we found a very small monoclonal spike and in immunofi xation there were monoclonal IgD κ and free light chain κ. (Med J Indones 2011; 20:217-21Keywords: immunofixation, myeloma IgD κ, protein electrophoresis
Development and Operational Experiences of the JT-60U Tokamak and Power Supplies
International Nuclear Information System (INIS)
Hosogane, N.; Ninomiya, H.; Matsukawa, M.; Ando, T.; Neyatani, Y.; Horiike, H.; Sakurai, S.; Masaki, K.; Yamamoto, M.; Kodama, K.; Sasajima, T.; Terakado, T.; Ohmori, S.; Ohmori, Y.; Okano, J.
2002-01-01
The design of the JT-60U tokamak, the configuration of the coil power supplies, and the operational experiences gained to date are reviewed. JT-60U is a large tokamak upgraded from the original JT-60 in order to obtain high plasma current, large plasma volume, and highly elongated divertor configurations. All components inside the toroidal magnetic field coils, such as vacuum vessel, poloidal magnetic field coils, divertor, etc., were modified. Various technologies and ideas were introduced to develop these components; for example, a multi-arc double skin wall structure for the vacuum vessel and a functional poloidal magnetic field coil system with taps for obtaining various plasma configurations. Furthermore, boron-carbide coated carbon fiber composite (CFC) tiles were used as divertor tiles to reduce erosion of carbon-base tiles. Later, a semiclosed divertor with pumps, for which cryo-panels originally used for NBI units were converted, was installed in the replacement of the open divertor. These development and operational results provide data for future tokamaks. Major failures experienced in the long operational period of JT-60U, such as water leakage from the toroidal magnetic field coil, fracture of carbon tiles, and breakdown of a filter capacitor, are described. As a maintenance issue for tokamaks using deuterium fueling gas, a method for reducing radiation exposure of in-vessel workers is described
Activation analysis for JT-60U experiments with deuterium gases
International Nuclear Information System (INIS)
Miya, Naoyuki
1993-11-01
Identification of radionuclides and evaluation of dose rate level have been made on the structural materials of the JT-60U tokamak device. A one-dimensional neutron and gamma-ray transport code ANISN and an induced activation calculation code CINAC are used in this work. Radionuclides of 56 Mn (High-Mn steel toroidal field coil case), 58 Co (Inconel-625 vessel) and 60 Co (SS-316 first wall supporting material) appeared on the structures, which contribute to the dose rate around a vacuum vessel. Cobalt-58 and 60 Co with long half-life time intensely make residual activation in the time of 3 days to 3 months corresponding to the maintenance time after shutdown. The calculated dose rate on the vessel agreed well with the measured data in the first 2 years D-D operations. The one-dimensional code provided a sufficient prediction for the dose rate, although an error due to the toroidal field coil modeling in the calculation is estimated within ∼30%. (author)
Prazdnik podportshen / Oksana Smirnova, Vladimir Skripov, Vjatsheslav Ivanov...[jt.
2005-01-01
Ülevaade diskussioonist Eestis, Lätis ja Leedus presidentide osalemise üle 9. mai pidustustel Moskvas. Juhan Partsi, Villu Reiljani, Toomas Hendrik Ilvese, Marko Mihkelsoni jt. arvamusi. Toimetuse seisukoht
Diagnostic system for passive charge-exchange particle measurements on JT-60
International Nuclear Information System (INIS)
Nemoto, Masahiro; Tobita, Kenji; Kusama, Yoshinori; Takeuchi, Hiroshi
1988-01-01
In order to measure energy distributions of the charge-exchange neutral particles in the JT-60 experiments, a compact size electrostatic energy analyzer which the measurable energy range is from 1 keV to 100 keV is developed successfully. Compactness of an analyzer is accomplished by setting an accelerator between a gas stripping cell and a deflector of 45deg injection type. The calibration of the analyzer was carried out owing to confirm the capability of energy analysis and stripping efficiency. This analyzer was applied to measure the energy distribution in additionally heated plasmas in JT-60. The usefullness of the analyzer was confirmed. (author)
Orbit-Attitude Changes of Objects in Near Earth Space Induced by Natural Charging
2017-05-02
Program Manager Technical Advisor, Spacecraft Component Technology //SIGNED// JOHN BEAUCHEMIN Chief Engineer, Spacecraft Technology Division...istration (NASA) and the US Air Force to investigate the effects of charging and develop technologies to mitigate the same. Accumulated charges may...e2 [ Sesin f +T (1+ ecos f ) ] (217a) de dt = √ 1− e2 na [ S sin f +T (cos f + cosE) ] (217b) di dt = r cos(ω + f ) na2 √ 1− e2 W (217c) dΩ dt = r sin
Crossover from 2d to 3d in anisotropic Kondo lattices
International Nuclear Information System (INIS)
Reyes, D.; Continentino, M.A.
2008-01-01
We study the crossover from two to three dimensions in Kondo lattices (KLM) using the Kondo necklace model (KNM). In order to diagonalize the KNM, we use a representation for the localized and conduction electron spins in terms of bond operators and a decoupling for the relevant Green's functions. Both models have a quantum critical point at a finite value of the ratio (J/t) between the Kondo coupling (J) and the hopping (t). In 2d there is no line of finite temperature antiferromagnetic (AF) transitions while for d≥3 this line is given by, T N ∝|g| 1/(d-1) [D. Reyes, M.A. Continentino, Phys. Rev. B 76 (2007) 075114]. The crossover from 2d to 3d is investigated by turning on the electronic hopping (t -perpendicular ) of conduction electrons between different planes. The phase diagram as a function of temperature T, J/t -parallel and ξ=t -perpendicular /t -parallel , where t -parallel is the hopping within the planes is calculated
Moore, Amy; Hochner, Hagit; Sitlani, Colleen M; Williams, Michelle A; Hoofnagle, Andrew N; de Boer, Ian H; Kestenbaum, Bryan; Siscovick, David S; Friedlander, Yechiel; Enquobahrie, Daniel A
2015-01-01
Objective To examine cross-sectional relationships between plasma vitamin D and Cardiometabolic Risk Factors in young adults. Design Data were collected from interviews, physical examinations, and biomarker measurements. Total plasma 25-hydroxyvitamin D (25[OH]D) was measured using liquid chromatography-tandem mass spectrometry. Associations between 25[OH]D and CMR were modeled using weighted linear regression with robust standard error estimates. Setting Individuals born in Jerusalem during 1974-1976. Subjects Participants of the Jerusalem Perinatal Study (n = 1,204) interviewed and examined at age 32 years. Participants were oversampled for low and high birthweight and for maternal pre-pregnancy obesity. Results Mean total 25[OH]D concentration among participants was 21.7 ng/mL (SD 8.9). Among males, 25[OH]D was associated with Homeostatic Model Assessment of Insulin Resistance (HOMA-IR) (natural log-transformed, β = -0.011, p = 0.004) after adjustment for body mass index. However, these associations were not present among females (p for sex interaction = 0.005). Conclusions We found evidence for inverse associations of 25[OH]D with markers of insulin resistance among males, but not females, in a health, young adult Caucasian population. Prospective studies and studies conducted on other populations investigating sex specific effects of vitamin D on CMR are warranted. PMID:25145881
Energy Technology Data Exchange (ETDEWEB)
Zhang, Wei, E-mail: wzhang@ecust.edu.cn [State Environmental Protection Key Laboratory of Environmental Risk Assessment and Control on Chemical Process, Shanghai 200237 (China); School of Resource and Environmental Engineering, East China University of Science and Technology, Shanghai 200237 (China); Liu, Kou; Li, Jing; Liang, Jun; Lin, Kuangfei [State Environmental Protection Key Laboratory of Environmental Risk Assessment and Control on Chemical Process, Shanghai 200237 (China); School of Resource and Environmental Engineering, East China University of Science and Technology, Shanghai 200237 (China)
2015-12-30
Highlights: • 10 or 100 μg g{sup −1} BDE209 addition caused histological changes in Pb-exposed earthworms’ body wall. • Strong histopathological effects with BDE209 addition confirmed the enhanced Pb bioavailability. • The presence of higher levels of BDE209 altered subcellular partitioning of Pb in earthworm. • Co-exposure to Pb and BDE209 declined SOD and CAT gene transcripts synergistically. • BDE209 addition elicited up-regulation of Hsp90 gene expression compared to Pb exposure alone. - Abstract: Lead (Pb) and decabromodiphenyl ether (BDE209) are the mainly co-existed contaminants at e-waste recycling sites. The potential toxicity of Pb (250 μg g{sup −1}) to earthworm Eisenia fetida in the presence of BDE209 (1, 10 and 100 μg g{sup −1}) was determined during 14-d incubation period. Compared to Pb treatment alone, the co-exposure with 1 μg g{sup −1} BDE209 barely affected Pb uptake, subcellular partitioning and gene expression; however, histopathological changes in earthworms’ body wall (epidermal, circular and longitudinal muscles) demonstrated that 10 and 100 μg g{sup −1} BDE209 additions enhanced Pb uptake and altered its subcellular partitioning, indicating that Pb redistributed from fractions E (cell debris) and D (metal-rich granules) to fraction C (cytosols); Additionally, BDE209 supply significantly inhibited (p < 0.05) the induction of SOD (superoxide dismutase) and CAT (catalase) gene expressions (maximum down-regulation 59% for SOD gene at Pb + 100 μg g{sup −1} BDE209 and 89% for CAT gene at Pb + 10 μg g{sup −1} BDE209), while facilitated (p < 0.05) Hsp90 (heat shock protein 90) gene expression with maximum induction rate of 120% after exposure to Pb + 10 μg g{sup −1} BDE209. These findings illustrate the importance of considering environmental BDE209 co-exposure when assessing Pb bioaccumulation and toxicity in multi-contaminated soil ecosystems.
International Nuclear Information System (INIS)
Zhang, Wei; Liu, Kou; Li, Jing; Liang, Jun; Lin, Kuangfei
2015-01-01
Highlights: • 10 or 100 μg g −1 BDE209 addition caused histological changes in Pb-exposed earthworms’ body wall. • Strong histopathological effects with BDE209 addition confirmed the enhanced Pb bioavailability. • The presence of higher levels of BDE209 altered subcellular partitioning of Pb in earthworm. • Co-exposure to Pb and BDE209 declined SOD and CAT gene transcripts synergistically. • BDE209 addition elicited up-regulation of Hsp90 gene expression compared to Pb exposure alone. - Abstract: Lead (Pb) and decabromodiphenyl ether (BDE209) are the mainly co-existed contaminants at e-waste recycling sites. The potential toxicity of Pb (250 μg g −1 ) to earthworm Eisenia fetida in the presence of BDE209 (1, 10 and 100 μg g −1 ) was determined during 14-d incubation period. Compared to Pb treatment alone, the co-exposure with 1 μg g −1 BDE209 barely affected Pb uptake, subcellular partitioning and gene expression; however, histopathological changes in earthworms’ body wall (epidermal, circular and longitudinal muscles) demonstrated that 10 and 100 μg g −1 BDE209 additions enhanced Pb uptake and altered its subcellular partitioning, indicating that Pb redistributed from fractions E (cell debris) and D (metal-rich granules) to fraction C (cytosols); Additionally, BDE209 supply significantly inhibited (p < 0.05) the induction of SOD (superoxide dismutase) and CAT (catalase) gene expressions (maximum down-regulation 59% for SOD gene at Pb + 100 μg g −1 BDE209 and 89% for CAT gene at Pb + 10 μg g −1 BDE209), while facilitated (p < 0.05) Hsp90 (heat shock protein 90) gene expression with maximum induction rate of 120% after exposure to Pb + 10 μg g −1 BDE209. These findings illustrate the importance of considering environmental BDE209 co-exposure when assessing Pb bioaccumulation and toxicity in multi-contaminated soil ecosystems.
48 CFR 1553.209 - Contractor qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor qualifications. 1553.209 Section 1553.209 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS FORMS Prescription of Forms 1553.209 Contractor qualifications. ...
48 CFR 53.209 - Contractor qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor qualifications. 53.209 Section 53.209 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.209 Contractor qualifications. ...
Analysis of JT-60SA operational scenarios
Garzotti, L.; Barbato, E.; Garcia, J.; Hayashi, N.; Voitsekhovitch, I.; Giruzzi, G.; Maget, P.; Romanelli, M.; Saarelma, S.; Stankiewitz, R.; Yoshida, M.; Zagórski, R.
2018-02-01
Reference scenarios for the JT-60SA tokamak have been simulated with one-dimensional transport codes to assess the stationary state of the flat-top phase and provide a profile database for further physics studies (e.g. MHD stability, gyrokinetic analysis) and diagnostics design. The types of scenario considered vary from pulsed standard H-mode to advanced non-inductive steady-state plasmas. In this paper we present the results obtained with the ASTRA, CRONOS, JINTRAC and TOPICS codes equipped with the Bohm/gyro-Bohm, CDBM and GLF23 transport models. The scenarios analysed here are: a standard ELMy H-mode, a hybrid scenario and a non-inductive steady state plasma, with operational parameters from the JT-60SA research plan. Several simulations of the scenarios under consideration have been performed with the above mentioned codes and transport models. The results from the different codes are in broad agreement and the main plasma parameters generally agree well with the zero dimensional estimates reported previously. The sensitivity of the results to different transport models and, in some cases, to the ELM/pedestal model has been investigated.
5 CFR 591.209 - What is a price index?
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false What is a price index? 591.209 Section... Allowances § 591.209 What is a price index? (a) The price index is the COLA area price divided by the DC area... case of the final index, OPM rounds the index to two decimal places. ...
48 CFR 253.209 - Contractor qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contractor qualifications. 253.209 Section 253.209 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.209 Contractor qualifications. ...
2010-06-08
...-1076. FOR FURTHER INFORMATION CONTACT: Ms. Bea Shahin (217) 373-7234, FAX (217) 373-7210, e-mail: Bea.S... applications to achieve increased soil strength, reduced air transport, and decreased soil erosion. During...
Structural analysis of the JT-60SA cryostat vessel body
Energy Technology Data Exchange (ETDEWEB)
Botija, José, E-mail: jose.botija@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Fernández, Pilar; Medrano, Mercedes; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico; Tomarchio, Valerio [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira; Shibama, Yusuke [JAEA – Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)
2013-10-15
Highlights: ► Structural analysis to validate the JT-60SA cryostat vessel body design. ► Design code ASME 2007 “Boiler and Pressure Vessel Code. Section VIII”. ► First buckling mode: load multiplier of 10.644, higher than the minimum factor 4.7. ► Elastic and elastic–plastic stress analysis meets ASME against plastic collapse. ► Bolted fasteners have been analyzed showing small gaps closed by strong welding. -- Abstract: The JT-60SA cryostat is a stainless steel vacuum vessel (14 m diameter, 16 m height) which encloses the Tokamak providing the vacuum environment (10{sup −3} Pa) necessary to limit the transmission of thermal loads to the components at cryogenic temperature. It must withstand both external atmospheric pressure during normal operation and internal overpressure in case of an accident. The paper summarizes the structural analyses performed in order to validate the JT-60SA cryostat vessel body design. It comprises several analyses: a buckling analysis to demonstrate stability under the external pressure; an elastic and an elastic–plastic stress analysis according to ASME VIII rules, to evaluate resistance to plastic collapse including localized stress concentrations; and, finally, a detailed analysis with bolted fasteners in order to evaluate the behavior of the flanges, assuring the integrity of the vacuum sealing welds of the cryostat vessel body.
Quality control of the software in the JT-60 computer control system
International Nuclear Information System (INIS)
Isaji, Nobuaki; Kurihara, Kenichi; Kimura, Toyoaki
1990-07-01
The JT-60 Control System should be improved corresponding to the experimental requirements. In order to keep the integrity of the system even in the modification the concept of quality control (QC) was introduced in the software development. What we have done for QC activity are (1) to establish standard procedures of the software development, (2) to develop support tools for grasping the present status of the program structure, and (3) to develop a document system, and a source program management system. This paper reports these QC activities and their problems for the JT-60 control system. (author)
Guarnieri, Vito; Seaberg, Raewyn M; Kelly, Catherine; Jean Davidson, M; Raphael, Simon; Shuen, Andrew Y; Baorda, Filomena; Palumbo, Orazio; Scillitani, Alfredo; Hendy, Geoffrey N; Cole, David E C
2017-08-03
Inactivating mutations of CDC73 cause Hyperparathyroidism-Jaw Tumour syndrome (HPT-JT), Familial Isolated Hyperparathyroidism (FIHP) and sporadic parathyroid carcinoma. We conducted CDC73 mutation analysis in an HPT-JT family and confirm carrier status of the proband's daughter. The proband had primary hyperparathyroidism (parathyroid carcinoma) and uterine leiomyomata. Her father and daughter had hyperparathyroidism (parathyroid adenoma) but no other manifestations of HPT-JT. CDC73 mutation analysis (sequencing of all 17 exons) and whole-genome copy number variation (CNV) analysis was done on leukocyte DNA of the three affecteds as well as the proband's unaffected sister. A novel deletion of exons 4 to 10 of CDC73 was detected by CNV analysis in the three affecteds. A novel insertion in the 5'UTR (c.-4_-11insG) that co-segregated with the deletion was identified. By in vitro assay the 5'UTR insertion was shown to significantly impair the expression of the parafibromin protein. Screening for the mutated CDC73 confirmed carrier status in the proband's daughter and the biochemistry and ultrasonography led to pre-emptive surgery and resolution of the hyperparathyroidism. A novel gross deletion mutation in CDC73 was identified in a three-generation HPT-JT family emphasizing the importance of including screening for large deletions in the molecular diagnostic protocol.
Descriptive evaluation of holter recordings at a teaching hospital in ...
African Journals Online (AJOL)
Wide QRS complex tachycardia was detected in 20.4%, ST segment depression in 47.8% and atrial fibrillation in 28.7%. Asystole was seen in 18% of subjects with a mean duration of 2.17secs, arrest was recorded in 26.7% of those with asystole. The longest duration was 7.58secs. Premature atrial ectopics were seen in ...
Design and Structural Analysis for the Vacuum Vessel of Superconducting Tokamak JT-60SC
International Nuclear Information System (INIS)
Kudo, Y.; Sakurai, S.; Masaki, K.; Urata, K.; Sasajima, T.; Matsukawa, M.; Sakasai, A.; Ishida, S.
2003-01-01
A modification of the JT-60 is planned to be a superconducting tokamak (JT-60SC) in order to establish steady-state operation of high beta plasma for 100 s, and to ensure the applicability of ferritic steel as a reduced activation material for reactor relevant break-even class plasmas. This paper describes the detailed design of the vacuum vessel, which has a unique structure for cost effective manufacturing, as well as structural analysis results for a feasibility study
47 CFR 25.209 - Antenna performance standards.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Antenna performance standards. 25.209 Section 25.209 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.209 Antenna performance standards. (a) The gain of any...
Development of virtual private network for JT-60SA CAD integration
International Nuclear Information System (INIS)
Oshima, Takayuki; Fujita, Takaaki; Seki, Masami; Kawashima, Hisato; Hoshino, Katsumichi; Shibanuma, Kiyoshi; Verrecchia, M.; Teuchner, B.
2010-01-01
The CAD models will be exchanged and integrated at Naka for JT-60SA, a common computer network efficiently connected between Naka site and the Garching site is needed to be established. Virtual Private Network (VPN) was introduced with LAN on computer network physically-separated from JAEA intranet area and firewall. In July 2009, a new VPN connection between the Naka and Garching sites has been successfully demonstrated using IPSec-VPN technology with a commercial and cost-effective firewall/router for security. It was found that the introduction of the Wide Area File Service (WAFS) could solve the issue of the data transmission time and enhance the usability of the VPN for design integration in JT-60SA. (author)
Czech Academy of Sciences Publication Activity Database
Seipold, L.; Damme, M.; Prox, J.; Rabe, B.; Kašpárek, Petr; Sedláček, Radislav; Altmeppen, H.; Willem, M.; Boland, B.; Glatzel, M.; Saftig, P.
2017-01-01
Roč. 1864, č. 1 (2017), s. 217-230 ISSN 0167-4889 R&D Projects: GA MŠk(CZ) LM2011032; GA MŠk(CZ) LM2015040 Institutional support: RVO:68378050 Keywords : ADAM10 * Tetraspanin * APP * Presenilin Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.521, year: 2016
Czech Academy of Sciences Publication Activity Database
Breiter, Karel; Ďurišová, Jana; Hrstka, Tomáš; Korbelová, Zuzana; Hložková Vaňková, M.; Vašinová Galiová, M.; Kanický, V.; Rambousek, P.; Knésl, I.; Dobeš, P.; Dosbaba, M.
292/293, November (2017), s. 198-217 ISSN 0024-4937 R&D Projects: GA ČR GA14-13600S Institutional support: RVO:67985831 Keywords : rare-metal granite * Cínovec/Zinnwald deposit * rock textures * metasomatic processes * magmatic processes Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016
Mechanism of vertical displacement events in JT-60U disruptive discharges
International Nuclear Information System (INIS)
Nakamura, Y.; Yoshino, R.; Neyatani, Y.; Tsunematsu, T.; Azumi, M.; Pomphrey, N.; Jardin, S.C.
1996-01-01
Enhanced vertical displacement events (VDEs), which are frequently observed in JT-60U disruptive discharges, are investigated using the Tokamak Simulation Code (TSC). The rapid plasma current quench can accelerate the vertical displacement, owing to both the up/down asymmetry of the eddy current distribution arising from the asymmetric geometry of the JT-60U vacuum vessel and the degradation of magnetic field decay index n, leading to high growth rates of positional instability. For a slightly elongated configuration (n = -0.9), the asymmetry of attractive forces on the toroidal plasma plays a dominant role in the VDE mechanism. For a more elongated configuration (n = -1.7), the degradation of field decay index n plays an important role on VDEs, in addition to the effect of asymmetric attractive forces. It is shown that the VDE characteristics of a highly elongated configuration with a rapid plasma current quench can be dominated by the field decay index degradation. It is also pointed out that both the softening of current quenches as was experimentally developed in the JT-60U tokamak, and the optimization of the allowable elongation of the plasma cross-section are critical issues in the development of a general control strategy of discharge termination. (author). 21 refs, 10 figs
49 CFR 217.2 - Preemptive effect.
2010-10-01
... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C. 20106 (section 20106), issuance of the regulations in this part preempts any State law, regulation, or order covering the same subject matter, except an additional or more stringent law, regulation, or order...
75 FR 9103 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; NOX
2010-03-01
... recommend that you telephone John Summerhays, Environmental Scientist, at (312) 886-6067, before visiting... 35 IAC 217 Subpart W. Illinois' revision would add 35 IAC 217.751, the full text of which is: The...
Neural-net disruption predictor in JT-60U
International Nuclear Information System (INIS)
Yoshino, R.
2003-01-01
The prediction of major disruptions caused by the density limit, the plasma current ramp-down with high internal inductance l i , the low density locked mode and the β-limit has been investigated in JT-60U. The concept of 'stability level', newly proposed in this paper to predict the occurrence of a major disruption, is calculated from nine input parameters every 2 ms by the neural network and the start of a major disruption is predicted when the stability level decreases to a certain level, the 'alarm level'. The neural network is trained in two steps. It is first trained with 12 disruptive and six non-disruptive shots (total of 8011 data points). Second, the target output data for 12 disruptive shots are modified and the network is trained again with additional data points generated by the operator. The 'neural-net disruption predictor' obtained has been tested for 300 disruptive shots (128 945 data points) and 1008 non-disruptive shots (982 800 data points) selected from nine years of operation (1991-1999) of JT-60U. Major disruptions except for those caused by the -limit have been predicted with a prediction success rate of 97-98% at 10 ms prior to the disruption and higher than 90% at 30 ms prior to the disruption while the false alarm rate is 2.1% for non-disruptive shots. This prediction performance has been confirmed for 120 disruptive shots (56 163 data points), caused by the density limit, as well as 1032 non-disruptive shots (1004 611 data points) in the last four years of operation (1999-2002) of JT-60U. A careful selection of the input parameters supplied to the network and the newly developed two-step training of the network have reduced the false alarm rate resulting in a considerable improvement of the prediction success rate. (author)
Study of turbofan engines designed for low energy consumption
Gray, D. E.
1976-01-01
The near-term technology improvements which can reduce the fuel consumed in the JT9D, JT8D, and JT3D turbofans in commercial fleet operation through the 1980's are identified. Projected technology advances are identified and evaluated for new turbofans to be developed after 1985. Programs are recommended for developing the necessary technology.
Retention of Hydrogen Isotopes in Divertor Tiles Used in JT-60U
International Nuclear Information System (INIS)
Hirohata, Y.; Shibahara, T.; Tanabe, T.; Oya, Y.; Arai, T.; Gotoh, Y.; Masaki, K.; Yagyu, J.; Oyaidzu, M.; Okuno, K.; Nishikawa, M.; Miya, N.
2005-01-01
Retention characteristics of deuterium and hydrogen retained in graphite tiles placed in the divertor region of JT-60U were investigated by thermal desorption spectroscopy (TDS). The deuterium retained in the near surface of all graphite tiles was mostly replaced by hydrogen due to exposure to hydrogen plasma at the final stage operations, resulting in main deuterium retention in the deeper region. The dominant species desorbed from the divertor tiles were H 2 , HD, D 2 and CH 4 . The smallest retention of hydrogen isotopes (H+D) was observed in the outer divertor tile which was eroded with maximum of 20 μm depth. The amount of H+D retained in the inner divertor tiles covered by the re-deposited layers increased with the thickness of the re-deposited layers. Hydrogen isotopes concentration ((H+D)/C) in the re-deposited layers was ∼0.02, which was much smaller than those observed in JET and other devices
Very fast feedback control of coil-current in JT-60 tokamak
International Nuclear Information System (INIS)
Aoyagi, T.; Terakado, T.; Takahashi, M.; Nobusaka, H.; Yagyu, J.; Matsuzaki, Y.
1992-01-01
A direct digital control (DDC) system is adopted for controlling thyristor converters of power supplies in the JT-60 tokamak built in 1984. Microcomputers of the DDC were 5 MHz i8086 microprocessor and programs were written by assembler language and the processing time was under 1ms. They were, however, too old in hardware and too complicated in software. New DDC system has been made in the JT-60 Upgrade (JT-60U) to control the power supplies more quickly under 0.25 and 0.5 ms of the processing time and also to write the programs used by high-level language. The new system consists of a host computer and five microcomputers with microprocessor on VME bus system. The host computer AS3260 performs on-line processing such as setting the DDC under the discharge conditions and so on. Functions of the microcomputers with a 32-bit, 20 MHz microprocessor MC68030, whose OS are VxWorks and programs are written by C language, are real-time processing such as taking in instructions from a ZENKEI computer and in feedback control of currents and voltages of coils every 0.25 and 0.5 ms. The system is now operating very smoothly. (author)
Energy Technology Data Exchange (ETDEWEB)
Bildstein, O
1998-03-13
The Ph.D. report describes a conceptual and numerical model for simulating gas-water-rock interaction during mineral diagenesis of sediments. The main specific features of this model are the following: applicable to open systems, half-implicit resolution numerical method, feedback on the texture evolution (grain model), existence of a gas phase, oxido-reduction phenomena. (author) 217 refs.
Efficiency and safety of fibroid embolisation
International Nuclear Information System (INIS)
Berczi, V.
2012-01-01
Full text: Introduction: Uterine Fibroid Embolisation (UFE) has been introduced in 1995 in France. It has been performed on growing number of cases in most countries. In Hungary, the first centre started these procedures in large number of cases approximately 7 years ago. Our group introduced this techniques in Budapest in 2008, and reached a steady rate of 60-80 fibroids per year. We regularly perform an audit of our cases. Patients and methods: Indication is decided by the interventional radiologist and the gynecologist knowing and accepting UFE. Most gynecologists in Hungary, however, still not inform the patient about UFE. Very often the patient finds the solution following an offer from the gynecologist to perform hysterectomy which she does not accept; searching on the internet leads her to our group in numerous cases. Prior to the embolisation, MR is performed in most cases. Fibroid embolisation is performed through to common femoral puncture using 500-700 μm PVA particles. Follow-up MR is performed 6 months following the procedure. Results: Between May, 2008 and October, 2011, 217 patients had UFE in our centre (mean age 42.2 years, range 24-55 years). Indications by symptoms: (n=218) Menorrhagia and metrorrhagia: 197, Pelvic pressure or pain: 117, Frequent urination: 85, Lack pain: 21, Lower complaints: 6, Risk reduction of future moymectomy: 3, Dyspareunia: 3. Indications based on morphology: (n=217), fibroid: 196, adenomyosis: 8, fibroid +adenomyosis: 13. Morphological changes: (n=50) decrease in volume at 6 months follow-up MR 55.3±3.8% (range 0-97.6%). Bilateral uterine artery catheterization and embolisation: 201/217=95.4%; 10/217=4.6% in ten cases, selective uterine artery was not possible due to the tortousity of the artery. Bilateral embolisation: 196/217=90%; 11/217=5% in eleven cases, unilateral embolisation was performed due to early venous filling or retrograde ovaric artery filling. Volume reduction at bilateral embolisation: 55.6±4.1% (n
Study of carbon impurity generation by chemical sputtering in JT-60U
International Nuclear Information System (INIS)
Higashijima, S.; Kubo, H.; Sugie, T.; Shimizu, K.; Asakura, N.; Itami, K.; Hosogane, N.; Sakasai, A.; Konoshima, S.; Sakurai, S.; Takenaga, H.
1997-01-01
CD/CH-band intensities emitted from hydrocarbon molecules have been measured in the divertor region of JT-60U and the chemical sputtering yield of methane was estimated as a function of the surface temperature and the deuterium ion flux. The chemical sputtering yield increases with the surface temperature and decreases with increasing ion flux density in the L-mode plasmas. The B 4 C converted CFC tiles are installed in JT-60U and it is found that the chemical sputtering of B 4 C converted CFC tiles is suppressed in comparison to normal CFC tiles. (orig.)
Czech Academy of Sciences Publication Activity Database
Aleksandrzak-Piekarczyk, T.; Koryszewska-Baginska, A.; Grynberg, M.; Nowak, A.; Cukrowska, B.; Kozáková, Hana; Bardowski, J.
2016-01-01
Roč. 8, č. 1 (2016), s. 202-217 ISSN 1759-6653 Institutional support: RVO:61388971 Keywords : adhesion * spaCBA pilus cluster * lactobacillus Subject RIV: EC - Immunology Impact factor: 3.979, year: 2016
Czech Academy of Sciences Publication Activity Database
Oros, Mikuláš; Hanzelová, V.; Scholz, Tomáš
2009-01-01
Roč. 164, 2-4 (2009), s. 217-222 ISSN 0304-4017 R&D Projects: GA MŠk LC522; GA ČR GA524/08/0885 Institutional research plan: CEZ:AV0Z60220518 Keywords : biological invasions * Khawia sinensis * fish health Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.278, year: 2009
5 CFR 842.209 - Members of Congress.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Members of Congress. 842.209 Section 842.209 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.209 Members of Congress. (a...
1983-05-15
Interconnection (ISO 051) is the model used as a guide for this introduction to network protocols [30] T. Utsumi, " GLOSAS Project (GLObal Systems...Analysis and Simulation)," Proceedings of the 1980 Winter Simulation * Conference, Orlando, Fl., December, 1980, pp. 165-217. GLOSAS Project proposes the
Performance of RF power and phase control on JT-60 LHRF heating system
International Nuclear Information System (INIS)
Fujii, T.; Ikeda, Y.; Imai, T.; Honda, M.; Kiyono, K.; Maebara, S.; Saigusa, M.; Sakamoto, K.; Sawahata, M.; Seki, M.
1987-01-01
The performance of RF power and phase control on the JT-60 LHRFD heating system are presented. The JT-60 LHRF heating system has three units of huge RF source with a total output of 24 MW, each unit consisting of eight amplifier chains. A high power klystron generating 1 MW for 10 s at 2 GHz is used in each chain. Automatic gain control is employed to regulate the output power not only against gain fluctuations in the chain but also against the unstable plasma load without any output circulator for the klystron
International Nuclear Information System (INIS)
Fujii, Tsuneyuki
1992-03-01
Two main subjects of ion cyclotron range of frequencies (ICRF) heating on JT-60 are described in this paper from development phase of the JT-60 ICRF heating system up to advanced experiment I, 1989. One is antenna design and development for the high power JT-60 ICRF heating system (6 MW for 10 s at a frequency range of 108 - 132 MHz). The other is the experimental investigation of characteristics of second harmonic ICRF heating in a large tokamak. (J.P.N.)
Energy Technology Data Exchange (ETDEWEB)
Shirai, Hiroshi, E-mail: shirai.hiroshi@jaea.go.jp [JT-60SA Project Team, Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Barabaschi, Pietro [JT-60SA EU-Home Team, Fusion for Energy, Boltsmannstr 2, Garching 85748 (Germany); Kamada, Yutaka [JT-60SA JA-Home Team, Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2016-11-01
Highlights: • JT-60SA Project is promoted under the BA Agreement and JA national programme. • JT-60SA is designed to operate in break-even equivalent condition for a long period. • JT-60SA Project supports and complements the ITER project, and promotes DEMO design. • Fabrication of JT-60SA components and assembly in Naka are steadily going on. • JT-60SA Research Plan has been developed jointly by EU and JA fusion communities. - Abstract: Aiming at supporting the early realization of fusion energy, the JT-60SA Project has shown steady progress for several years toward the first plasma in 2019 under the dual frameworks: the Satellite Tokamak Programme of the Broader Approach Agreement between EU and Japan, and the Japanese national programme. JT-60SA is a superconducting tokamak designed to operate in break-even equivalent conditions for a long pulse duration (typically 100 s) with a maximum plasma current of 5.5 MA. A variety of plasma control capabilities enable JT-60SA to contribute directly to the ITER project and also to DEMO by addressing key engineering and physics issues for advanced plasma operation. Design and fabrication of JT-60SA components, shared by the EU and Japan, started in 2007. Assembly in the torus hall started in January 2013, and welding work of the vacuum vessel sectors (seven 40° sectors and two 30° sectors) is currently ongoing on the cryostat base. Other components such as TF coils, PF coils, power supplies, cryogenic system, cryostat vessel, thermal shields and so on were or are being delivered to the Naka site for installation, assembly and commissioning. This paper gives technical progress on fabrication, installation and assembly of tokamak components and ancillary systems, as well as progress of the JT-60SA Research Plan being developed jointly by European and Japanese fusion communities.
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
Plasma equilibrium response modelling and validation on JT-60U
International Nuclear Information System (INIS)
Lister, J.B.; Sharma, A.; Limebeer, D.J.N.; Wainwright, J.P.; Nakamura, Y.; Yoshino, R.
2002-01-01
A systematic procedure to identify the plasma equilibrium response to the poloidal field coil voltages has been applied to the JT-60U tokamak. The required response was predicted with a high accuracy by a state-space model derived from first principles. The ab initio derivation of linearized plasma equilibrium response models is re-examined using an approach standard in analytical mechanics. A symmetric formulation is naturally obtained, removing a previous weakness in such models. RZIP, a rigid current distribution model, is re-derived using this approach and is compared with the new experimental plasma equilibrium response data obtained from Ohmic and neutral beam injection discharges in the JT-60U tokamak. In order to remove any bias from the comparison between modelled and measured plasma responses, the electromagnetic response model without plasma was first carefully tuned against experimental data, using a parametric approach, for which different cost functions for quantifying model agreement were explored. This approach additionally provides new indications of the accuracy to which various plasma parameters are known, and to the ordering of physical effects. Having taken these precautions when tuning the plasmaless model, an empirical estimate of the plasma self-inductance, the plasma resistance and its radial derivative could be established and compared with initial assumptions. Off-line tuning of the JT-60U controller is presented as an example of the improvements which might be obtained by using such a model of the plasma equilibrium response. (author)
DEFF Research Database (Denmark)
Jespersen, Kira V; Koenig, Julian; Jennum, Poul
2015-01-01
in the meta-analysis. The results of a random-effects meta-analysis revealed an effect in favour of music listening (mean difference (MD) -2.80; 95% confidence interval (CI) -3.42 to -2.17; Z = 8.77, P
Review of JT-60 experimental results from June to October, 1987
International Nuclear Information System (INIS)
1988-03-01
This is a prompt report on JT-60 experimental results from June to October, 1987. Experiments in hydrogen plasmas have been undertaken with up to 3.2 MA of plasma current in limiter discharges, 2.7 MA in divertor discharges, and 30 MW of total NB (H 0 → H + ) and RF injection power. In limiter discharges with ∼3 MA plasma current, the maximum central electron density of 1.3 x 10 20 m -3 and the energy confinement time of 0.15 - 0.18 sec were obtained with heating powers of 13 - 20 MW. The total plasma stored energy of 3.1 MJ, and n e (0)τ E of 1.4 - 1.8 x 10 19 m -3 sec were achieved. The best set of parameters achieved is n e (0)τ E = 1.8 x 10 19 m -3 sec and T i (0) = 3.7 KeV at plasma current of 3.2 MA. By applying deutrium discharge condition, n e (0)τ E and T i (0) enter the JT-60 target area determined by Atomic Energy Commission. Many short periods (50 - 100 ms) of H-mode phase are found in outside X-point divertor discharges with NB or NB + RF (LH or IC) heating power of more than 16 MW, although at present the energy confinement improvement is limited to within 10 %. In combined LH and NB heating of low-n-bar e discharge, the plasma stored energy increases with the same rate as NB heating only, with preferential absorption of LH wave to the high energy beam ions. In combined NB and on-axis ICRF heating of low-n-bar e discharge, a high incremental energy confinement time is obtained, with strong high energy beam ion acceleration and electron heating in the central region of the plasma. (author)
Fabrication and performance tests of a prototype in-situ coating machine for JT-60
International Nuclear Information System (INIS)
Obara, Kenjiro; Abe, Tetsuya; Murakami, Yoshio
1987-09-01
Prior to the design and construction of the JT-60's in-situ coating device, a prototype machine was fabricated and tested to confirm the applicability of proposed driving methods and mechanical elements to the device which would be operated in very severe conditions including high ambient temperature and high vacuum. The machine basically consists of an in-vessel manipulator, a fiberscope and an ohmically heated titanium evaporator. From the test results, we recommended to use the combination of Inconel 625 and a self-lubricating alloy for the solid-lubricated bearings and MoS 2 -coated Inconel 625 for the solid-lubricated gears. It was also found that TiC coating showed a effect for the prevention of welding between bolts and nuts. In order to optimize the operating parameters of the machine, many wall inspection tests and titanium evaporation tests were carried out in a large vacuum vessel by simulating the JT-60 conditions. (author)
Coprime solutions to ax = b (mod n)
Czech Academy of Sciences Publication Activity Database
Grošek, O.; Porubský, Štefan
2013-01-01
Roč. 7, č. 3 (2013), s. 217-224 ISSN 1862-2984 R&D Projects: GA ČR(CZ) GAP201/12/2351 Institutional support: RVO:67985807 Keywords : coprime solutions * random linear congruences Subject RIV: BA - General Mathematics
Czech Academy of Sciences Publication Activity Database
Novotný, Karel
2015-01-01
Roč. 25, č. 2 (2015), s. 217-229 ISSN 1591-9625 R&D Projects: GA ČR(CZ) GA15-10832S Institutional support: RVO:67985955 Keywords : phenomenon * reduction * givenness * interpretation * hermeneutics Subject RIV: AA - Philosophy ; Religion
International Nuclear Information System (INIS)
Becchetti, F.D.; Harvey, B.G.; Kovar, D.; Mahoney, J.; Maguire, C.; Scott, D.K.
1975-01-01
The neutron levels in 209 Pb have been studied with the 208 Pb( 16 O, 15 O) reaction at a bomdarding energy of 139 MeV. Spectroscopic factors (S) have been deduced using a finite-range distorted-wave Born approximation (DWBA) with recoil. The 2g 9 / 2 , 1i 11 / 2 , 2g 7 / 2 , and 3d 3 / 2 levels are found to have S approximately-greater-than 0.9 while S approx. = 0.7 for the 1j 15 / 2 level at 1.4 MeV excitation. Evidence is found for other 1j 15 / 2 fragments being at 3.05 MeV and approx. 3.8 MeV with S approx. = 0.08 and 0.26, respectively, which would place the centroid of the 1j 15 / 2 level at E/subx/ approx. = 2.2 MeV. DWBA predicts a shift in the maxima of the angular distributions as a function of Q value which is not observed experimentally. A comparison with the proton transfer reaction 208 Pb( 16 O, 15 N) 209 Bi has been used to deduce the geometrical parameters of a neutron shell model potential appropriate for nuclei with A approximately-greater-than 200. The parameters of this Wood-Saxon potential are: V/subR/=-50.5 MeV,r/subR/=1.19 fm, a/subR/=0.75 fm, V)=-5.5 MeV, r)=1.01 fm, and a)=0.75 fm
Directory of Open Access Journals (Sweden)
de Koning Charles B
2008-01-01
Full Text Available Abstract Background Prior work from these laboratories has centred on the development of enaminones as versatile intermediates for the synthesis of alkaloids and other nitrogen-containing heterocycles. In this paper we describe the enantioselective synthesis of indolizidine and quinolizidine analogues of bicyclic amphibian alkaloids via pyrrolidinylidene- and piperidinylidene-containing enaminones. Results Our previously reported synthesis of racemic 8-epi-indolizidine 209B has been extended to the laevorotatory enantiomer, (--9. Attempts to adapt the synthetic route in order to obtain quinolizidine analogues revealed that a key piperidinylidene-containing enaminone intermediate (+-28 was less tractable than its pyrrolidinylidene counterpart, thereby necessitating modifications that included timing changes and additional protection-deprotection steps. A successful synthesis of [(1S,4R,9aS-4-pentyloctahydro-2H-quinolizin-1-yl]methanol (--41 from the chiral amine tert-butyl (3R-3-{benzyl [(1R-1-phenylethyl]amino}octanoate (+-14 was achieved in 14 steps and an overall yield of 20.4%. Conclusion The methodology reported in this article was successfully applied to the enantioselective synthesis of the title compounds. It paves the way for the total synthesis of a range of cis-5,8-disubstituted indolizidines and cis-1,4-disubstituted quinolizidines, as well as the naturally occurring trans-disubstituted alkaloids.
A coil test facility for the cryogenic tests of the JT-60SA TF coils
International Nuclear Information System (INIS)
Chantant, M.; Genini, L.; Bayetti, P.; Millet, F.; Wanner, M.; Massaut, V.; Corte, A. Della; Ardelier-Desage, F.; Catherine-Dumont, V.; Dael, A.; Decool, P.; Donati, A.; Duchateau, J.L.; Garibaldi, P.; Girard, S.; Hatchressian, J.C.; Fejoz, P.; Jamotton, P.; Jourdheuil, L.; Juster, F.P.
2011-01-01
In the framework of the Broader Approach Activities, the EU will deliver to Japan the 18 superconducting coils, which constitute the JT-60SA Toroidal field magnet. These 18 coils, manufactured by France and Italy, will be cold tested before shipping to Japan. For this purpose, the European Joint Undertaking for ITER, the Development of Fusion Energy ('Fusion for Energy', F4E) and the European Voluntary Contributors are collaborating to design and set-up a coil test facility (CTF) and to perform the acceptance test of the 18 JT-60SA Toroidal Field (TF) coils. The test facility is designed to test one coil at a time at nominal current and cryogenic temperature. The test of the first coil of each manufacturer includes a quench triggered by increasing the temperature. The project is presently in the detailed design phase.
Progress of data processing system in JT-60 utilizing the UNIX-based workstations
International Nuclear Information System (INIS)
Sakata, Shinya; Kiyono, Kimihiro; Oshima, Takayuki; Sato, Minoru; Ozeki, Takahisa
2007-07-01
JT-60 data processing system (DPS) possesses three-level hierarchy. At the top level of hierarchy is JT-60 inter-shot processor (MSP-ISP), which is a mainframe computer, provides communication with the JT-60 supervisory control system and supervises the internal communication inside the DPS. The middle level of hierarchy has minicomputers and the bottom level of hierarchy has individual diagnostic subsystems, which consist of the CAMAC and VME modules. To meet the demand for advanced diagnostics, the DPS has been progressed in stages from a three-level hierarchy system, which was dependent on the processing power of the MSP-ISP, to a two-level hierarchy system, which is decentralized data processing system (New-DPS) by utilizing the UNIX-based workstations and network technology. This replacement had been accomplished, and the New-DPS has been started to operate in October 2005. In this report, we describe the development and improvement of the New-DPS, whose functions were decentralized from the MSP-ISP to the UNIX-based workstations. (author)
Characteristics of large scale ionic source for JT-60
Energy Technology Data Exchange (ETDEWEB)
Fujiwara, Yukio; Honda, Atsushi; Inoue, Takashi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment] [and others
1997-02-01
The Neutral Beam Injection (NBI) apparatus is expected for important role sharing apparatus to realize the plasma electric current drive and the plasma control in not only temperature upgrading of the plasma but also Tokamak nuclear fusion reactor for the next generation such as JT-60, ITER and so forth. Japan Atomic Energy Research Institute has developed the ionic source with high energy and large electric current for about 10 years. Some arrangement tests of the large negative ion source for JT-60 No. 1 were executed from June to October, 1995. As a series of arrangement tests, 400 KeV and 13.5 A of deuterium negative ion beam was successfully accelerated for 0.12 sec. under 0.22 Pa of low gas pressure. And, it was elucidated that electron electric current could be controlled efficiently even in deuterium negative ion beam. Here is described on the testing results in details. (G.K.)
FastStats: Oral and Dental Health
... What's this? Submit Button NCHS Home Oral and Dental Health Recommend on Facebook Tweet Share Compartir Data ... States, 2016, table 60 [PDF – 9.8 MB] Dental visits Percent of children aged 2-17 years ...
Review of JT-60U experimental results from February to October, 1995
International Nuclear Information System (INIS)
1996-03-01
Renewed theme group organization started from October 1994 for the upcoming experiments in JT-60U. This regime has three theme groups each of which is composed of two sub-theme groups as; (1) Plasma Operation Theme (Leader Y. Neyatani) with Operation Sub-Theme and Disruption Sub-Theme, (2) High Performance (Leader S. Ishida) with Confinement and MHD Sub-Theme and High Energy Particle Sub-Theme and (3) Steady State Theme (Leader A. Sakasai) with Current Drive Sub-Theme and Divertor Sub-Theme. The main results from the JT-60U experiments in 1995 are summarized in the overviews of the three theme group activities. (J.P.N.)
Review of JT-60U experimental results from February to October, 1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
Renewed theme group organization started from October 1994 for the upcoming experiments in JT-60U. This regime has three theme groups each of which is composed of two sub-theme groups as; (1) Plasma Operation Theme (Leader Y. Neyatani) with Operation Sub-Theme and Disruption Sub-Theme, (2) High Performance (Leader S. Ishida) with Confinement and MHD Sub-Theme and High Energy Particle Sub-Theme and (3) Steady State Theme (Leader A. Sakasai) with Current Drive Sub-Theme and Divertor Sub-Theme. The main results from the JT-60U experiments in 1995 are summarized in the overviews of the three theme group activities. (J.P.N.).
VA/DoD Joint Executive Council Fiscal Year 2010
2010-01-01
forced the cancellation of both courses this FY. Training was rescheduled for November 2010. Efforts to leverage patient reception exercise...private sector. The project will allow the 3rd MDG to contract for one anesthesiologist and one support nurse . Cost: $1,217,600 James A. Haley...Staffing requirements are two registered nurses , four dialysis technicians, and one administrative technician. Cost: $1,790,750 San Diego VAMC/NMC San
1988-07-01
macrophytes; I. Depth distribution and shade tolerance. New Phytology 69:205-215. Spence, D. H. N., and J. Crystal.. 1970b. Photosynthesis and zonation of...freshwater macrophytes; II. Adaptability of species of deep and shallow % water. New Phytology 69:217-227. Spencer, D. F., and L. W. J. Anderson. 1986
International Nuclear Information System (INIS)
Kamada, Yutaka; Hosogane, Nobuyuki; Hirayama, Toshio; Tsunematsu, Toshihide
1990-05-01
This report studies mainly the density limit for a series of gas- and pellet-fuelled limiter discharges in JT-60. With the pellet injection into high-current/low-q (q(a)=2.3∼2.5) discharges, the Murakami factor reaches up to 10∼13 x 10 19 m -2 T -1 . The values are about factors of 1.5∼2.0 higher than those for usual gas-fuelled discharges. The pellet injected discharges have high central density, whereas the electron density in the outer region (a/2 abs and n e 2 (r=50 cm) x Z eff (r=50 cm). (author)
Optimal Day-Ahead Scheduling of a Hybrid Electric Grid Using Weather Forecasts
2013-12-01
with 214 turbines [22]. In July 2011, the DoD declared that a complete study of 217 wind farm projects proposed in 35 states and Puerto Rico found...14. SUBJECT TERMS Hybrid electric grid , Microgrid , Hybrid renewable energy system , energy management center, optimization, Day...electric grid. In the case of a hybrid electric grid (HEG), or hybrid renewable energy system (HRES) where the microgrid can be connected to the commercial
The current study compares the faunistic composition and the spatial ...
African Journals Online (AJOL)
spamer
217. SUAU, P. 1981 – Campaña “MEDITERRÁNEO II” (Marzo. 1977). Datos informativos Inst. Investnes pesq. 8: 240 pp. WURTZ, M., MATRICARDI, G. and P. BELCARI 1992 – Distri- bution and abundance of the octopus Eledone cirrhosa in.
Paolini, Marco; Keeser, Daniel; Ingrisch, Michael; Werner, Natalie; Kindermann, Nicole; Reiser, Maximilian; Blautzik, Janusch
2015-05-01
Little research exists on the influence of a magnetic resonance imaging (MRI) head coil's channel count on measured resting-state functional connectivity. To compare a 32-element (32ch) and an 8-element (8ch) phased array head coil with respect to their potential to detect functional connectivity within resting-state networks. Twenty-six healthy adults (mean age, 21.7 years; SD, 2.1 years) underwent resting-state functional MRI at 3.0 Tesla with both coils using equal standard imaging parameters and a counterbalanced design. Independent component analysis (ICA) at different model orders and a dual regression approach were performed. Voxel-wise non-parametric statistical between-group contrasts were determined using permutation-based non-parametric inference. Phantom measurements demonstrated a generally higher image signal-to-noise ratio using the 32ch head coil. However, the results showed no significant differences between corresponding resting-state networks derived from both coils (p coil does not offer any significant advantages in detecting ICA-based functional connectivity within RSNs. © The Foundation Acta Radiologica 2015 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.
Comparison of Resistance to Water Stress of Two Wheat Cultivars
Czech Academy of Sciences Publication Activity Database
Procházková, Dagmar; Wilhelmová, Naděžda
2002-01-01
Roč. 481, - (2002), s. 217-221 ISSN 1230-0810 R&D Projects: GA ČR GA522/01/0846 Institutional research plan: CEZ:AV0Z5038910 Keywords : drought * antioxidative enzymes * Triticum aestivum L. Subject RIV: GE - Plant Breeding
International Nuclear Information System (INIS)
Zhu, Liangliang; Xiao, Ling; Xia, Yangliu; Zhou, Kun; Wang, Huili; Huang, Minyi; Ge, Guangbo; Wu, Yan; Wu, Ganlin; Yang, Ling
2015-01-01
This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K m values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V max values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V max from 0.016 to 0.81 nmol/min/mg, while lifting K m in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K A , α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the activity of UGT1A4
Energy Technology Data Exchange (ETDEWEB)
Zhu, Liangliang; Xiao, Ling [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Xia, Yangliu [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Zhou, Kun [College of Pharmacy, Liaoning University of Traditional Chinese Medicine, Dalian 116600 (China); Wang, Huili; Huang, Minyi [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Ge, Guangbo, E-mail: geguangbo@dicp.ac.cn [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Wu, Yan; Wu, Ganlin [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Yang, Ling, E-mail: yling@dicp.ac.cn [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China)
2015-03-01
This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K{sub m} values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V{sub max} values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V{sub max} from 0.016 to 0.81 nmol/min/mg, while lifting K{sub m} in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K{sub A}, α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the
Design optimization of JT-60SU for steady-state advanced operation
International Nuclear Information System (INIS)
Ushigusa, K.; Kurita, G.; Toyoshima, N.
2001-01-01
Design optimization of JT-60SU has been done for a steady-state advanced operation. A transport code simulation indicates that a fully non-inductive reversed shear plasmas with fractions of 70% of the bootstrap current and 30% of beam driven current can be sustained for more than 1,000s without any additional control. Investigations have been progressed on MHD stability, vertical positional stability and dynamics of the vertical displacement events. Significant progress has been achieved in the R and D of Nb 3 Al superconducting wires, low induced activation material (Fe-Cr-Mn steel). A design improvement has been made in TF coils to reduce a local stress on radial disk. Dynamic behaviors of the tokamak machine have been analyzed at emergency events such as an earthquake. (author)
Active Control of Inlet Noise on the JT15D Turbofan Engine
Smith, Jerome P.; Hutcheson, Florence V.; Burdisso, Ricardo A.; Fuller, Chris R.
1999-01-01
This report presents the key results obtained by the Vibration and Acoustics Laboratories at Virginia Tech over the year from November 1997 to December 1998 on the Active Noise Control of Turbofan Engines research project funded by NASA Langley Research Center. The concept of implementing active noise control techniques with fuselage-mounted error sensors is investigated both analytically and experimentally. The analytical part of the project involves the continued development of an advanced modeling technique to provide prediction and design guidelines for application of active noise control techniques to large, realistic high bypass engines of the type on which active control methods are expected to be applied. Results from the advanced analytical model are presented that show the effectiveness of the control strategies, and the analytical results presented for fuselage error sensors show good agreement with the experimentally observed results and provide additional insight into the control phenomena. Additional analytical results are presented for active noise control used in conjunction with a wavenumber sensing technique. The experimental work is carried out on a running JT15D turbofan jet engine in a test stand at Virginia Tech. The control strategy used in these tests was the feedforward Filtered-X LMS algorithm. The control inputs were supplied by single and multiple circumferential arrays of acoustic sources equipped with neodymium iron cobalt magnets mounted upstream of the fan. The reference signal was obtained from an inlet mounted eddy current probe. The error signals were obtained from a number of pressure transducers flush-mounted in a simulated fuselage section mounted in the engine test cell. The active control methods are investigated when implemented with the control sources embedded within the acoustically absorptive material on a passively-lined inlet. The experimental results show that the combination of active control techniques with fuselage
2016-06-10
Armstrong, 135. 132 William E. Burrows , By Any Means Necessary: America’s Secret Air War in the Cold War (New York: Farrar, Straus, and Giroux, 2001...216 Captain Larry Seaquist, USN (Ret.) interview by Thomas P. Ehrhard, 25 May 1999, quoted in Ehrhard, 359. 217 Lehman, 339...D. Unmanned Aerial Systems: A Historical Perspective. Ft. Leavenworth, KS: Combat Studies Institute Press, September 2010. Burrows , William E. By
High performance experiments in JT-60U reversed shear discharges
International Nuclear Information System (INIS)
Fujita, T.; Kamada, Y.; Ishida, S.
2001-01-01
The operation of JT-60U reversed shear discharges has been extended to a high plasma current, low-q regime keeping a large radius of the internal transport barrier (ITB) and the record value of equivalent fusion multiplication factor in JT-60U, Q DT eq =1.25, has been achieved at 2.6 MA. Operational schemes to reach the low-q regime with good reproducibility have been developed. The reduction of Z eff was obtained in the newly installed W-shaped pumped divertor. The beta limit in the low-q min regime, which limited the performance of L-mode edge discharges, has been improved in H-mode edge discharges with a broader pressure profile, which was obtained by power flow control with ITB degradation. Sustainment of ITB and improved confinement for 5.5 seconds has been demonstrated in an ELMy H reversed shear discharge. (author)
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Removal. 1280.209 Section 1280.209 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...
Experimental study of radiation losses on the JT-60 tokamak
International Nuclear Information System (INIS)
Nishitani, Takeo
1990-06-01
Bolometric measurement system and associated diagnostics, soft x-ray pulse-height-analyzer, soft x-ray intensity and Balmer α line measurement systems, were developed to investigate the radiation losses of the JT-60 plasmas. The bolometric measurement is the most important diagnostics in the radiation loss study. The soft x-ray pulse-height-analyzer is useful to estimate the metallic impurity concentration, and the soft x-ray intensity and Balmer α line measurements are monitors of radiation in x-ray region and particle recycling in the plasma edge, respectively. In JT-60, the marfe has been observed frequently in high-Ip and high density limited discharges with NB heating after the replacement of the first wall from TiC coated molybdenum tiles to graphite ones. The threshold electron density of the marfe onset increased with the NB power. The empirical scaling of the marfe onset taking account of the NB power was obtained. This scaling was useful to predict the marfe onset condition in NB heated discharges on JT-60. The marfe was modelled based on the radiative thermal instability. The simple model can explain the marfe onset condition. The radiated power from the plasma with marfe was about 90 % of the absorbed power. Both stored energy and central electron temperatures did not change by the marfe onset in spite of the such intense radiation loss. Finally, this study revealed that the most clean plasma was obtained in the metallic first wall with the divertor on JT-60. This fact is suggesting the capability of the metallic material for the first wall of next devices. Enhance radiation localized in the peripheral plasma such as marfe and IDC does not degrade the core plasma confinement or somewhat improves it, so that marfe and IDC are suitable operational regime in the high density region for future devices because they have strong remote-radiative-cooling-effect. (J.P.N.)
Web-based Java application to advanced JT-60 Man-Machine Interfacing System for remote experiments
International Nuclear Information System (INIS)
Totsuka, Toshiyuki; Suzuki, Yoshio; Sakata, Shinya; Oshima, Takayuki; Iba, Katsuyuki
2008-01-01
Since remote participation in ITER experiments is planned, it is expected to demonstrate that the JT-60SA experiment is controlled from a Japanese remote experiment center located in Rokkasho-mura, Aomori-ken, Japan as a part of the ITER-BA project. Functions required for this experiment are monitoring of the discharge sequence status, handling of the discharge parameter, checking of experiment data, and monitoring of plant data, all of which are included in the existing JT-60 Man-Machine Interfacing System (MMIF). The MMIF is now only available to on-site users at the Naka site due to network safety. The motivation for remote MMIF is prompted by the issue of developing and achieving compatibility with network safety. The Java language has been chosen to implement this task. This paper deals with details of the JT-60 MMIF for the remote experiment that has evolved using the Java language
Determination of Some Heavy Metals In The Environment of SADAT Industrial City
International Nuclear Information System (INIS)
Nassef, M.; EI-Tahawy, M.S.; Hannigan, R.; EL Sayed, K.A.
2007-01-01
The aim of this study was to assess the heavy metal concentration in the soil and the groundwater of Sadat City in Egypt and its relation to the highly developed industrial activities in that area. The levels of Pb, Cr, Cu, Cd, Zr, and V were determined in the groundwater samples (as drinking water supplies) and also the same elements in the soil samples. 10 soil samples and 18 groundwater samples were collected from the city. The soil and the groundwater samples were analysed using Inductively Coupled Plasma Mass Spectrometry (ICP-MS). The concentration of Pb, Cr, Cu, Cd, Zr, and V measured (in ppm) in the soil samples ranged from 0.48 to 11.3, 0.36 to 2.56, 43.7 to 304.0, 0.34 to 2.64, 0.209 to 21.7, and 0.10 to 17.0, respectively. The concentration of Pb, Cr, Cu, Cd, Zr, and V measured (in ppb) in the groundwater samples of all studied wells ranged from 0.11 to 41.32, 0.10 to 2.63, 0.14 to 5.76, 0.03 to 21.7, 11.4 to 134, and 0.08 to 5.08, respectively. The levels of Pb and Zr exceeded the threshold limits set by the WHO health-based guideline for drinking water in some studied groundwater wells
40 CFR 80.217 - How does a refiner or importer apply for the GPA standards?
2010-07-01
... annual average sulfur standard for gasoline produced for use in the GPA for the 2004 through 2006 annual... for gasoline produced for use in the GPA. (d) If EPA finds that a refiner or importer provided false... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Geographic Phase...
Biochemical composition of zooplankton from the northern Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Bhat, K.L.; Sreepada, R.A; Ansari, Z.A
stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India
Digital Repository Service at National Institute of Oceanography (India)
Ingole, B.S.; Ansari, Z.A; Parulekar, A
stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-01-0068 ref|ZP_01038050.1| Nitric oxide reductase large subunit, cytochrome b [Rose...ovarius sp. 217] gb|EAQ23442.1| Nitric oxide reductase large subunit, cytochrome b [Roseovarius sp. 217] ZP_01038050.1 2.6 29% ...
DEFF Research Database (Denmark)
Lähteenmäki, A.; Poutanen, T.; Natoli, P.
2011-01-01
The data reported in Planck's Early Release Compact Source Catalogue (ERCSC) are exploited to measure the number counts (dN/dS) of extragalactic radio sources at 30, 44, 70, 100, 143 and 217 GHz. Due to the full-sky nature of the catalogue, this measurement extends to the rarest and brightest sou...
Funkce rekultivované krajiny po těžbě hnědého uhlí
Czech Academy of Sciences Publication Activity Database
Pecharová, E.; Procházka, J.; Wotavová, K.; Sýkorová, Z.; Pokorný, Jan
3,21, č. 3 (2004), s. 217-224 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape * mining * flow of matter and water Subject RIV: DO - Wilderness Conservation
Brand, Cara L; Cattani, M Victoria; Kingan, Sarah B; Landeen, Emily L; Presgraves, Daven C
2018-04-23
Crossing over between homologous chromosomes during meiosis repairs programmed DNA double-strand breaks, ensures proper segregation at meiosis I [1], shapes the genomic distribution of nucleotide variability in populations, and enhances the efficacy of natural selection among genetically linked sites [2]. Between closely related Drosophila species, large differences exist in the rate and chromosomal distribution of crossing over. Little, however, is known about the molecular genetic changes or population genetic forces that mediate evolved differences in recombination between species [3, 4]. Here, we show that a meiosis gene with a history of rapid evolution acts as a trans-acting modifier of species differences in crossing over. In transgenic flies, the dicistronic gene, mei-217/mei-218, recapitulates a large part of the species differences in the rate and chromosomal distribution of crossing over. These phenotypic differences appear to result from changes in protein sequence not gene expression. Our population genetics analyses show that the protein-coding sequence of mei-218, but not mei-217, has a history of recurrent positive natural selection. By modulating the intensity of centromeric and telomeric suppression of crossing over, evolution at mei-217/-218 has incidentally shaped gross differences in the chromosomal distribution of nucleotide variability between species. We speculate that recurrent bouts of adaptive evolution at mei-217/-218 might reflect a history of coevolution with selfish genetic elements. Copyright © 2018 Elsevier Ltd. All rights reserved.
31 CFR 0.217 - Personal financial interests.
2010-07-01
... hold the following financial interests without violating 18 U.S.C. 208(a): (1) The stocks or bonds of a publicly traded corporation with a value of $1000 or less; and (2) The stocks or bonds in the investment portfolio of a diversified mutual fund in which an employee has invested. (b) The Department has found that...
48 CFR 217.7103-4 - Emergency work.
2010-10-01
..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... soliciting offers, may issue a written job order to a contractor that has previously executed a master...
International Nuclear Information System (INIS)
Kouchakdjian, M.; Patel, D.J.; Bodepudi, V.; Shibutani, S.; Eisenberg, M.; Johnson, F.; Grollman, A.P.
1991-01-01
Proton NMR studies are reported on the complementary d(C1-C2-A3-C4-T5-A6-oxo-G7-T8-C9-A10-C11-C12)·d(G13-G14-T15-G16-A17-A18-T19-A20-G21-T22-G23-G24) dodecanucleotide duplex (designated 8-oxo-7H-dG·dA 12-mer), which contains a centrally located 7-hydro-8-oxodeoxyguanosine (8-oxo-7H-dG) residue, a group commonly found in DNA that has been exposed to ionizing radiation or oxidizing free radicals. From the NMR spectra it can be deduced that this moiety exists as two tautomers, or gives rise to two DNA conformations, that are in equilibrium and that exchange slowly. The present study focuses on the major component of the equilibrium that originates in the 6,8-dioxo tautomer of 8-oxo-7H-dG. The authors have assigned the exchangeable NH1, NH7, and NH 2 -2 base protons located on the Watson-Crick and Hoogsteen edges of 8-oxo-7H-dG7 in the 8-oxo-7H-dG·dA 12-mer duplex, using an analysis of one- and two-dimensional nuclear Overhauser enhancement (NOE) data in H 2 O solution. They were able to detect a set of intra- and interstrand NOEs between protons (exchangeable and nonexchangeable) on adjacent residues in the d(A6-oxo-G7-T8)·d(A17-A18-T19) trinucleotide segment centered about the lesion site that establishes stacking of the oxo-dG7(syn)·dA(anti) pair between stable Watson-Crick dA6·dT19 and dT8·A17 base pairs with minimal perturbation of the helix. The structural studies demonstrate that 8-oxo-7H-dG(syn)·dA(anti) forms a stable pair in the interior of the helix, providing a basis for the observed incorporation of dA opposite 8-oxo-7H-dG when readthrough occurs past this oxidized nucleoside base
Vacuum pumping system for the JT-60 radio-frequency heating system
International Nuclear Information System (INIS)
Yokokura, Kenji; Ikeda, Yoshitaka; Imai, Tuyoshi; Suganuma, Kazuaki; Nagashima, Takashi
1988-01-01
The basic design requirements set up for the JT-60 radio-frequency heating system included: (1) rapid pumping of gas released upon application of a radio-frequency power to maintain the pressure in the launchers at 10 -2 - 10 -3 Pa or less, (2) incorporation of a gas analysis system that can operate under a strong field and high pressure (>10 -2 Pa) to permit remote controlled data collection and processing, and (3) low cost, multiple functions and high reliability. The vacuum pumping system, consisting of three units for low hybrid radio-frequency (LHRF) and one unit for ion cyclotron radio-frequency (ICRF), is connected to each launcher provided at the four ports of JT-60. The LHRF unit is composed of a main pump, an alumina joint for electrical insulation from the launcher, a metallic gate valve for isolation from the JT-60 vacuum region, and various vacuum gauges. Only a turbo-molecular pump is used for the ICRF system because a large-scale differential pumping is not required. A gas measuring system is incorporated which consists of a mass filter, personal computer, turbo-molecular pump, and variable flow valve equipped with an APG control. This system is designed to identify and make use of gas impurities released during the launcher aging process. The control system employed consists of a personal computer, interlock control board, data logger and other devices such as vacuum gages. (Nogami, K.)
24 CFR 200.217 - Filing of previous participation certificate on prescribed form.
2010-04-01
... occurrence of any of the events below: (1) With an Application for a Site Appraisal/Market Analysis Letter, Feasibility Letter, Conditional Commitment for Mortgage Insurance, or Firm Commitment for Mortgage Insurance... change ownership of a property regulated or controlled by a HUD “use agreement”; (8) With an application...
Seroprevalencia de Leptospira spp en caninos y humanos de tres barrios de Tunja, Colombia
Directory of Open Access Journals (Sweden)
Soledad Bermúdez C.
2010-12-01
Full Text Available Objetivo. Establecer la seroprevalencia de Leptospira spp., en la población canina y humana de barrios marginados en la ciudad de Tunja. Materiales y métodos. Se muestrearon 61 sueros caninos en los barrios marginales de la ciudad, parlelamente se muestrearon y encuestaron 46 humanos propietarios de las mascotas. Para el procesamiento de las muestras se empleó la técnica de microaglutinación-lisis (MAT para seis serotipos de Leptospira spp. Resultados. Se encontró una seropositividad del 67.2% en la población de caninos muestreada, la seroprevalencia por serovares arrojada fue del 14.8% para L. icterohemorrágica; 8.2% para L. pomona; 9.85% para L. hardjo; 18% para L. canicola y 6.6% para L. automnalis y 9.8% para L. sejroë. Para los humanos la prevalencia fue del 21.7%, por serovares se encontró que L. automnalis tiene 4.35%; L. hardjo 2.17%, L. sejroë tiene 6.52%, L. icterohaemorragiae 6.52% y L. canicola 2.17%. Conclusiones. Estos resultados demostraron una gran problemática de alto impacto ya que en contraste con prevalencias de otros municipios de Colombia, mostró una elevada positividad en esta zona y dejan una gran preocupación por una rápida diseminación que podria suceder debido al contacto entre los diferentes vectores como lo roedores y caninos.
Czech Academy of Sciences Publication Activity Database
Gacheva, G. V.; Gigova, L. G.; Ivanova, N. Y.; Pilarski, P. S.; Lukavský, Jaromír
2013-01-01
Roč. 61, č. 3 (2013), s. 217-227 ISSN 1322-0829 R&D Projects: GA TA ČR TE01020080 Institutional support: RVO:67985939 Keywords : antioxidant enzymes * Gloeocapsa * temperature, light Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.955, year: 2013