WorldWideScience

Sample records for jt8d-209 217 217a

  1. 76 FR 8620 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Turbofan Engines

    Science.gov (United States)

    2011-02-15

    ... inspection AD 97-17-04R1, and to allow automatic eddy current inspection per engine manual Section 72-33-31.... That AD currently requires revisions to the engine manufacturer's time limits section (TLS) to include... modifies the TLS of the manufacturer's engine manual and an air carrier's approved continuous airworthiness...

  2. Validation of the Konsung QD217A for clinical use and self-measurement according to the European Society of Hypertension International Protocol.

    Science.gov (United States)

    Wu, Ning; Zhang, Xuezhong; Wang, Wen; Zhang, Hongye

    2015-08-01

    This study aimed to evaluate the accuracy of the automated oscillometric upper arm blood pressure (BP) monitor Konsung QD217A for home BP monitoring according to the European Society of Hypertension International Protocol revision 2010. Three trained observers validated the performance of these devices by comparing the measurements obtained from these devices with those taken using a standard mercury sphygmomanometer. Systolic blood pressure (SBP) and diastolic blood pressure (DBP) were sequentially measured in 33 participants using a standard mercury sphygmomanometer and the Konsung QD217A device. A total of 99 pairs of comparisons were obtained from 33 participants. The QD217A device achieved the targets in part 1 of the validation study. The number of absolute differences between the device and the observers within a range of 5, 10 and 15 mmHg was 70/99, 92/99 and 96/99, respectively, for SBP and 80/99, 94/99 and 99/99, respectively, for DBP. The device also achieved the targets in part 2 of the validation study. A total of 27 and 31 participants for SBP and DBP, respectively, showed at least two of the three device-observers differences within 5 mmHg (required≥24). The number of participants without device-observer difference within 5 mmHg was one for SBP and one for DBP (required≤3). The Konsung upper arm BP monitor QD217A has passed the International Protocol requirements and it can be recommended for clinical use and self-measurement in adults. Copyright © 2015 Wolters Kluwer Health, Inc. All rights reserved.

  3. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

    2015-01-02

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  4. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr−/− mice

    International Nuclear Information System (INIS)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung; Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog; Lee, Yun Mi; Sohn, Eunjin; Kim, Jin Sook

    2015-01-01

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr −/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr −/− ) mice. In three-week-old male Vldlr −/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr −/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC 50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB

  5. MO-E-217A-01: Contrast-Enhanced Spectral Mammography - Physical Aspects and QA.

    Science.gov (United States)

    Yaffe, M; Hill, M

    2012-06-01

    To describe the current state of dual energy contrast-enhanced digital mammography, to discuss those aspects of its operation that require evaluation or monitoring and to propose elements of a program for quality assurance of such systems. The principles of dual-energy contrast imaging will be discussed and tools and techniques for assessment of performance will be described. Many of the elements affecting image quality and dose performance in digital mammography (eg noise, system linearity, consistency of x-ray output and detector performance, artifacts) remain important. In addition, the ability to register images can influence the resultant image quality. The maintenance of breast compression thickness during the imaging procedure and calibration of the system to allow quantification of iodine in the breast represent new challenges to quality assurance. CESM provides a means of acquiring new information regarding tumor angiogenesis and may reveal some cancers that will not be detectable on digital mammography. It may also better demonstrate the extent of disease. The medical physicist must understand the dependence of image quality on physical factors. Implementation of a relevant QA program will be required if the promise of this new modality is to be delivered. © 2012 American Association of Physicists in Medicine.

  6. WE-E-217A-01: CAD: Quality Assurance of CAD Systems Implemented in Clinical Use.

    Science.gov (United States)

    Huo, Z

    2012-06-01

    We propose a new metric called Distance Discordance (DD), which is defined as the distance between two anatomic points from two moving images, which are co-located on some reference image, when deformed onto another reference image. To demonstrate the concept of DD, we created a reference software phantom which contains two objects. The first object (1) consists of a hollow box with a fixed size core and variable wall thickness. The second object (2) consists of a solid box of fixed size and arbitrary location. 7 different variations of the fixed phantom were created. Each phantom was deformed onto every other phantom using two B-Spline DIR algorithms available in Elastix and Plastimatch. Voxels were sampled from the reference phantom [1], which were also deformed from moving phantoms [2…6], and we find the differences in their corresponding location on phantom [7]. Each voxel results in a distribution of DD values, which we call distance discordance histogram (DDH). We also demonstrate this concept in 8 Head & Neck patients. The two image registration algorithms produced two different DD results for the same phantom image set. The mean values of the DDH were slightly lower for Elastix (0-1.28 cm) as compared to the values produced by Plastimatch (0-1.43 cm). The combined DDH for the H&N patients followed a lognormal distribution with a mean of 0.45 cm and std. deviation of 0.42 cm. The proposed distance discordance (DD) metric is an easily interpretable, quantitative tool that can be used to evaluate the effect of inter-patient variability on the goodness of the registration in different parts of the patient anatomy. Therefore, it can be utilized to exclude certain images based on their DDH characteristics. In addition, this metric does not rely on 'ground truth' or the presence of contoured structures. © 2012 American Association of Physicists in Medicine.

  7. Use of a genetically enhanced, pediocin-producing starter culture, Lactococcus lactis subsp. lactis MM217, to control Listeria monocytogenes in cheddar cheese

    NARCIS (Netherlands)

    Buyong, N; Kok, J; Luchansky, JB

    1998-01-01

    Cheddar cheese was prepared with Lactococcus lactis subsp, lactis MM217, a starter culture which contains pMC117 coding for pediocin PA-1, About 75 liters of pasteurized milk (containing ca, 3.6% fat) was inoculated with strain MM217 (ca, 10(6) CFU per ml) and a mixture of three Listeria

  8. 48 CFR 217.7104 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... and Health. (14) 252.217-7016, Plant Protection, as applicable. (b)(1) Incorporate in solicitations....217-7016, Plant Protection, in job orders where performance is to occur at the contractor's facility. ...

  9. 48 CFR 252.217-7009 - Default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Default. 252.217-7009... Clauses 252.217-7009 Default. As prescribed in 217.7104(a), use the following clause: Default (DEC 1991... of default to the Contractor, terminate the whole or any part of a job order if the Contractor fails...

  10. 45 CFR 150.217 - Preliminary determination.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Preliminary determination. 150.217 Section 150.217... Are Failing To Substantially Enforce HIPAA Requirements § 150.217 Preliminary determination. If, at... designees). (b) Notifies the State of CMS's preliminary determination that the State has failed to...

  11. 8 CFR 217.6 - Carrier agreements.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Carrier agreements. 217.6 Section 217.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217... may notify a carrier of the existence of a basis for termination of a carrier agreement under this...

  12. 22 CFR 217.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.4 Section 217.4... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.4 Discrimination... participation in, be denied the benefits of, or otherwise be subjected to discrimination under any program or...

  13. 7 CFR 1280.217 - Lamb purchases.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Lamb purchases. 1280.217 Section 1280.217 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE LAMB PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Assessments § 1280.217 Lamb purchases. (a...

  14. 22 CFR 217.45 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide...

  15. 49 CFR 238.217 - Side structure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Side structure. 238.217 Section 238.217 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.217 Side structure. Each passenger car shall comply with the following: (a) Side posts and...

  16. 22 CFR 217.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.1 Purpose. The purpose of this part is to... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 217.1 Section 217.1 Foreign Relations... the basis of handicap in any program or activity within the United States receiving Federal financial...

  17. 22 CFR 217.23 - New construction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...

  18. 48 CFR 252.217-7010 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...

  19. 27 CFR 24.217 - Vinegar stock.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Vinegar stock. 24.217 Section 24.217 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.217 Vinegar stock. Vinegar...

  20. Nuclear Data Sheets for A=217

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.

    2018-01-01

    The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For Tl-217, Pb-217, Pa-217, and U-217 nuclei, only information on the ground state is available. Levels in Bi-217 are known only from isomer decay following fragmentation reaction and those in At-217 and Rn-217 only from the a decay of Fr-221 and Ra-221, respectively. High spin levels in Ra-217 are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme.This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.

  1. 49 CFR 217.3 - Application.

    Science.gov (United States)

    2010-10-01

    ... general railroad system of transportation; or (2) Rapid transit operations in an urban area that are not... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 217.3 Section 217.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...

  2. 13 CFR 134.217 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...

  3. 14 CFR 145.217 - Contract maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to an...

  4. 22 CFR 217.21 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or activity...

  5. 22 CFR 217.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2) A...

  6. 49 CFR 229.217 - Fuel tank.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum... to the fuel tank safety requirements of § 238.223 or § 238.423 of this chapter. The Director of the...

  7. 40 CFR 86.217-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  8. 33 CFR 136.217 - Compensation allowable.

    Science.gov (United States)

    2010-07-01

    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.217 Compensation... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Compensation allowable. 136.217...

  9. 22 CFR 217.14 - Preemployment inquiries.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Preemployment inquiries. 217.14 Section 217.14 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... inquiries. (a) Except as provided in paragraphs (b) and (c) of this section, a recipient may not conduct a...

  10. 48 CFR 1252.217-72 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1252.217-72... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon...

  11. 49 CFR 397.217 - Waiver processing.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...

  12. 48 CFR 252.217-7002 - Offering property for exchange.

    Science.gov (United States)

    2010-10-01

    ... exchange. 252.217-7002 Section 252.217-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.217-7002 Offering property for exchange. As prescribed in 217.7005, use the following provision: Offering Property for Exchange (DEC 1991) (a) The property described in item...

  13. 14 CFR 217.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... passengers when traveling free or pursuant to token charges: (1) Directors, officers, employees, and others authorized by the air carrier operating the aircraft; (2) Directors, officers, employees, and others... remuneration. (This definition is for 14 CFR part 217 traffic reporting purposes and may differ from the...

  14. 31 CFR 800.217 - Hold.

    Science.gov (United States)

    2010-07-01

    ... and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.217 Hold. The terms hold(s) and holding mean legal or beneficial ownership, whether direct or indirect, whether through fiduciaries, agents, or other means. ...

  15. 25 CFR 217.6 - Method of casting votes.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Method of casting votes. 217.6 Section 217.6 Indians.... § 217.6 Method of casting votes. Within 30 days after an issue and any analysis provided for in §§ 217.4... superintendent in writing of the number of votes cast for and against the proposed or alternative solutions. If...

  16. 48 CFR 52.217-3 - Evaluation Exclusive of Options.

    Science.gov (United States)

    2010-10-01

    ... Options. 52.217-3 Section 52.217-3 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....217-3 Evaluation Exclusive of Options. As prescribed in 17.208(a), insert a provision substantially the same as the following in solicitations when the solicitation includes an option clause and does...

  17. 48 CFR 1552.217-70 - Evaluation of contract options.

    Science.gov (United States)

    2010-10-01

    ... options. 1552.217-70 Section 1552.217-70 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION... 1552.217-70 Evaluation of contract options. As prescribed in 1517.208(a), insert the following solicitation provision in Requests for Proposals when the solicitation contains options. Evaluation of Contract...

  18. 48 CFR 217.202 - Use of options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of options. 217.202... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.202 Use of options. (1) See PGI 217.202 for guidance on the use of options. (2) See 234.005-1 for limitations on the...

  19. 48 CFR 252.217-7001 - Surge option.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option (AUG 1992) (a) General. The Government has the option to— (1) Increase the quantity of supplies or...

  20. 20 CFR 217.25 - Who may cancel an application.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Who may cancel an application. 217.25 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.25 Who may cancel an application. An application may be cancelled by the claimant or a person described in § 217.17. If the claimant is deceased...

  1. 48 CFR 217.7404-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...

  2. 48 CFR 252.217-7016 - Plant protection.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Plant protection. 252.217... Clauses 252.217-7016 Plant protection. As prescribed in 217.7104(a), use the following clause: Plant Protection (DEC 1991) (a) The Contractor shall provide, for the plant and work in process, reasonable...

  3. 36 CFR 2.17 - Aircraft and air delivery.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2.17 Section 2.17 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are...

  4. 48 CFR 217.207 - Exercise of options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Exercise of options. 217..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.207 Exercise of options. (c) In addition to the requirements at FAR 17.207(c), exercise an option only after...

  5. 20 CFR 217.26 - How to cancel an application.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How to cancel an application. 217.26 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.26 How to cancel an application. An application may be cancelled under the following conditions: (a) Before an annuity is awarded. The application...

  6. 49 CFR 1544.217 - Law enforcement personnel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1544.217 Section 1544... AND COMMERCIAL OPERATORS Operations § 1544.217 Law enforcement personnel. (a) The following applies to... for law enforcement personnel meeting the qualifications and standards specified in §§ 1542.215 and...

  7. 5 CFR 532.217 - Appropriated fund survey jobs.

    Science.gov (United States)

    2010-01-01

    ... Laundry Worker 1 Food Service Worker 2 Cook 8 (e) A lead agency must obtain prior approval of OPM to add a... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Appropriated fund survey jobs. 532.217 Section 532.217 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS...

  8. 47 CFR 25.217 - Default service rules.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Default service rules. 25.217 Section 25.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... licenses to operate a satellite system in a frequency band granted after a domestic frequency allocation...

  9. 31 CFR 31.217 - Confidentiality of information.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality of information. 31.217 Section 31.217 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET... from a source other than the retained entity. (b) Prohibitions. The retained entity shall not: (1...

  10. 48 CFR 217.7506 - Spare parts breakout program.

    Science.gov (United States)

    2010-10-01

    ..., DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout program. 217.7506 Section 217.7506 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  11. 20 CFR 217.10 - Application filed after death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter. The...

  12. 48 CFR 3052.217-94 - Lay days (USCG).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Lay days (USCG). 3052.217... CLAUSES Text of Provisions and Clauses 3052.217-94 Lay days (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Lay Days (DEC 2003) (a) Lay day time...

  13. 48 CFR 1252.217-75 - Lay days.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1252.217-75... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-75 Lay days. As prescribed at (TAR) 48 CFR 1217.7001(c) and (e), insert the following clause: Lay Days (OCT 1994) (a) Lay day...

  14. 27 CFR 28.217 - Consignment, shipment, and delivery.

    Science.gov (United States)

    2010-04-01

    ... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.217 Consignment, shipment, and delivery. The consignment, shipment, and delivery of wines...

  15. 48 CFR 217.172 - Multiyear contracts for supplies.

    Science.gov (United States)

    2010-10-01

    ... law. For additional policies that apply only to multiyear contracts for weapon systems, see 217.173... requirements of law are met and there are no other statutory restrictions on using a multiyear contract for the... provisions in the contract do not include consideration of recurring manufacturing costs of the contractor...

  16. 48 CFR 52.217-5 - Evaluation of Options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Options. 52....217-5 Evaluation of Options. As prescribed in 17.208(c), insert a provision substantially the same as the following: Evaluation of Options (JUL 1990) Except when it is determined in accordance with FAR 17...

  17. 48 CFR 52.217-6 - Option for Increased Quantity.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option for Increased....217-6 Option for Increased Quantity. As prescribed in 17.208(d), insert a clause substantially the same as the following: Option for Increased Quantity (MAR 1989) The Government may increase the...

  18. 48 CFR 52.217-8 - Option To Extend Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option To Extend Services....217-8 Option To Extend Services. As prescribed in 17.208(f), insert a clause substantially the same as the following: Option To Extend Services (NOV 1999) The Government may require continued performance...

  19. 20 CFR 217.27 - Effect of cancellation.

    Science.gov (United States)

    2010-04-01

    ... ANNUITY OR LUMP SUM Cancellation of Application § 217.27 Effect of cancellation. When a person cancels an application the effect is the same as though an application was never filed. When an employee cancels his or her application, any application filed by the employee's spouse is also cancelled. However, a request...

  20. 49 CFR 1542.217 - Law enforcement personnel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used... the criminal laws of the State and local jurisdictions in which the airport is located— (1) A crime...

  1. 37 CFR 2.17 - Recognition for representation.

    Science.gov (United States)

    2010-07-01

    ..., registrant, or party (e.g., a corporate officer or general partner of a partnership). In the case of joint..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized Persons § 2.17 Recognition for representation. (a) Authority to practice in trademark cases. Only an...

  2. 48 CFR 217.7505 - Limitations on price increases.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Limitations on price... Acquisition of Replenishment Parts 217.7505 Limitations on price increases. This section provides implementing... award, on a sole source basis, a contract for any centrally managed replenishment part when the price of...

  3. 12 CFR 217.101 - Premiums on deposits.

    Science.gov (United States)

    2010-01-01

    ... from paying interest on a demand deposit. Premiums, whether in the form of merchandise, credit, or cash... AGAINST THE PAYMENT OF INTEREST ON DEMAND DEPOSITS (REGULATION Q) Interpretations § 217.101 Premiums on... that is not, directly or indirectly, related to or dependent on the balance in a demand deposit account...

  4. 48 CFR 217.7103 - Master agreements and job orders.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Master agreements and job... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103 Master agreements and job orders. ...

  5. 48 CFR 217.7103-3 - Solicitations for job orders.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitations for job... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103-3 Solicitations for job orders. (a) When a...

  6. 12 CFR 217.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ...(t) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12 CFR 20.4). [Reg... 217.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Reserve Act (12 U.S.C. 371a, 461, 505), section 7 of the International Banking Act of 1978 (12 U.S.C. 3105...

  7. 22 CFR 217.42 - Admissions and recruitment.

    Science.gov (United States)

    2010-04-01

    ... activity in question and (ii) alternate tests or criteria that have a less disproportionate, adverse effect... effects of past discrimination pursuant to § 217.6(a) or when a recipient is taking voluntary action to... base prediction equations on first year grades, but shall conduct periodic validity studies against the...

  8. 28 CFR 2.17 - Original jurisdiction cases.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Original jurisdiction cases. 2.17 Section... Original jurisdiction cases. (a) Following any hearing conducted pursuant to these rules, the Regional Commissioner may designate that a case should be decided as an original jurisdiction case. If the Regional...

  9. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

    Science.gov (United States)

    2010-04-01

    ... INTERPRETATIONS Statements of General Policy and Interpretations Under the Federal Power Act § 2.17 Price... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Price discrimination and anticompetitive effect (price squeeze issue). 2.17 Section 2.17 Conservation of Power and Water...

  10. 48 CFR 1252.217-80 - Department of Labor Safety and Health Regulations for Ship Repairing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Department of Labor Safety and Health Regulations for Ship Repairing. 1252.217-80 Section 1252.217-80 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-80...

  11. 48 CFR 1552.217-74 - Option for increased quantity-cost-plus-award-fee contract.

    Science.gov (United States)

    2010-10-01

    ... quantity-cost-plus-award-fee contract. 1552.217-74 Section 1552.217-74 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.217-74 Option for increased quantity—cost-plus-award-fee contract. As prescribed in 1517.208(e), insert this contract clause in cost-plus-award-fee term contracts when...

  12. 42 CFR 413.217 - Items and services included in the ESRD prospective payment system.

    Science.gov (United States)

    2010-10-01

    ... payment system. 413.217 Section 413.217 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT....217 Items and services included in the ESRD prospective payment system. The following items and services are included in the ESRD prospective payment system effective January 1, 2011: (a) Renal dialysis...

  13. 33 CFR 148.217 - How can a State be designated as an adjacent coastal State?

    Science.gov (United States)

    2010-07-01

    ... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD... General § 148.217 How can a State be designated as an adjacent coastal State? (a) Adjacent coastal States... as an adjacent coastal State in the notice may request to be designated as one if the environmental...

  14. 20 CFR 725.217 - Determination of dependency; surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving divorced spouse. 725.217 Section 725.217 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.217 Determination of dependency; surviving divorced spouse. An individual who is the miner...

  15. Investigation of octupole deformations in the Fr217 nucleus by yrast spectroscopy

    International Nuclear Information System (INIS)

    Hulne, S.

    1988-01-01

    The spectroscopic characteristics of the yrast levels of Fr217 are determined. The level scheme up to a value of J = (39/2 + ) for angular momentum and parity is established. The production of the Fr217 nucleus in a heavy ion collision reaction was only possible by using a radioactive Pb210 target. The method for preparing the target is described. The Fr217 nucleus belongs to the category of nuclei showing octupole effects. Mass A = 217 seems to be the lower limit of the region where these effects occur [fr

  16. 9 CFR 93.217 - Import permit and declaration for poultry.

    Science.gov (United States)

    2010-01-01

    ... poultry. 93.217 Section 93.217 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...

  17. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    Science.gov (United States)

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

  18. 49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?

    Science.gov (United States)

    2010-10-01

    ... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of this...

  19. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    International Nuclear Information System (INIS)

    Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming

    2016-01-01

    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  20. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail: lizm_1001@sina.com

    2016-02-26

    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  1. Studies of α-spectra in 221Fr, 217At, 213Bi and 213Po decays

    International Nuclear Information System (INIS)

    Chumin, V.G.; Fominykh, V.I.; Furyaev, T.A.; Gromov, K.Ya.; Jabber, J.K.; Kalyapkin, K.V.; Kudrya, S.A.; Tsupko-Sitnikov, V.V.

    1997-01-01

    The alpha-recoil phenomenon is used to gain data on the weak components of the α-spectra of the nuclides from the 225 Ac equilibrium chain. It is established that there is no experimental basis for introducing the 450 keV level of 213 Bi in the 217 At decay and the 868 keV level of 209 Tl in the 213 Bi decay. Excitation of the 759 keV level in the 217 At decay is confirmed. The intensities of the 221 Fr, 217 At and 213 Bi β - -decay are measured

  2. Requirement of histidine 217 for ubiquinone reductase activity (Qi site) in the cytochrome bc1 complex.

    Science.gov (United States)

    Gray, K A; Dutton, P L; Daldal, F

    1994-01-25

    Folding models suggest that the highly conserved histidine 217 of the cytochrome b subunit from the cytochrome bc1 complex is close to the quinone reductase (Qi) site. This histidine (bH217) in the cytochrome b polypeptide of the photosynthetic bacterium Rhodobacter capsulatus has been replaced with three other residues, aspartate (D), arginine (R), and leucine (L). bH217D and bH217R are able to grow photoheterotrophically and contain active cytochrome bc1 complexes (60% of wild-type activity), whereas the bH217L mutant is photosynthetically incompetent and contains a cytochrome bc1 complex that has only 10% of the wild-type activity. Single-turnover flash-activated electron transfer experiments show that cytochrome bH is reduced via the Qo site with near native rates in the mutant strains but that electron transfer between cytochrome bH and quinone bound at the Qi site is greatly slowed. These results are consistent with redox midpoint potential (Em) measurements of the cytochrome b subunit hemes and the Qi site quinone. The Em values of cyt bL and bH are approximately the same in the mutants and wild type, although the mutant strains have a larger relative concentration of what may be the high-potential form of cytochrome bH, called cytochrome b150. However, the redox properties of the semiquinone at the Qi site are altered significantly. The Qi site semiquinone stability constant of bH217R is 10 times higher than in the wild type, while in the other two strains (bH217D and bH217L) the stability constant is much lower than in the wild type. Thus H217 appears to have major effects on the redox properties of the quinone bound at the Qi site. These data are incorporated into a suggestion that H217 forms part of the binding pocket of the Qi site in a manner reminiscent of the interaction between quinone bound at the Qb site and H190 of the L subunit of the bacterial photosynthetic reaction center.

  3. Time-differential observation of α-particle perturbed angular distribution: g-factor measurements for 217Acsup(gs) and 217Acsup(m)

    International Nuclear Information System (INIS)

    Maier, K.H.; Decman, D.J.; Grawe, H.; Kluge, H.

    1981-01-01

    The g-factor measurements of the ground state and an isomeric level in 217 Ac using the DPAD method with α-decay are described in this work. The results of γ-ray g-factor measurements for the isomer and a tentative decay scheme produced by α-γ and γ-γ coincidence experiments are also presented. An analysis of the α-particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (orig.)

  4. Time-differential observation of alpha -particle perturbed angular distribution; g-factor measurements for /sup 217/Ac/sup gs/ and /sup 217/Ac/sup m/

    CERN Document Server

    Maier, K H; Grawe, H; Kluge, H

    1981-01-01

    The g-factor measurements of the ground state and an isomeric level in /sup 217/Ac using the DPAD method with alpha -decay are described. The results of gamma -ray g-factor measurements for the isomer and a tentative decay scheme produced by alpha - gamma and gamma - gamma coincidence experiments are also presented. An analysis of the alpha - particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (13 refs).

  5. 5 CFR 531.217 - Special conversion rules for certain non-GS employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special conversion rules for certain non... SERVICE REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Setting Pay When Appointment Or Position Changes § 531.217 Special conversion rules for certain non-GS employees. When an...

  6. CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar

    Directory of Open Access Journals (Sweden)

    Plínio Itamar de Mello de Souza

    2008-01-01

    Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.

  7. 9 CFR 381.217 - Authority for condemnation or seizure under other provisions of law.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority for condemnation or seizure... Detention; Seizure and Condemnation; Criminal Offenses § 381.217 Authority for condemnation or seizure under other provisions of law. The provisions of this subpart relating to detention, seizure, condemnation and...

  8. Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y (0) YDL217C TIM22 Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopi...rey gene name TIM22 Prey description Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopic

  9. 48 CFR 1552.217-72 - Option to extend the term of the contract-cost-plus-award-fee contract.

    Science.gov (United States)

    2010-10-01

    ... of the contract-cost-plus-award-fee contract. 1552.217-72 Section 1552.217-72 Federal Acquisition...-award-fee contract. As prescribed in 1517.208(c), insert this contract clause in cost-plus-award-fee... Term of the Contract—Cost-Plus-Award-Fee Contract (APR 1984) (a) The Government has the option to...

  10. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

    Science.gov (United States)

    2010-10-01

    ... Distinct Population Segment of Atlantic Salmon (Salmo salar). 226.217 Section 226.217 Wildlife and... Distinct Population Segment of Atlantic Salmon (Salmo salar). Critical habitat is designated to include all... the Gulf of Maine Distinct Population Segment of Atlantic Salmon (GOM DPS), except for those...

  11. miR-217 regulates ethanol-induced hepatic inflammation by disrupting sirtuin 1-lipin-1 signaling.

    Science.gov (United States)

    Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O; You, Min

    2015-05-01

    Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and in primary Kupffer cells. In macrophages, ethanol substantially exacerbated LPS-mediated induction of miR-217 and production of proinflammatory cytokines compared with LPS or ethanol alone. Consistently, ethanol administration to mice led to increases in miR-217 abundance and increased production of inflammatory cytokines in isolated primary Kupffer cells exposed to the combination of ethanol and LPS. miR-217 promoted combined ethanol and LPS-mediated inhibition of sirtuin 1 expression and activity in macrophages. Moreover, miR-217-mediated sirtuin 1 inhibition was accompanied by increased activities of two vital inflammatory regulators, NF-κB and the nuclear factor of activated T cells c4. Finally, adenovirus-mediated overexpression of miR-217 led to steatosis and inflammation in mice. These findings suggest that miR-217 is a pivotal regulator involved in ethanol-induced hepatic inflammation. Strategies to inhibit hepatic miR-217 could be a viable approach in attenuating alcoholic hepatitis. Copyright © 2015 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

  12. Snow hazard potential evaluation along G217 highway in Tianshan mountains by using GIS and RS

    Science.gov (United States)

    Tao, Jianwei

    2007-11-01

    Snow hazard especially avalanche potential along G217 national highway in Tianshan Mountains using remote sensing and GIS is evaluated and compared with actual site records of avalanche in a test area. Most places of the actual avalanche accidents are consistent with the places with the high snow hazard potential. But there are several places of the avalanche were not in the high hazard potential areas. The reason for this difference is discussed.

  13. Pt.2. Charge and mass analysis at 217MeV bombarding energy

    International Nuclear Information System (INIS)

    Galin, J.; Gatty, B.; Guerreau, D.; Lefort, M.; Tarrago, X.; Agarwal, S.; Babinet, R.; Cauvin, B.; Girard, J.; Nifenecker, H.

    1977-01-01

    Atomic numbers and masses have been identified for the fragments (12 40 Ar (217MeV) + 197 Au. Even for such a large mass asymmetry in the entrance channel it is shown how difficult it is, for some part of the cross section, to distinguish between a classical deep inelastic phenomenon and the formation of a true compound nucleus followed by symmetric fission. The two reaction mechanisms are then studied separately in a critical way comparing with existing models

  14. miR-217 Regulates Ethanol-Induced Hepatic Inflammation by Disrupting Sirtuin 1–Lipin-1 Signaling

    OpenAIRE

    Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O.; You, Min

    2015-01-01

    Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and ...

  15. Microstructure, magnetic properties and magnetic hardening in 2:17 Sm-Co magnets

    International Nuclear Information System (INIS)

    Tang, W.; Zhang, Y.; Hadjipanayis, G.C.

    2002-01-01

    A comprehensive and systematic study has been made on Sm(Co,Fe,M,L) z magnets (M=Cu or Ni, and L=Zr or Ti) to completely understand the effects of composition and processing on the microstructure and magnetic properties of magnets. Ti-containing magnets do not have a lamellar phase but exhibit only a cellular microstructure, resulting in a much lower coercivity (below 10 kOe). Ni-containing magnets exhibit a perfect cellular/lamellar microstructure, but without a large domain wall energy gradient at the interface of the 2:17 and 1:5 phases, leading to a low coercivity. Only in the magnets containing both Cu and Zr, a uniform and stable cellular/lamellar microstructure with a high domain wall energy gradient across the 1:5 phase is formed, resulting in high coercivity. These results indicate that the conditions for effective magnetic hardening are: (1) Formation of a cellular/lamellar microstructure, and (2) establishment of a domain wall energy gradient at the cell boundaries. Based on all of these experimental results, the magnetization reversal mechanism of 2:17 Sm-Co magnets can be explained by both the domain wall pinning and nucleation models. The nucleation mechanism holds at any temperature in the Cu-rich magnets, and only above the Curie temperature of the 1:5 phase in the alloys with the lower Cu content. In these cases, the 2:17 cells become magnetically decoupled. (orig.)

  16. Aging method for electronic components and systems based on MIL-HDBK 217

    International Nuclear Information System (INIS)

    Declercq, M.; Simoens, F.

    1984-01-01

    Accelerated aging tests as requested to comply IEEE Std 323-1974, rise the question of the availability of an adequate aging model. After getting through the usual models, the authors describe an aging methodology based on MIL-HDBK 217. The method, taking into account several stress factors, is shown to yield on acceptable acceleration of time, while reducing the relative importance of temperature. Practical implementation of acceleration testing is discussed, and a summary of the gained experience is made and discussed in the scope of the philosophy of IEEE Std 650. Only natural thermal aging and functional aging, excluding irradiation or thermal shocks, are considered [fr

  17. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 217, Revision 1 (FGE.217Rev1). Consideration of genotoxic potential for α,β-Unsaturated ketones and precursors from chemical subgroup 4.1 of FGE

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma...

  18. Production and identification of an isomeric state in 217Pa and the new isotope 218Pa

    International Nuclear Information System (INIS)

    Schmidt, K.H.; Faust, W.; Muenzenberg, G.; Ewald, H.; Guettner, K.; Clerc, H.G.; Lang, W.; Wohlfarth, H.; Pielenz, K.

    1977-02-01

    Evaporation residues produced in the reaction 40Ar(176 MeV) + 181Ta were separated from the primary beam by the velocity filter SHIP and detected by a ΔE-E counter telescope. The technique of delayed coincidences was applied to individually identify the reaction products implanted into a Si-surface barrier detector by their subsequent alpha decays. The previously unknown nucleus 218Pa was identified by its known daughter decays. 218Pa was found to decay with Esub(α) = (9.614 +- 0.015) MeV, T(1/2) = (140 +- 50) μs and probably also with Esub(α) = (9.535 +- 0.020) MeV, T(1/2) = (150 + 100 - 50) μs. The half-life of the 8.33 MeV alpha decay of 217Pa was determined to be (o.2 +- 0.4) ms. Anew isomer in 217 Pa was found which decays with Esub(α) = (10.16 +- 0.02) MeV and T(1/2) = (1.8 +- 0.5) ms. (orig./BJ) [de

  19. Analysis the findings of chest radiograph and CT scan in 217 acute thoracic trauma

    International Nuclear Information System (INIS)

    Huang Shaoying

    2005-01-01

    Objective: To evaluate chest radiograph and CT scan in assessing acute thoracic trauma. Methods: Retrospectively analyzed the findings of chest radiograph and CT scan in 217 cases of acute thoracic trauma and positive rate of each modality was compared. Results: The positive rate of rib and clavicle fracture was higher in chest radiograph than these in CT scan. But the positive rate of chest wall hematoma, mediastinum and subcutaneous emphysema, pneumothorax, hydropneumothorax, damage of lung parenchyma and traumatic pulmonary atelectasis was higher in CT scan than those in chest radiograph. Conclusion: The application of the combined imaging modalities improves assessing of acute thoracic trauma, because the imaging manifestation of the lesion is various. (authors)

  20. Fluid-mixing studies in a hexagonal 217-pin wire-wrapped rod bundle

    International Nuclear Information System (INIS)

    Symolon, P.D.; Todreas, N.E.

    1981-02-01

    Mixing, pressure drop, and flow split experiments were performed on a 217 pin LMFBR fuel bundle with a pitch to diameter ratio of 1.25 and a lead length of 12 inches. It was found that the turbulent flow data could best be characterized by the energy parameter C/sub 1L/=.106, which is 9% higher than the value from the correlation of Chiu et al. Chiu's correlation was developed on a data base of 61 and 91 pins. The spread of existing data about the correlation is +- 25%, but the error band on our data is expected to be less (approx. +- 10% since injection depth effects were not previously considered). This result is consistent with the concept of increased swirl flow in larger bundles

  1. Health and relationships with leisure time activities in Swedish children aged 2-17 years.

    Science.gov (United States)

    Berntsson, Leeni T; Ringsberg, Karin C

    2014-09-01

    Three cross-sectional time series studies, randomised and stratified for age and gender, were performed on children aged 2-17, studying their health and well-being. The studies were performed in the Nordic countries in 1984, 1996 and 2011. Long-term illness (LTI) and psychosomatic complaints (PSC) increased during the period. Data were collected from mailed questionnaires. Data of 1461 Swedish children from 2011 were used and compared with data from 1984 and 1996. Relationships between the health indicators (the absence of LTI, 13 diagnoses, the absence of PSC, six symptoms, six items of well-being) and 12 activities were analysed. A total of 83.2% of the children were healthy and 16.8% had at least one LTI, boys 19.1% and girls 14.5%. PSC increased from 18.6% in 1996 to 23.1% in 2011. The distribution was higher in girls. Girls were more active than boys during leisure time. 'Reading books', 'visiting friends', 'listening to music' and 'activity in organisations' were related to an absence of PSC, LTI and well-being. 'Surfing/blogging on the Internet' was negatively related to LTI, PSC and well-being. Multiple regression showed that that 'visits or is visited by friends' was related with a low probability for LTI and also with a high probability for well-being. In the logistic regression analyses, the following variables were seen as promoting health most: 'visits or is visited by friends' and 'is active in organizations' for children aged 2-17 years, especially for boys and well-being. The health of Swedish children declined between 1984 and 2011. Positive relationships were found between some activities and health as well as other activities related to ill health. The results suggest an increased focus on the activities that have positive relationships with health in order to promote health among children. © 2013 Nordic College of Caring Science.

  2. 5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Are part-time Federal employees eligible... the Child Care Subsidy Program Legislation and to Whom Does It Apply? § 792.217 Are part-time Federal employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for...

  3. Modification on C217 by auxiliary acceptor toward efficient sensitiser for dye-sensitised solar cells: a theoretical study

    Science.gov (United States)

    Zhao, Caibin; Jin, Lingxia; Ge, Hongguang; Guo, Xiaohua; Zhang, Qiang; Wang, Wenliang

    2018-02-01

    In this work, to develop efficient organic dye sensitisers, a series of novel donor-acceptor-π-acceptor metal-free dyes were designed based on the C217 dye by means of modifying different auxiliary acceptors, and their photovoltaic performances were theoretically investigated with systematic density functional theory calculations coupled with the incoherent charge-hopping model. Results showed that the designed dyes possess lower highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) levels as well as narrower HOMO-LUMO gaps compared to C217, which indicate their higher light-harvesting efficiency. In addition, using the (TiO2)38 cluster and bidentate bridging model, we predicted that the photoelectric conversion efficiency (PCE) for the C217 dye is as high as 9.92% under air mass (AM) 1.5 illumination (100 mW.cm-2), which is in good agreement with its experimental value (9.60%-9.90%). More interestingly, the cell sensitised by the dye 7 designed in this work exhibits a middle-sized open-circuit voltage of 0.737 V, large short-circuit photocurrent density of 21.16 mAˑcm-2 and a fill factor of 0.801, corresponding to a quite high PCE of 12.49%, denoting the dye 7 is a more promising sensitiser candidate than the C217, and is worth further experimental study.

  4. [Physician Assisted Suicide - Survey on § 217 StGB in Germany].

    Science.gov (United States)

    Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael

    2017-03-01

    Background  In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods  In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results  457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion  Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.

  5. Echomorphology of cardiomyopathy: review of 217 cases from 1999 to 2010

    International Nuclear Information System (INIS)

    Ilyas, S.; Ilyas, H.; Fawad, A.; Hameed, A.; Fazli, A.

    2013-01-01

    Objective: To study echocardiogram features of different types of cardiomyopathy presenting over a 12 year period at a single centre in Peshawar. Methods: The series comprised a retrospective review of 13,788 consecutive echocardiograms carried out at the Muhammadi Hospital International Medical Research Centre, Hayatabad, Peshawar, from January 1999 to December 2010. Patients were split into two: Group I with paediatric and adolescent cases (0-18 years) and Group II with adults (>18 years). In the adult group, women with peripartum cardiomyopathy were subdivided into two groups of 18-30 years and 30 to 44 years. Standard Echo B and M modes and Doppler parameters were recorded to ascertain the diagnoses of common primary and secondary cardiomyopathies. Patients with myocarditis with chambers dilatation and global dysfunction, and cardiopathy associated with major cardiovascular diseases were excluded. SPSS 14 was used for statistical analysis. Results: Cardiomyopathy was diagnosed in 217 (1.57%) cases. There were 144 (66%) cases of dilated cardiomyopathy with a mean age of 13+-14.8 years; 17 (8%) cases of hypertrophic cardiomyopathy with a mean age of 12+-11.5 years; and 7 (3%) cases of restrictive cardiomyopathy with a mean age of 31+-7.8 years. Primary cardiac amyloidosis was confirmed in 9 (4%) cases, and peripartum cardiomyopathy in 25 (11%) females. Rare subtypes were found in 15 (7%) cases. Conclusion: DCM was the most frequently diagnosed subtype of cardiomyopathy followed by HCM in both the adult and paediatric age groups. (author)

  6. RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)

    2017-03-15

    Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

  7. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Directory of Open Access Journals (Sweden)

    Mark Walter

    2006-08-01

    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  8. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  9. Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.

    Science.gov (United States)

    2004-01-01

    Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies

  10. Recent extensions and use of the statistical model code EMPIRE-II - version: 2.17 Millesimo

    International Nuclear Information System (INIS)

    Herman, M.

    2003-01-01

    This lecture notes describe new features of the modular code EMPIRE-2.17 designed to perform comprehensive calculations of nuclear reactions using variety of nuclear reaction models. Compared to the version 2.13, the current release has been extended by including Coupled-Channel mechanism, exciton model, Monte Carlo approach to preequilibrium emission, use of microscopic level densities, widths fluctuation correction, detailed calculation of the recoil spectra, and powerful plotting capabilities provided by the ZVView package. The second part of this lecture concentrates on the use of the code in practical calculations, with emphasis on the aspects relevant to nuclear data evaluation. In particular, adjusting model parameters is discussed in details. (author)

  11. [Usefulness of stratigraphy and computerized tomography in the initial staging of osteosarcoma of the extremities. Retrospective study of 217 cases].

    Science.gov (United States)

    Pelotti, P; Ciminari, R; Bacci, G; Avella, M; Briccoli, A

    1988-01-01

    The value of stratigraphy and pulmonary CT in the initial work-up of osteosarcoma of the extremities is assessed with reference to 217 patients encountered in the Bone Tumour Centre of Rizzoli Orthopaedic Institute in May 1983-May 1986. Stratigraphy revealed lung metastases not identified by standard radiography in 4 patients (1.8%), while CT revealed metastases not identified by either standard X-rays or stratigraphy in a further 6 cases (2.7%). It is concluded that the increase in the percentage of cures (about 30%) reported in the last 10 years in osteosarcoma cases given adjuvant chemotherapy cannot be explained by any difference in initial selection due to the use of these techniques that were not adopted in the historical series.

  12. VizieR Online Data Catalog: Catalog of Eq.Widths of Interstellar 217nm Band (Friedemann 1992)

    Science.gov (United States)

    Friedemann, C.

    2005-03-01

    (from CDS Inf. Bull. 40, 31) The main task of the catalogue consists in a comprehensive collection of equivalent widths of the 217nm band derived from both spectrophotometric and filterphotometric measurements obtained with TD-1, OAO-2 and ANS satellites. These data concern reddened O, B stars with color excesses E(B-V) >= 0.02 mag. The extinction curve is approximated by the empirical formula introduced by Guertler et al. (1982AN....303..105G) e({lambda}) = A(i/{lambda} - 1/{lambda}o)n + B + C {kappa}({lambda}) The relative errors amount to about {delta}A/A = +/- 0.10, {delta}B/B = +/- 0.02 and {delta}C/C = +/- 0.03. (1 data file).

  13. Results of the independent verification of radiological remedial action at 217 South 2nd East Street, Monticello, Utah (MS00097)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Wilson, M.J.

    1990-02-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  14. Radial cracks and fracture mechanism of radially oriented ring 2:17 type SmCo magnets

    International Nuclear Information System (INIS)

    Tian Jianjun; Pan Dean; Zhou Hao; Yin Fuzheng; Tao Siwu; Zhang Shengen; Qu Xuanhui

    2009-01-01

    Radially oriented ring 2:17 type SmCo magnets have different microstructure in the radial direction (easy magnetization) and axial direction (hard magnetization). The structure of the cross-section in radial direction is close-packed atomic plane, which shows cellular microstructure. The microstructure of the cross-section in axial direction consists of a mixture of rhombic microstructure and parallel lamella phases. So the magnets have obvious anisotropy of thermal expansion in different directions. The difference of the thermal expansion coefficients reaches the maximum value at 830-860 deg. C, which leads to radial cracks during quenching. The magnets have high brittlement because there are fewer slip systems in crystal structure. The fracture is brittle cleavage fracture.

  15. Microstructural changes during the slow-cooling annealing of nanocrystalline SmCo 2:17 type magnets

    International Nuclear Information System (INIS)

    Romero, S.A.; Campos, M.F. de; Castro, J.A. de; Moreira, A.J.; Landgraf, F.J.G.

    2013-01-01

    Highlights: ► Use of the Stoner-Wohlfarth Callen Liu Cullen model in 2:17 type magnets. ► Data suggest exchange coupling between Sm2(CoFe)17 and Sm(CoCu)5 phases. ► It is given structural data for phase Sm0.33Zr0.67TM3, with TM=Co,Fe,Cu. ► The beneficial effect of the slow cooling treatment is explained. - Abstract: The microstructure and magnetic properties of 2:17 type isotropic magnets were investigated. The slow cooling heat treatment (cooling at 1 °C/min from 820 to 400 °C, and isothermal treatment during 24 h) was interrupted after the temperatures of 820, 700, 600 and 500 °C and their hysteresis were measured with fields up to 9 T. The fully heat treated sample presented coercivity (μ 0 H) of 3.32 T, after 24 h at 400 °C. The microstructure was investigated with SEM–FEG (Scanning Electron Microscope with Field Emission Gun) and X-ray Diffraction Rietveld analysis. The application of the Stoner–Wohlfarth–Callen–Liu–Cullen (SW–CLC) model points out exchange coupling between ferromagnetic Sm 2 (CoFe) 17 nanocells and ferromagnetic Sm(CoCu) 5 present at the cell boundary phase. The results are interpreted with the double shell model: first-a cobalt-rich ferromagnetic Sm(CoCu) 5 shell originates exchange coupling and second-a copper-rich paramagnetic Sm(CuCo) 5 shell produces magnetic decoupling. This double shell helps to maximize coercivity and remanence. The anisotropy field of the Sm 2 (CoFe) 17 cell phase was estimated in 7 T with the SW–CLC model.

  16. Swedish parents' activities together with their children and children's health: a study of children aged 2-17 years.

    Science.gov (United States)

    Berntsson, Leeni T; Ringsberg, Karin C

    2014-11-01

    Nordic children's health has declined. Studies show that parents' engagement in children's leisure-time activities might provide beneficial health outcomes for children. The aim of the present study was to examine the association between Swedish parents' activities together with their children, the parents' experiences of time pressure and their children's health. Data of 1461 Swedish children aged 2-17 years old that were collected in the NordChild study of 2011 were used. We analyzed physical health, diseases and disabilities, psychosomatic health and well-being, and the parents' experiences of time pressure; and we calculated the associations between parental activity together with the child and health indicators. Activities that were significantly and positively associated with children's health at ages 2-17 years of age were: playing and playing games; going to the cinema, theatre, and sporting events; reading books; playing musical instruments/singing; sports activities; watching TV/video/DVD. Playing video games or computer games, driving child to activities and going for walks were significantly and positively associated at age groups 7-12 years and 13-17 years. Activities that were negatively associated with health were: surfing/blogging on the Internet, going shopping and doing homework. Parents who were not experiencing time pressures had a higher level of activity together with their children. The parental experience of time pressure was associated with work time, with less homework activity and more symptoms in children. The family and home are important settings for the development of children's health we found eight parental activities together with their children that promoted the children's health parents' working time and their time pressure experiences affected their activities with their children there is a need for an increased focus on parental activities that are positively associated with children's health. © 2014 the Nordic Societies of

  17. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

    Science.gov (United States)

    2010-04-01

    ... chapter (Employment Tax Regulations). The term self-employed individual as used in this section is defined... within such period. (b) Definition of moving expenses—(1) In general. Section 217(b) defines the term... placement charges which are, in essence, prepayments of interest, or the purchase price of the residence...

  18. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2012-09-01

    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.

  19. Characterization of velocity and temperature fields in a 217 pin wire wrapped fuel bundle of sodium cooled fast reactor

    International Nuclear Information System (INIS)

    Naveen Raj, M.; Velusamy, K.

    2016-01-01

    Highlights: • We simulate flow and temperature fields in fuel subassembly of fast reactor. • We perform high fidelity computations for 217 pin bundle of 7 axial pitch lengths. • We investigate transverse and axial flows in different types of subchannels. • Correlations are proposed for transverse flow, which form input for subchannel analysis. • Periodic variations of large magnitude are observed in subchannel flow rates. - Abstract: RANS based computational fluid dynamic (CFD) simulation of flow and temperature fields in a fast reactor fuel subassembly has been carried out. The sodium cooled prototype subassembly consists of 217 pins with helical wire spacers. An axial length of seven helical wire pitches has been considered for the study adopting a structured mesh having 36 million points and 84 processors in parallel. The computational model has been validated against in-house and published experimental data for friction factor and Nusselt number. Also, the transverse flow in the central subchannel and swirl flow in the peripheral subchannel are compared against reported experimental data and those computed by subchannel models. The focus of the study is investigation of transverse and axial flows in different types of subchannels. Based on the 3-dimensional CFD study, correlations have been proposed for calculation of transverse flow, which forms an important input for development of subchannel analysis codes. Periodic variations have been observed in the subchannel axial flow rates. For the subchannels located in the central region, the peak to peak variation in the axial flow rate is ∼21% and it is found to be contributed by the changes in the flow area and hydraulic resistance due to frequent passage of helical wires through the subchannel. For the subchannels located in the periphery, this variation is as high as 50%. The transverse flow in the central subchannels follows a cosine profile, for all the faces. However, there is a phase lag of 120

  20. Knockdown of AMPKα decreases ATM expression and increases radiosensitivity under hypoxia and nutrient starvation in an SV40-transformed human fibroblast cell line, LM217.

    Science.gov (United States)

    Murata, Yasuhiko; Hashimoto, Takuma; Urushihara, Yusuke; Shiga, Soichiro; Takeda, Kazuya; Jingu, Keiichi; Hosoi, Yoshio

    2018-01-22

    Presence of unperfused regions containing cells under hypoxia and nutrient starvation contributes to radioresistance in solid human tumors. It is well known that hypoxia causes cellular radioresistance, but little is known about the effects of nutrient starvation on radiosensitivity. We have reported that nutrient starvation induced decrease of mTORC1 activity and decrease of radiosensitivity in an SV40-transformed human fibroblast cell line, LM217, and that nutrient starvation induced increase of mTORC1 activity and increase of radiosensitivity in human liver cancer cell lines, HepG2 and HuH6 (Murata et al., BBRC 2015). Knockdown of mTOR using small interfering RNA (siRNA) for mTOR suppressed radiosensitivity under nutrient starvation alone in HepG2 cells, which suggests that mTORC1 pathway regulates radiosensitivity under nutrient starvation alone. In the present study, effects of hypoxia and nutrient starvation on radiosensitivity were investigated using the same cell lines. LM217 and HepG2 cells were used to examine the effects of hypoxia and nutrient starvation on cellular radiosensitivity, mTORC1 pathway including AMPK, ATM, and HIF-1α, which are known as regulators of mTORC1 activity, and glycogen storage, which is induced by HIF-1 and HIF-2 under hypoxia and promotes cell survival. Under hypoxia and nutrient starvation, AMPK activity and ATM expression were increased in LM217 cells and decreased in HepG2 cells compared with AMPK activity under nutrient starvation alone or ATM expression under hypoxia alone. Under hypoxia and nutrient starvation, radiosensitivity was decreased in LM217 cells and increased in HepG2 cells compared with radiosensitivity under hypoxia alone. Under hypoxia and nutrient starvation, knockdown of AMPK decreased ATM activity and increased radiation sensitivity in LM217 cells. In both cell lines, mTORC1 activity was decreased under hypoxia and nutrient starvation. Under hypoxia alone, knockdown of mTOR slightly increased ATM

  1. Biocontrol activity of surfactin A purified from Bacillus NH-100 and NH-217 against rice bakanae disease.

    Science.gov (United States)

    Sarwar, Ambrin; Hassan, Muhammad Nadeem; Imran, Muhammad; Iqbal, Mazhar; Majeed, Saima; Brader, Günter; Sessitsch, Angela; Hafeez, Fauzia Yusuf

    2018-04-01

    The potential of the Bacillus genus to antagonize phytopathogens is associated with the production of cyclic lipopeptides. Depending upon the type of lipopeptide, they may serve as biocontrol agents that are eco-friendly alternatives to chemical fertilizers. This study evaluates the biocontrol activity of surfactin-producing Bacillus (SPB) strains NH-100 and NH-217 and purified surfactin A from these strains against rice bakanae disease. Biologically active surfactin fractions were purified by HPLC, and surfactin A variants with chain lengths from C12 to C16 were confirmed by LCMS-ESI. In hemolytic assays, a positive correlation between surfactin A production and halo zone formation was observed. The purified surfactin A had strong antifungal activity against Fusarium oxysporum, F. moniliforme, F. solani, Trichoderma atroviride and T. reesei. Maximum fungal growth suppression (84%) was recorded at 2000 ppm against F. moniliforme. Surfactin A retained antifungal activity at different pH levels (5-9) and temperatures (20, 50 and 121 °C). Hydroponic and pot experiments were conducted to determine the biocontrol activity of SPB strains and the purified surfactin A from these strains on Super Basmati rice. Surfactin production in the rice rhizosphere was detected by LCMS-ESI at early growth stages in hydroponics experiments inoculated with SPB strains. However, the maximum yield was observed with a consortium of SPB strains (T4) and purified surfactin A (T5) treatments in the pot experiment. The outcomes of the present study revealed that surfactin A significantly reduced rice bakanae disease by up to 80%. These findings suggest that purified surfactin A could be an effective biocontrol agent against bakanae disease in rice and should be incorporated into strategies for disease management. Copyright © 2018 Elsevier GmbH. All rights reserved.

  2. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Directory of Open Access Journals (Sweden)

    Kohzad S

    2013-03-01

    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  3. Hypoxia-inducible factors regulate pluripotency factor expression by ZNF217- and ALKBH5-mediated modulation of RNA methylation in breast cancer cells.

    Science.gov (United States)

    Zhang, Chuanzhao; Zhi, Wanqing Iris; Lu, Haiquan; Samanta, Debangshu; Chen, Ivan; Gabrielson, Edward; Semenza, Gregg L

    2016-10-04

    Exposure of breast cancer cells to hypoxia increases the percentage of breast cancer stem cells (BCSCs), which are required for tumor initiation and metastasis, and this response is dependent on the activity of hypoxia-inducible factors (HIFs). We previously reported that exposure of breast cancer cells to hypoxia induces the ALKBH5-mediated demethylation of N6-methyladenosine (m6A) in NANOG mRNA leading to increased expression of NANOG, which is a pluripotency factor that promotes BCSC specification. Here we report that exposure of breast cancer cells to hypoxia also induces ZNF217-dependent inhibition of m6A methylation of mRNAs encoding NANOG and KLF4, which is another pluripotency factor that mediates BCSC specification. Although hypoxia induced the BCSC phenotype in all breast-cancer cell lines analyzed, it did so through variable induction of pluripotency factors and ALKBH5 or ZNF217. However, in every breast cancer line, the hypoxic induction of pluripotency factor and ALKBH5 or ZNF217 expression was HIF-dependent. Immunohistochemistry revealed that expression of HIF-1α and ALKBH5 was concordant in all human breast cancer biopsies analyzed. ALKBH5 knockdown in MDA-MB-231 breast cancer cells significantly decreased metastasis from breast to lungs in immunodeficient mice. Thus, HIFs stimulate pluripotency factor expression and BCSC specification by negative regulation of RNA methylation.

  4. pages 217 - 225.pmd

    African Journals Online (AJOL)

    Administrator

    National Environmental Engineering Research Institute, CSIR-complex, Taramani, ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic ... especially in developing countries, where factors such .... Table 1: Ambient physical parameters at the sampling location.

  5. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Directory of Open Access Journals (Sweden)

    Mahsa Mansourian

    2012-03-01

    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  6. Posttranscriptional silencing of the lncRNA MALAT1 by miR-217 inhibits the epithelial–mesenchymal transition via enhancer of zeste homolog 2 in the malignant transformation of HBE cells induced by cigarette smoke extract

    International Nuclear Information System (INIS)

    Lu, Lu; Luo, Fei; Liu, Yi; Liu, Xinlu; Shi, Le; Lu, Xiaolin; Liu, Qizhan

    2015-01-01

    Lung cancer is regarded as the leading cause of cancer-related deaths, and cigarette smoking is one of the strongest risk factors for the development of lung cancer. However, the mechanisms for cigarette smoke-induced lung carcinogenesis remain unclear. The present study investigated the effects of an miRNA (miR-217) on levels of an lncRNA (MALAT1) and examined the role of these factors in the epithelial–mesenchymal transition (EMT) induced by cigarette smoke extract (CSE) in human bronchial epithelial (HBE) cells. In these cells, CSE caused decreases of miR-217 levels and increases in lncRNA MALAT1 levels. Over-expression of miR-217 with a mimic attenuated the CSE-induced increase of MALAT1 levels, and reduction of miR-217 levels by an inhibitor enhanced expression of MALAT1. Moreover, the CSE-induced increase of MALAT1 expression was blocked by an miR-217 mimic, indicating that miR-217 negatively regulates MALAT1 expression. Knockdown of MALAT1 reversed CSE-induced increases of EZH2 (enhancer of zeste homolog 2) and H3K27me3 levels. In addition to the alteration from epithelial to spindle-like mesenchymal morphology, chronic exposure of HBE cells to CSE increased the levels of EZH2, H3K27me3, vimentin, and N-cadherin and decreased E-cadherin levels, effects that were reversed by MALAT1 siRNA or EZH2 siRNA. The results indicate that miR-217 regulation of EZH2/H3K27me3 via MALAT1 is involved in CSE-induced EMT and malignant transformation of HBE cells. The posttranscriptional silencing of MALAT1 by miR-217 provides a link, through EZH2, between ncRNAs and the EMT and establishes a mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure decreases miR-217 levels and increases MALAT1 levels. • miR-217 negatively regulates MALAT1 expression. • MALAT1, via EZH2, is involved in the EMT of CSE-transformed HBE cells.

  7. MicroRNA and cellular targets profiling reveal miR-217 and miR-576-3p as proviral factors during Oropouche infection.

    Directory of Open Access Journals (Sweden)

    Victor Emmanuel Viana Geddes

    2018-05-01

    Full Text Available Oropouche Virus is the etiological agent of an arbovirus febrile disease that affects thousands of people and is widespread throughout Central and South American countries. Although isolated in 1950's, still there is scarce information regarding the virus biology and its prevalence is likely underestimated. In order to identify and elucidate interactions with host cells factors and increase the understanding about the Oropouche Virus biology, we performed microRNA (miRNA and target genes screening in human hepatocarcinoma cell line HuH-7. Cellular miRNAs are short non-coding RNAs that regulates gene expression post-transcriptionally and play key roles in several steps of viral infections. The large scale RT-qPCR based screening found 13 differentially expressed miRNAs in Oropouche infected cells. Further validation confirmed that miR-217 and miR-576-3p were 5.5 fold up-regulated at early stages of virus infection (6 hours post-infection. Using bioinformatics and pathway enrichment analysis, we predicted the cellular targets genes for miR-217 and miR-576-3p. Differential expression analysis of RNA from 95 selected targets revealed genes involved in innate immunity modulation, viral release and neurological disorder outcomes. Further analysis revealed the gene of decapping protein 2 (DCP2, a previous known restriction factor for bunyaviruses transcription, as a miR-217 candidate target that is progressively down-regulated during Oropouche infection. Our analysis also showed that activators genes involved in innate immune response through IFN-β pathway, as STING (Stimulator of Interferon Genes and TRAF3 (TNF-Receptor Associated Factor 3, were down-regulated as the infection progress. Inhibition of miR-217 or miR-576-3p restricts OROV replication, decreasing viral RNA (up to 8.3 fold and virus titer (3 fold. Finally, we showed that virus escape IFN-β mediated immune response increasing the levels of cellular miR-576-3p resulting in a decreasing of

  8. 14 CFR 145.209 - Repair station manual contents.

    Science.gov (United States)

    2010-01-01

    ...; (g) Procedures for maintenance, preventive maintenance, or alterations performed under § 145.205; (h)Procedures for— (1) Maintaining and revising the contract maintenance information required by § 145.217(a)(2...) Maintaining and revising the contract maintenance information required by § 145.217(a)(2)(ii) and notifying...

  9. VizieR Online Data Catalog: HK photometry in an UCHII region near Sh2-217 (Brand+, 2011)

    Science.gov (United States)

    Brand, J.; Massi, F.; Zavagno, A.; Deharveng, L.; Lefloch, B.

    2010-11-01

    Coordinates and photometric parameters (magnitudes and colours) are presented of the stars located in a molecular condensation on the SW-border of the Galactic HII region Sh2-217. The data were obtained on January 4, 2004 with the 3.58-m Telescopio Nazionale Galileo (TNG; La Palma, Canary Islands, Spain). Near-infrared observations were carried out through H and K' broad-band filters with the camera NICS. The image scale is 0.25arcsec/pixel, yielding a field of view of about 4.2'x4.2'. Observing strategy and exposure times are described in Deharveng et al. (2006A&A...458..191D), the only difference being that the dithering sequence for the H-band images was the same as adopted for K'. The data reduction steps adopted are outlined in Deharveng et al. (2006A&A...458..191D). Aperture photometry was done using the DAOPHOT package in IRAF. We followed the same procedure described in Deharveng et al. (2006A&A...458..191D) to obtain aperture photometry, after which PSF-fitting photometry was performed. Although the seeing was good (<1"), the night was barely photometric, so we calibrated our H, K' photometry with that performed on the same field by Deharveng et al. (2003, Cat. J/A+A/399/1135). We calculated the difference in magnitudes for each coinciding source and plotted it against our derived instrumental H-K'. A colour term was present in K' because of the difference between the K and K' filters. After a best-fit calibration, a residual r.m.s. of about 0.2mag. was present in the difference between our photometry and that of Deharveng et al. (2003, J/A+A/399/1135), probably because of the different seeing and possibly also due to the intrinsic variability of young stars. Our photometry is thus on the same HK standard system as Deharveng et al. (2003, J/A+A/399/1135). Sources with K, H < 11-12 are in the non-linear regime or saturated, but such bright objects are few in number and lie outside the cluster, and are probably foreground stars. The approximate limiting

  10. Pre-eruptive conditions of dacitic magma erupted during the 21.7 ka Plinian event at Nevado de Toluca volcano, Central Mexico

    Science.gov (United States)

    Arce, J. L.; Gardner, J. E.; Macías, J. L.

    2013-01-01

    The Nevado de Toluca volcano in Central Mexico has been active over the last ca. 42 ka, during which tens of km3 of pyroclastic material were erupted and two important Plinian-type eruptions occurred at ca. 21.7 ka (Lower Toluca Pumice: LTP) and ca. 10.5 ka (Upper Toluca Pumice: UTP). Samples from both the LTP and UTP contain plagioclase, amphibole, iron-titanium oxides, and minor anhedral biotite, set in a vesicular, rhyolitic, glassy matrix. In addition, UTP dacites contain orthopyroxene. Analysis of melt inclusions in plagioclase phenocrysts yields H2O contents of 2-3.5 wt.% for LTP and 1.3-3.6 wt.% for UTP samples. Ilmenite-ulvospinel geothermometry yields an average temperature of ~ 868 °C for the LTP magma (hotter than the UTP magma, ~ 842 °C; Arce et al., 2006), whereas amphibole-plagioclase geothermometry yields a temperature of 825-859 °C for the LTP magma. Water-saturated experiments using LTP dacite suggest that: (i) amphibole is stable above 100 MPa and below 900 °C; (ii) plagioclase crystallizes below 250-100 MPa at temperatures of 850-900 °C; and (iii) pyroxene is stable only below pressures of 200-100 MPa and temperatures of 825-900 °C. Comparison of natural and experimental data suggests that the LTP dacitic magma was stored at 150-200 MPa (5.8-7.7 km below the volcano summit). No differences in pressure found between 21.7 ka and 10.5 ka suggest that these two magmas were stored at similar depths. Orthopyroxene produced in lower temperature LTP experiments is compositionally different to those found in UTP natural samples, suggesting that they originated in two different magma batches. Whole-rock chemistry, petrographic features, and mineral compositions suggest that magma mixing was responsible for the generation of the dacitic Plinian LTP eruption.

  11. A comparative CFD investigation of helical wire-wrapped 7, 19 and 37 fuel pin bundles and its extendibility to 217 pin bundle

    International Nuclear Information System (INIS)

    Gajapathy, R.; Velusamy, K.; Selvaraj, P.; Chellapandi, P.; Chetal, S.C.

    2009-01-01

    Preliminary investigations of sodium flow and temperature distributions in heat generating fuel pin bundles with helical spacer wires have been carried out. Towards this, the 3D conservation equations of mass, momentum and energy have been solved using a commercial computational fluid dynamics (CFD) code. Turbulence has been accounted through the use of high Reynolds number version of standard k-ε model, with uniform mesh density respecting wall function requirements. The geometric details of the bundle and the heat flux in are similar to that of the Indian Prototype Fast Breeder Reactor (PFBR) that is currently under construction. The mixing characteristics of the flow among the peripheral and central zones are compared for 7, 19 and 37 fuel pin bundles and the characteristics are extended to a 217 pin bundle. The friction factors of the pin bundles obtained from the present study is seen to agree well with the values derived from experimental correlations. It is found that the normalized outlet velocities in the peripheral and central zones are nearly equal to 1.1-0.9, respectively which is in good agreement with the published hydraulic experimental measurements of 1.1-0.85 for a 91 pin bundle. The axial velocity is the maximum in the peripheral zone where spacer wires are located and minimum in the zones which are diametrically opposite to the respective zone of maximum velocity. The sodium temperature is higher in the zones where the flow area and mass flow rates are less due to the presence of the spacer wires though the axial velocity is higher there. It is the minimum in the peripheral zones where the circumferential flow is larger. Based on the flow and temperature distributions obtained for 19 and 37 pin bundles, a preliminary extrapolation procedure has been established for estimating the temperatures of peripheral and central zones of 217 pin bundle.

  12. Increased risk of revision in patients with non-traumatic femoral head necrosis 11,589 cases compared to 416,217 cases with primary osteoarthritis in the NARA database, 1995–2011

    DEFF Research Database (Denmark)

    Bergh, C.; Fenstad, Ann M.; Furnes, O.

    2014-01-01

    . The relative risk of revision for any reason, for aseptic loosening, dislocation, deep infection, and periprosthetic fracture was studied before and after adjustment for covariates using Cox regression models. Results - 416,217 hips with POA (mean age 69 (SD 10), 59% females) and 11,589 with FHN (mean age 65...

  13. A study to define the research and technology requirements for advanced turbo/propfan transport aircraft

    Science.gov (United States)

    Goldsmith, I. M.

    1981-01-01

    The feasibility of the propfan relative to the turbofan is summarized, using the Douglas DC-9 Super 80 (DS-8000) as the actual operational base aircraft. The 155 passenger economy class aircraft (31,775 lb 14,413 kg payload), cruise Mach at 0.80 at 31,000 ft (8,450 m) initial altitude, and an operational capability in 1985 was considered. Three propfan arrangements, wing mounted, conventional horizontal tail aft mounted, and aft fuselage pylon mounted are selected for comparison with the DC-9 Super 80 P&WA JT8D-209 turbofan powered aircraft. The configuration feasibility, aerodynamics, propulsion, structural loads, structural dynamics, sonic fatigue, acoustics, weight maintainability, performance, rough order of magnitude economics, and airline coordination are examined. The effects of alternate cruise Mach number, mission stage lengths, and propfan design characteristics are considered. Recommendations for further study, ground testing, and flight testing are included.

  14. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink

    2015-02-01

    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  15. Malachi’s concern for social justice: Malachi 2:17 and 3:5 and its ethical imperatives for faith communities

    Directory of Open Access Journals (Sweden)

    Blessing O. Bọlọjẹ

    2014-07-01

    Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.

  16. On employing H216O, H217O, H218O, and D216O lines as frequency standards in the 15-170 cm-1 window

    International Nuclear Information System (INIS)

    Furtenbacher, Tibor; Csaszar, Attila G.

    2008-01-01

    The protocol MARVEL, standing for measured active rotational-vibrational energy levels, is used to study high-accuracy measurements of rotational lines of four isotopologues of water, H 2 16 O, H 2 17 O, H 2 18 O, and D 2 16 O, obtained by spectroscopy in the far-infrared (FIR) region of 15-170 cm -1 by Matsushima et al. [Matsushima F, Odashima H, Iwasaki T, Tsunekawa S, Takagi K. Frequency measurement of pure rotational transitions of H 2 O from 0.5 to 5 THz. J Mol Struct 1995; 352/353, 371-8; Matsushima F, Nagase H, Nakauchi T, Odashima H, Takagi K. Frequency measurement of pure rotational transitions of H 2 17 O and H 2 18 O from 0.5 to 5 THz. J Mol Spectrosc 1999;193: 217-23; Matsushima F, Matsunaga M, Qian GY, Ohtaki Y, Wang RL, Takagi K. Frequency measurement of pure rotational transitions of D 2 O from 0.5 to 5 THz. J Mol Spectrosc 2001;206: 41-6; Matsushima F, Tomatsu N, Nagai T, Moriwaki Y, Takagi K. Frequency measurement of pure rotational transitions in the v 2 =1 state of H 2 O. J Mol Spectrosc 2006;235: 190-5]. MARVEL validates the high accuracy of most of the measured line positions. It results in a considerable number of energy levels with an average internal uncertainty of only 40 kHz (2σ). It also supports serious inaccuracy problems when Watson-type A-reduced Hamiltonians are used for predicting the highly accurate rotational measurements for water. Finally, MARVEL suggests a large number of para-water levels, for example 41 for H 2 16 O, which are candidates for becoming frequency standards in the FIR region of 15-170 cm -1 (the 0.5-5 THz window) when an accuracy of about 0.1 MHz is deemed to be sufficient

  17. Surface ablation with iris recognition and dynamic rotational eye tracking-based tissue saving treatment with the Technolas 217z excimer laser.

    Science.gov (United States)

    Prakash, Gaurav; Agarwal, Amar; Kumar, Dhivya Ashok; Jacob, Soosan; Agarwal, Athiya; Maity, Amrita

    2011-03-01

    To evaluate the visual and refractive outcomes and expected benefits of Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking. This prospective, interventional case series comprised 122 eyes (70 patients). Pre- and postoperative assessment included uncorrected distance visual acuity (UDVA), corrected distance visual acuity (CDVA), refraction, and higher order aberrations. All patients underwent Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking using the Technolas 217z 100-Hz excimer platform (Technolas Perfect Vision GmbH). Follow-up was performed up to 6 months postoperatively. Theoretical benefit analysis was performed to evaluate the algorithm's outcomes compared to others. Preoperative spherocylindrical power was sphere -3.62 ± 1.60 diopters (D) (range: 0 to -6.75 D), cylinder -1.15 ± 1.00 D (range: 0 to -3.50 D), and spherical equivalent -4.19 ± 1.60 D (range: -7.75 to -2.00 D). At 6 months, 91% (111/122) of eyes were within ± 0.50 D of attempted correction. Postoperative UDVA was comparable to preoperative CDVA at 1 month (P=.47) and progressively improved at 6 months (P=.004). Two eyes lost one line of CDVA at 6 months. Theoretical benefit analysis revealed that of 101 eyes with astigmatism, 29 would have had cyclotorsion-induced astigmatism of ≥ 10% if iris recognition and dynamic rotational eye tracking were not used. Furthermore, the mean percentage decrease in maximum depth of ablation by using the Tissue Saving Treatment was 11.8 ± 2.9% over Aspheric, 17.8 ± 6.2% over Personalized, and 18.2 ± 2.8% over Planoscan algorithms. Tissue saving surface ablation with iris recognition and dynamic rotational eye tracking was safe and effective in this series of eyes. Copyright 2011, SLACK Incorporated.

  18. 217 - 222_Kawo and Bello

    African Journals Online (AJOL)

    User

    1Department of Microbiology, Faculty of Science, Bayero University, PMB 3011, ... information to evaluate health risks for consumers. ... Kano Teaching Hospital, Kano, Nigeria, after seeking .... present in members of the Listeria genus with.

  19. Atti : programs 2-17

    OpenAIRE

    Grech, Sergio

    1998-01-01

    A series of programs where producer and presenter Sergio Grech explores the story of theatre in Malta and the contribution that various personalities gave to enrich it. Unfortunately, program 1 was lost.

  20. Hormone withdrawal-associated symptoms with ethinylestradiol 20 µg/drospirenone 3 mg (24/4 regimen versus ethinylestradiol 20 µg/desogestrel 150 µg (21/7 regimen

    Directory of Open Access Journals (Sweden)

    Bitzer J

    2015-05-01

    Full Text Available Johannes Bitzer,1 Maria Jesusa Banal-Silao,2 Hans-Joachim Ahrendt,3 Jaime Restrepo,4 Marion Hardtke,5 Ulrike Wissinger-Graefenhahn,6 Dietmar Trummer7 1Department of Obstetrics and Gynecology, University Hospital of Basel, Basel, Switzerland; 2University of the Philippines College of Medicine, Manila, Philippines; 3Praxis für Frauenheilkunde, Klinische Forschung und Weiterbildung (Clinical Research and Further Education, Magdeburg, Germany; 4Centro de Investigación Clínica, Clinica Medellin Poblado, Medellin, Colombia; 5Global Clinical Development Operations, Bayer Pharma AG, Berlin, Germany; 6Global Medical Affairs Women’s Healthcare, Bayer Pharma AG, Berlin, Germany; 7Clinical Statistics Europe, Bayer Pharma AG, Berlin, Germany Objective: To assess whether the combined oral contraceptive (COC ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4-day regimen (ie, 4-day hormone-free interval is more effective than an EE 20 µg/desogestrel (DSG 150 µg COC taken in a 21/7-day regimen (ie, 7-day hormone-free interval in reducing hormone withdrawal-associated symptoms (HWAS.Methods: This double-blind, randomized study (NLM identifier: NCT01076582 was conducted at 34 centers in 12 countries. Otherwise healthy women who experienced ≥2 HWAS of headache, pelvic pain, and/or bloating when using their current COCs in a 21/7-day regimen were recruited. Subjects rated the severity of their HWAS daily on a seven-point Likert scale during a baseline cycle and during four 28-day cycles with EE/drospirenone 24/4 (n=290 or EE/DSG 21/7 (n=304. The primary variable was the mean change from baseline to cycle 4 in the composite HWAS score (sum of scores for all three symptoms during cycle days 22–28.Results: In the EE/drospirenone 24/4 group, the mean (standard deviation composite HWAS score during cycle days 22–28 was reduced from 42.2 (24.8 at baseline to 12.8 (13.4 at cycle 4 (change from baseline: -30.3 [22.9]. In the EE/DSG 21/7 group, the

  1. Properties of 15/2- states in 215Ra and 217Th; evaluation of the 15/2- to 9/2+ E3 strength in N=127 isotones

    International Nuclear Information System (INIS)

    Dracoulis, G.D.; Riess, R.; Stuchbery, A.E.; Bark, R.A.; Gupta, S.L.; Baxter, A.M.; Kruse, M.

    1988-01-01

    The lifetime of the yrast 15/2 - state in 215 Ra was measured using pulsed beams and γ-ray and electron techniques. Transition multipolarities were established from measured conversion coefficients. The B(E3) of the 15/2 - → 9/2 + transition is found to be considerably larger than previously reported. A candidate for the corresponding transition in 217 Th was also observed. The E3 strength of the 15/2 - → 9/2 + transition in the N=127 isotones is evaluated in the light of these and other recent results. Interpretation in the framework of particle-octupole vibration coupling requires a systematic lowering of the core 3 - vibration as proton pairs are added to 208 Pb

  2. Decay analysis of compound nuclei formed in reactions with exotic neutron-rich 9Li projectile and the synthesis of 217At* within the dynamical cluster-decay model

    Science.gov (United States)

    Kaur, Arshdeep; Kaushal, Pooja; Hemdeep; Gupta, Raj K.

    2018-01-01

    The decay of various compound nuclei formed via exotic neutron-rich 9Li projectile is studied within the dynamical cluster-decay model (DCM). Following the earlier work of one of us (RKG) and collaborators (M. Kaur et al. (2015) [1]), for an empirically fixed neck-length parameter ΔRemp, the only parameter in the DCM, at a given incident laboratory energy ELab, we are able to fit almost exactly the (total) fusion cross section σfus =∑x=16σxn for 9Li projectile on 208Pb and other targets, with σfus depending strongly on the target mass of the most abundant isotope and its (magic) shell structure. This result shows the predictable nature of the DCM. The neck-length parameter ΔRemp is fixed empirically for the decay of 217At* formed in 9Li + 208Pb reaction at a fixed laboratory energy ELab, and then the total fusion cross section σfus calculated for all other reactions using 9Li as a projectile on different targets. Apparently, this procedure could be used to predict σfus for 9Li-induced reactions where experimental data are not available. Furthermore, optimum choice of "cold" target-projectile combinations, forming "hot" compact configurations, are predicted for the synthesis of compound nucleus 217At* with 8Li + 209Pb as one of the target-projectile combination, or another (t , p) combination 48Ca + 169Tb, with a doubly magic 48Ca, as the best possibility.

  3. 14 CFR 120.217 - Tests required.

    Science.gov (United States)

    2010-01-01

    ... best available information at the time of the determination, that the covered employee's performance... involving the performance of safety-sensitive functions). (2) You must treat all safety-sensitive employees... employee for alcohol if that employee's performance of a safety-sensitive function either contributed to...

  4. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Knowledge integration and the adoption of new agricultural technologies: Kenyan perspectives (restricted access). The study aims to identify and better understand the barriers to knowledge integration for improved agricultural technologies and their adoption. Results suggest a potential link between farmers'' levels of ...

  5. 14 CFR 217.10 - Instructions.

    Science.gov (United States)

    2010-01-01

    ... compatible disk. Carriers wishing to use a different ADP procedure or e-mail must obtain written approval to... aircraft type— B-1—Aircraft type code B-2—Revenue aircraft departures B-3—Revenue passengers transported B-4—Revenue freight transported (kg) Sum of all aircraft types— C-1-Total revenue passengers in market...

  6. 22 CFR 217.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., structures, equipment, roads, walks, parking lots, or other real or personal property or interest in such... property or the safety of others. (ii) Major life activities means functions such as caring for one's self... vocational education services, a handicapped person who meets the academic and technical standards requisite...

  7. 48 CFR 217.7801 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... elements of the Department of Homeland Security concerned with the analysis of intelligence information... order for the acquisition of supplies or services on behalf of DoD. Direct acquisition means the type of interagency contracting through which DoD orders a supply or service from a Governmentwide acquisition...

  8. 49 CFR 217.2 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C. 20106 (section 20106), issuance of the regulations in this part preempts any State law, regulation, or order covering the same subject matter, except an additional or more stringent law, regulation, or order...

  9. 48 CFR 252.217-7007 - Payments.

    Science.gov (United States)

    2010-10-01

    ... Officer shall approve progress payments based on the value, computed on the price of the job order, of... Contracting Officer may require. (c) The Government will retain until final completion and acceptance of all... direct that progress payments be based on the price of the job order as adjusted as a result of change...

  10. 22 CFR 217.44 - Academic adjustments.

    Science.gov (United States)

    2010-04-01

    ..., manual, or speaking skills as will best ensure that the results of the evaluation represents the student... speaking skills (except where such skills are the factors that the test purports to measure). (d) Auxiliary... sensory, manual, or speaking skills. (2) Auxiliary aids may include taped texts, interpreters or other...

  11. 48 CFR 252.217-7006 - Title.

    Science.gov (United States)

    2010-10-01

    ... performance of a job order shall vest in the Government upon delivery at the location specified for the performance of the work. (b) Upon completion of the job order, or with the approval of the Contracting Officer during performance of the job order, all Contractor-furnished materials and equipment not incorporated in...

  12. 48 CFR 217.7402 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... maximum extent practicable (also see paragraph (b) of this section): (1) UCAs for foreign military sales...) Congressionally mandated long-lead procurement contracts. (b) If the contracting officer determines that it is...

  13. 48 CFR 217.170 - General.

    Science.gov (United States)

    2010-10-01

    ... contract to the cost of an annual procurement approach, using a present value analysis. Do not award the multiyear contract unless the analysis shows that the multiyear contract will result in the lower cost (10 U...

  14. 22 CFR 217.5 - Assurances required.

    Science.gov (United States)

    2010-04-01

    ... benefits. (2) In the case of Federal financial assistance extended to provide personal property, the... or recording this transfer shall contain a covenant running with the land to assure nondiscrimination... services or benefits. (2) Where no transfer of property is involved but property is purchased or improved...

  15. 48 CFR 217.7802 - Policy.

    Science.gov (United States)

    2010-10-01

    ... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... threshold through a non-DoD agency in any fiscal year only if the head of the non-DoD agency has certified... order exceeds the simplified acquisition threshold. These procedures shall include— (1) Evaluating...

  16. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity ... Through books, articles, research publications, and studies, we aim to widen the ... Case study : SIRCA; building evaluation capacity - a review of awarding, ... Behind the Scenes at a Climate Change Knowledge Sharing Network: IDS ...

  17. 48 CFR 217.7102 - General.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and... contractors located outside the United States and its outlying areas. (c) Activities may issue job orders... government in the solicitation and job order. [56 FR 36345, July 31, 1991, as amended at 70 FR 35544, June 21...

  18. 48 CFR 217.7101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... master agreement. (2) Is not a contract. (b) Job order— (1) Is a fixed price contract incorporating, by... pertaining to subjects not covered by the master agreement; but applicable to the job order being awarded...

  19. 12 CFR 217.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... that is considered to be a deposit under § 204.2(a) of the Board's Regulation D—Reserve Requirements of... bank under § 204.2(o) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM PROHIBITION AGAINST THE...

  20. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    As reliable and timely health information is essential for public health action and ... proposals from the findings towards revising and developing the livelihoods inquiry. ... Kebijakan kawasan tanpa rokok : peluang dan hambatan (restricted access) ... This case study provides a summary of the Utilization Focused Evaluation ...

  1. Immunogenicity, safety and reactogenicity of the pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV) in 2-17-year-old children with asplenia or splenic dysfunction: A phase 3 study.

    Science.gov (United States)

    Szenborn, L; Osipova, I V; Czajka, H; Kharit, S M; Jackowska, T; François, N; Habib, M A; Borys, D

    2017-09-25

    Immunization with pneumococcal vaccines is an important prophylactic strategy for children with asplenia or splenic dysfunction, who are at high risk of bacterial infections (including S. pneumoniae). This study aimed to assess immunogenicity and safety of pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV, GSK) in this at-risk population. This phase III, multi-centre, open-label, controlled study, in which at-risk children with asplenia or splenic dysfunction were enrolled (age strata: 2-4, 5-10 and 11-17years), was conducted in Poland and the Russian Federation. For the 2-4years at-risk group, healthy age-matched children were enrolled as control. Unprimed children (not previously vaccinated with any pneumococcal vaccine) received 2 PHiD-CV doses (≥2months apart) and pneumococcal vaccine-primed children received 1 dose. Immune responses were assessed pre-vaccination and one month post-each dose. Solicited and unsolicited adverse events (AEs) were recorded for 4 and 31days post-vaccination, respectively, and serious AEs (SAEs) throughout the study. Of 52 vaccinated children (18 at-risk primed, 28 at-risk unprimed and 6 control unprimed), 45 (18, 23 and 4, respectively) were included in the according-to-protocol cohort for immunogenicity. Post-vaccination (post-dose 1 in primed and post-dose 2 in unprimed children), for each vaccine pneumococcal serotype and vaccine-related serotype 6A all at-risk children had antibody concentrations ≥0.2µg/mL, and for vaccine-related serotype 19A at least 94.4%. Increases in antibody geometric mean concentrations were observed. For most serotypes, all at-risk children had post-vaccination opsonophagocytic activity (OPA) titers ≥8 and increases in OPA geometric mean titers were observed. No safety concerns were raised. One non-fatal SAE (respiratory tract infection, considered not vaccine-related) was reported by one at-risk unprimed child. PHiD-CV was immunogenic and well tolerated in 2-17

  2. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    Science.gov (United States)

    2010-10-01

    ... piece of window glazing and each surrounding window frame when tested in accordance with the procedure... of the rear emergency door or doors shall be 45 inches high, 22 inches wide, and six inches deep. S5...

  3. 28 CFR 16.200 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... action on behalf of the Commission where such deliberations determine or result in the joint conduct or... jurisdiction cases pursuant to 28 CFR 2.17(a); (4) Meetings of the entire Commission to determine original jurisdiction appeal cases pursuant to 28 CFR 2.27; and (5) Meetings of the National Appeals Board pursuant to...

  4. 76 FR 33764 - Announcement of Meeting of the Secretary's Advisory Committee on National Health Promotion and...

    Science.gov (United States)

    2011-06-09

    ... Committee on National Health Promotion and Disease Prevention Objectives for 2020 AGENCY: Department of... of Disease Prevention and Health Promotion. ACTION: Notice of Meeting. Authority: 42 U.S.C. 217a... next Federal advisory committee meeting regarding the national health promotion and disease prevention...

  5. 76 FR 16777 - Announcement of Meeting of the Secretary's Advisory Committee on National Health Promotion and...

    Science.gov (United States)

    2011-03-25

    ... Committee on National Health Promotion and Disease Prevention Objectives for 2020 AGENCY: Department of... of Disease Prevention and Health Promotion. ACTION: Notice of meeting. Authority: 42 U.S.C. 217a... federal advisory committee meeting regarding the national health promotion and disease prevention...

  6. 75 FR 37813 - Announcement of Meeting of the Secretary's Advisory Committee on National Health Promotion and...

    Science.gov (United States)

    2010-06-30

    ... Committee on National Health Promotion and Disease Prevention Objectives for 2020 AGENCY: Department of... Disease Prevention and Health Promotion. ACTION: Notice of meeting. Authority: 42 U.S.C. 217a, Section 222... federal advisory committee meeting regarding the national health promotion and disease prevention...

  7. Genetic and serological typing of European infectious haematopoietic necrosis virus (IHNV) isolates

    DEFF Research Database (Denmark)

    Johansson, Tove; Einer-Jensen, Katja; Batts, William

    2009-01-01

    Infectious haematopoietic necrosis virus (IHNV) causes the lethal disease infectious haematopoietic necrosis (IHN) in juvenile salmon and trout. The nucleocapsid (N) protein gene and partial glycoprotein (G) gene (nucleotides 457 to 1061) of the European isolates IT-217A, FR-32/87, DE-DF 13/98 11...

  8. 78 FR 25447 - Establishment of the Discretionary Advisory Committee on Heritable Disorders in Newborns and...

    Science.gov (United States)

    2013-05-01

    ... Health Service Act (PHS), 42 U.S.C. 217a: Advisory councils or committees as well as provisions of Public... newborn and childhood screening and technical information for the development of policies and priorities... Administration--or their designees. The Chair and other members are (a) medical, technical, public health or...

  9. A 21.7 kb DNA segment on the left arm of yeast chromosome XIV carries WHI3, GCR2, SPX18, SPX19, an homologue to the heat shock gene SSB1 and 8 new open reading frames of unknown function.

    Science.gov (United States)

    Jonniaux, J L; Coster, F; Purnelle, B; Goffeau, A

    1994-12-01

    We report the amino acid sequence of 13 open reading frames (ORF > 299 bp) located on a 21.7 kb DNA segment from the left arm of chromosome XIV of Saccharomyces cerevisiae. Five open reading frames had been entirely or partially sequenced previously: WHI3, GCR2, SPX19, SPX18 and a heat shock gene similar to SSB1. The products of 8 other ORFs are new putative proteins among which N1394 is probably a membrane protein. N1346 contains a leucine zipper pattern and the corresponding ORF presents an HAP (global regulator of respiratory genes) upstream activating sequence in the promoting region. N1386 shares homologies with the DNA structure-specific recognition protein family SSRPs and the corresponding ORF is preceded by an MCB (MluI cell cycle box) upstream activating factor.

  10. Orbit-Attitude Changes of Objects in Near Earth Space Induced by Natural Charging

    Science.gov (United States)

    2017-05-02

    Program Manager Technical Advisor, Spacecraft Component Technology //SIGNED// JOHN BEAUCHEMIN Chief Engineer, Spacecraft Technology Division...istration (NASA) and the US Air Force to investigate the effects of charging and develop technologies to mitigate the same. Accumulated charges may...e2 [ Sesin f +T (1+ ecos f ) ] (217a) de dt = √ 1− e2 na [ S sin f +T (cos f + cosE) ] (217b) di dt = r cos(ω + f ) na2 √ 1− e2 W (217c) dΩ dt = r sin

  11. 48 CFR 252.217-7027 - Contract definitization.

    Science.gov (United States)

    2010-10-01

    ...., fixed-price or cost-and-fee) proposal and cost or pricing data supporting its proposal. (b) The schedule for definitizing this contract is as follows (insert target date for definitization of the contract... of the make-or-buy and subcontracting plans and cost or pricing data). (c) If agreement on a...

  12. 48 CFR 552.217-70 - Evaluation of Options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Evaluation of Options. 552... Evaluation of Options. As prescribed in 517.208(a), insert the following provision: Evaluation of Options... period price. When option year pricing is based on a formula (e.g., changes in the Producer Price Index...

  13. 31 CFR 0.217 - Personal financial interests.

    Science.gov (United States)

    2010-07-01

    ... hold the following financial interests without violating 18 U.S.C. 208(a): (1) The stocks or bonds of a publicly traded corporation with a value of $1000 or less; and (2) The stocks or bonds in the investment portfolio of a diversified mutual fund in which an employee has invested. (b) The Department has found that...

  14. 48 CFR 217.7404-6 - Allowable profit.

    Science.gov (United States)

    2010-10-01

    ... ensure the profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The requirements at 215.404...

  15. 48 CFR 52.217-2 - Cancellation Under Multiyear Contracts.

    Science.gov (United States)

    2010-10-01

    ... precluded anticipated benefits of Contractor or subcontractor learning. (g) The claim shall not include— (1...) This contract may include an Option clause with the period for exercising the option limited to the...

  16. 48 CFR 1252.217-76 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ...) The Contractor shall not make any allowance in the contract price for the inclusion of any premium... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  17. 48 CFR 252.217-7012 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ...) The Contractor shall not make any allowance in the job order price for the inclusion of any premium... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  18. 48 CFR 3052.217-95 - Liability and insurance (USCG).

    Science.gov (United States)

    2010-10-01

    ... inclusion of any premium expense or charge for any reserve made on account of self-insurance for coverage... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  19. All projects related to | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Mexico, North and Central America, South America. Program: Maternal and Child Health. Total Funding: CA$ 391,650.00. Understanding Southern Influence in Cyberspace Security and Governance: Toward a Global Network of Southern-based Cyber Scholars. Project. The securitization of cyberspace - that is, ...

  20. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .ab1 QG_EFGHJ lettuce serriola Lactuca sativa cDNA clone QGJ1L02, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsx... 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia milti

  1. 7 CFR 2.17 - Under Secretary for Rural Development.

    Science.gov (United States)

    2010-01-01

    ... research and analysis, statistical programs, and associated service work related to rural people and the...). (iii) Designate the chief executive officer of the Rural Telephone Bank. (iv) Administer the following...

  2. 48 CFR 217.171 - Multiyear contracts for services.

    Science.gov (United States)

    2010-10-01

    ... services (e.g., ground maintenance, in-plane refueling, bus transportation, and refuse collection and... installation being closed or realigned under a base closure law as defined in 10 U.S.C. 2667(h)(2); or (C) A... Public Law 105-56 and similar sections in subsequent DoD appropriations acts); or (ii) A cancellation...

  3. 27 CFR 9.217 - Happy Canyon of Santa Barbara.

    Science.gov (United States)

    2010-04-01

    ..., which is a boundary line of the Los Padres National Forest, to its intersection with the southwest corner of section 18 that coincides with one of the two 90-degree, southwest corners of the Los Padres... Padres National Forest, to its intersection with the boundary line of the Cañada de Los Pinos, or College...

  4. 34 CFR 685.217 - Teacher loan forgiveness program.

    Science.gov (United States)

    2010-07-01

    ... borrower— (A) Demonstrated knowledge and teaching skills in reading, writing, mathematics, and other areas...) May receive up to $17,500 of loan forgiveness if the borrower— (A) Taught mathematics or science on a full-time basis at an eligible secondary school, or taught mathematics or science to secondary school...

  5. 217 | Page A JURISPRUDENCE OF THE RULE OF LAW: AN ...

    African Journals Online (AJOL)

    Fr. Ikenga

    In the previous republics in Nigeria, the rule of law has not been .... 5 T. Aquinas in S.O. Eboh, Legal Theories and The African Concept of Law, Heb – Uni – Tech ... Not only with us no man is above the law (what is a different thing) that here.

  6. 48 CFR 252.217-7014 - Discharge of liens.

    Science.gov (United States)

    2010-10-01

    ... discharged, any lien or right in rem of any kind, other than in favor of the Government, that exists or...) If any lien or right in rem is not immediately discharged, the Government, at the expense of the Contractor, may discharge, or cause to be discharged, the lien or right. (End of clause) ...

  7. 48 CFR 1252.217-78 - Discharge of liens.

    Science.gov (United States)

    2010-10-01

    ... lien or right in rem of any kind, other than in favor of the Government, that exists or arises in connection with work done or materials furnished under this contract. (b) If any such lien or right in rem is... to be discharged, the lien or right. (End of clause) ...

  8. 48 CFR 3052.217-97 - Discharge of liens (USCG).

    Science.gov (United States)

    2010-10-01

    ...) (a) The Contractor shall immediately discharge or cause to be discharged, any lien or right in rem of... materials furnished under this contract. (b) If any such lien or right in rem is not immediately discharged... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Discharge of liens (USCG...

  9. 12038_2016_9610_Article_print 205..217

    Indian Academy of Sciences (India)

    2016-05-13

    May 13, 2016 ... ground fluorescence from the HL5 medium, cells were in- cubated in 'Loflo' .... in the segregation of anterograde and retrograde trans- ported proteins .... enriched Golgi appears to be fractionated (figure 6, pan- el 1E).

  10. 8 CFR 217.5 - Electronic System for Travel Authorization.

    Science.gov (United States)

    2010-01-01

    ...) Required elements. ESTA will collect such information as the Secretary deems necessary to issue a travel... changes his or her name; (3) The alien changes his or her gender; (4) The alien's country of citizenship...

  11. 29 CFR 1910.217 - Mechanical power presses.

    Science.gov (United States)

    2010-07-01

    ..., including relays, limit switches, and static output circuits. (9) Slide counterbalance systems. (i) Spring...., mechanical, electro-mechanical, or electronic) shall meet the requirements of paragraph (b)(13) of this...

  12. JCSC_128_2_217-226_SI_a.doc

    Indian Academy of Sciences (India)

    All reagents were purchased from TCI and Sigma Aldrich and used without further purification. All the products ... General procedure for the four component synthesis of compounds 13 and 14: A solution of 4-chloro-3-formyl coumarin (1 mmol), morpholine/ thiomorpholine (2 mmol) were refluxed for 2 min in benzene. To this ...

  13. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico...

  14. 217 THE LAND USE ACT AND EQUITY FACTOR IN PROPERTY ...

    African Journals Online (AJOL)

    Fr. Ikenga

    discretion in tax management, provides harsh and inequitable penalties on tax defaulters, does not provide any .... remains one of the fundamental pillars of taxation guideline globally. ..... expense of the land owner and a disincentive to property investments. It is an .... establishing clear indices for tax valuation and review.

  15. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

    Science.gov (United States)

    2013-01-02

    ...-time employees on business days during the preceding calendar year. For purposes of determining whether... referred to, for convenience, as the ``look-back measurement method.'') This method may not be used for... employer (the start date), a new employee was reasonably expected to be employed an average of 30 hours of...

  16. 20 CFR 702.217 - Penalty for false statement, misrepresentation.

    Science.gov (United States)

    2010-04-01

    ... representation for the purpose of obtaining a benefit or payment under this Act shall be guilty of a felony, and... or representation for the purpose of reducing, denying or terminating benefits to an injured employee, or his dependents pursuant to section 9, 33 U.S.C. 909, if the injury results in death, shall be...

  17. 48 CFR 217.7103-4 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... soliciting offers, may issue a written job order to a contractor that has previously executed a master...

  18. 48 CFR 217.7103-2 - Period of agreement.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for.... (c) Cancellation of a master agreement does not affect the rights and liabilities under any job order existing at the time of cancellation. The contractor must continue to perform all work covered by any job...

  19. 48 CFR 217.7103-6 - Modification of master agreements.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS... only by modifying the master agreement itself. It shall not be changed through a job order. (c) A modification to a master agreement shall not affect job orders issued before the effective date of the...

  20. Piezoelectric and Electrostrictive Materials for Transducer Applications.

    Science.gov (United States)

    1984-05-01

    nfornation Center Battelle Memoria : :nsz~ftu -e Army Materials and ’Iec.hanics ;05 igAeu Researcl Center Columous, O!H 13201 .iatartown, >A217 A77N...Sylvania epartment of Ceramic Engineering 100 Endicott Street University of m11incis Danvers, YA 01923 Urbana , Illinois 51801 .r. allace A. Smit...Oanvers, MA 01923 Urbana , il1inois 61801 Oi-.. allace A. Smith Professor 3. A. Aul. Ortf American Philips Laboratories Stanford University 3

  1. Test plan: Potash Core Test. WIPP experimental program borehole plugging

    International Nuclear Information System (INIS)

    Christensen, C.L.

    1979-09-01

    The Potash Core Test will utilize a WIPP emplaced plug to obtain samples of an in-situ cured plug of known mix constituents for bench scale testing. An earlier effort involved recovery at the salt horizon of Plug 217, a 17 year old plug in a potash exploration hole for bond testing, but the lack of particulars in the emplacement precluded significant determination of plug performance

  2. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2012-09-01

    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  3. Occurrence and removal of estrogens in Brazilian wastewater treatment plants

    International Nuclear Information System (INIS)

    Pessoa, Germana P.; Souza, Neyliane C. de; Vidal, Carla B.; Alves, Joana A.C.; Firmino, Paulo Igor M.; Nascimento, Ronaldo F.; Santos, André B. dos

    2014-01-01

    This paper evaluated the occurrence and removal efficiency of four estrogenic hormones in five biological wastewater treatment plants (WWTPs), located in the State of Ceará, Brazil. The five WWTPs comprised: two systems consisted of one facultative pond followed by two maturation ponds, one facultative pond, one activated sludge (AS) system followed by a chlorination step, and one upflow anaerobic sludge blanket (UASB) reactor followed by a chlorination step. Estrogen occurrence showed a wide variation among the analyzed influent and effluent samples. Estrone (E1) showed the highest occurrence in the influent (76%), whereas both 17β-estradiol (E2) and 17α-ethynylestradiol (EE2) presented a 52% occurrence, and the compound 17β-estradiol 17-acetate (E2-17A), a 32% one. The occurrence in the effluent samples was 48% for E1, 28% for E2, 12% for E2-17A, and 40% for EE2. The highest concentrations of E1 and EE2 hormones in the influent were 3050 and 3180 ng L −1 , respectively, whereas E2 and E2-17A had maximum concentrations of 776 and 2300 ng L −1 , respectively. The lowest efficiencies for the removal of estrogenic hormones were found in WWTP consisted of waste stabilization ponds, ranging from 54 to 79.9%. The high-rate systems (AS and UASB), which have chlorination as post-treatment, presented removal efficiencies of approximately 95%. - Highlights: • The occurrence of four endocrine disrupting chemicals was evaluated. • The removal efficiency of four hormones in low-cost plants was examined. • Estrogen occurrence showed a wide variation in influent and effluent samples. • Estrone showed the highest occurrence in the influent and the effluent samples. • WSP treatment was observed to be less effective for removing estrogens

  4. Occurrence and removal of estrogens in Brazilian wastewater treatment plants

    Energy Technology Data Exchange (ETDEWEB)

    Pessoa, Germana P. [Department of Hydraulic and Environmental Engineering, Federal University of Ceará, Rua do Contorno, S/N Campus do Pici, Bl. 713, CEP: 60455-900, Fortaleza, CE (Brazil); Souza, Neyliane C. de [Department Sanitary and Environmental Engineering, State University of Paraíba, Rua Juvêncio Arruda, S/N, Campus Universitário, Bodocongó, CEP: 58109-790, Campina Grande, PB (Brazil); Vidal, Carla B.; Alves, Joana A.C.; Firmino, Paulo Igor M. [Department of Hydraulic and Environmental Engineering, Federal University of Ceará, Rua do Contorno, S/N Campus do Pici, Bl. 713, CEP: 60455-900, Fortaleza, CE (Brazil); Nascimento, Ronaldo F. [Department of Analytical Chemistry and Physical Chemistry, Federal University of Ceará, Rua do Contorno, S/N Campus do Pici, Bl. 940, CEP: 60451-970, Fortaleza, CE (Brazil); Santos, André B. dos, E-mail: andre23@ufc.br [Department of Hydraulic and Environmental Engineering, Federal University of Ceará, Rua do Contorno, S/N Campus do Pici, Bl. 713, CEP: 60455-900, Fortaleza, CE (Brazil)

    2014-08-15

    This paper evaluated the occurrence and removal efficiency of four estrogenic hormones in five biological wastewater treatment plants (WWTPs), located in the State of Ceará, Brazil. The five WWTPs comprised: two systems consisted of one facultative pond followed by two maturation ponds, one facultative pond, one activated sludge (AS) system followed by a chlorination step, and one upflow anaerobic sludge blanket (UASB) reactor followed by a chlorination step. Estrogen occurrence showed a wide variation among the analyzed influent and effluent samples. Estrone (E1) showed the highest occurrence in the influent (76%), whereas both 17β-estradiol (E2) and 17α-ethynylestradiol (EE2) presented a 52% occurrence, and the compound 17β-estradiol 17-acetate (E2-17A), a 32% one. The occurrence in the effluent samples was 48% for E1, 28% for E2, 12% for E2-17A, and 40% for EE2. The highest concentrations of E1 and EE2 hormones in the influent were 3050 and 3180 ng L{sup −1}, respectively, whereas E2 and E2-17A had maximum concentrations of 776 and 2300 ng L{sup −1}, respectively. The lowest efficiencies for the removal of estrogenic hormones were found in WWTP consisted of waste stabilization ponds, ranging from 54 to 79.9%. The high-rate systems (AS and UASB), which have chlorination as post-treatment, presented removal efficiencies of approximately 95%. - Highlights: • The occurrence of four endocrine disrupting chemicals was evaluated. • The removal efficiency of four hormones in low-cost plants was examined. • Estrogen occurrence showed a wide variation in influent and effluent samples. • Estrone showed the highest occurrence in the influent and the effluent samples. • WSP treatment was observed to be less effective for removing estrogens.

  5. High prevalence of cardiac involvement in patients with myotonic dystrophy type 1

    DEFF Research Database (Denmark)

    Petri, Helle; Witting, Nanna; Ersbøll, Mads Kristian

    2014-01-01

    of controls. Thus, the optimal strategy for assessing cardiac involvement in DM1 is unclear. METHOD: In this large single-centre study, we evaluated 129 unselected DM1 patients (49.6% men), mean (SD) age 44 (14.7) years with family history, physical examination, electrocardiogram (ECG), echocardiography......) arrhythmias: atrial fibrillation/flutter (4.1%), other supraventricular tachyarrhythmia (7.3%) and non-sustained ventricular tachycardia (4.1%); and 3) structural abnormalities: left ventricular systolic dysfunction (20.6%) and reduced global longitudinal strain (21.7%). A normal ECG was not significantly...

  6. 48 CFR 552.217-71 - Notice Regarding Option(s).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice Regarding Option(s... Notice Regarding Option(s). As prescribed in 517.208(b), insert the following provision: Notice Regarding Option(s) (NOV 1992) The General Services Administration (GSA) has included an option to [Insert...

  7. 40 CFR 80.217 - How does a refiner or importer apply for the GPA standards?

    Science.gov (United States)

    2010-07-01

    ... annual average sulfur standard for gasoline produced for use in the GPA for the 2004 through 2006 annual... for gasoline produced for use in the GPA. (d) If EPA finds that a refiner or importer provided false... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Geographic Phase...

  8. 5 CFR 591.217 - In which outlets does OPM collect prices?

    Science.gov (United States)

    2010-01-01

    ... data collection areas, accessibility by road, physical size, advertising, and other characteristics that reflect sales volume. To the extent practical, OPM prices like items in the same types of outlets...

  9. 217. Experiencia en asistencia circulatoria mecánica en nuestro centro

    Directory of Open Access Journals (Sweden)

    J. Otero

    2012-04-01

    Conclusiones: Dada la gravedad de estos pacientes, con mortalidad cercana al 100% sin asistencia, consideramos el beneficio que aporta esta técnica y la gran utilidad que representa su disponibilidad.

  10. Laboratory manual for salt-mixing test in 37- and 217-pin bundles

    International Nuclear Information System (INIS)

    Chan, Y.N.; Todreas, N.E.

    1980-08-01

    This laboratory manual deals with the procedure employed during salt tracer experiments used in evaluating the hydraulic characteristics of a rod bundle. A description of the standard equipment used is given together with the details of manufacture of probes used for detecting the salt concentration. Details of the bundle construction have been excluded as they are availble in the reference cited. An attempt has been made to point out potential trouble areas and procedures

  11. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    CERN Document Server

    2013-01-01

    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  12. 217 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    An alternative structure exist when a party does not perceive sufficiently important interest .... Considering the grand strategies of the superpowers during the cold war,. Freiberg .... the two adversaries; how they construct and interpret reality; and the. “bounded ... to loss… it can only make people behave to avoid it. The only.

  13. 48 CFR 252.217-7005 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... over activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms... the extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair; (6) Furnish the Contracting Officer or designated representative with a copy of the “gas-free” or...

  14. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG).

    Science.gov (United States)

    2010-10-01

    ... activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms containing... extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair... work is done on a tank; (7) Treat the contents of any tank as Government property in accordance with...

  15. 48 CFR 1252.217-73 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms containing... extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair... work is done on a tank; (7) Treat the contents of any tank as Government property in accordance with...

  16. 20 CFR 217.8 - When one application satisfies the filing requirement for other benefits.

    Science.gov (United States)

    2010-04-01

    .... Therefore a claimant does not need to file another application to be entitled to any of the following types of benefits: (a) An employee age annuity if— (1) The employee's application for a disability annuity... (2) The employee is entitled to a disability annuity in the month before the month he or she is 65...

  17. http://journals.tbzmed.ac.ir/JARCM/Manuscript/JARCM-2-217.pdf

    Directory of Open Access Journals (Sweden)

    Ali Ghavidel

    2014-11-01

    Full Text Available Introduction: Secondary aortoenteric fistula (SAF is an uncommon, but very important complication of abdominal aortic reconstruction. The complication often occurs months to years after aortic surgery. The clinical manifestation of the aortoenteric fistula is always upper gastrointestinal bleeding. Treatment of the disease is early surgical intervention. If operative treatment is not performed promptly, the mortality is high. Case Report: A case of secondary aortoduodenal fistula found 6 years after aortic reconstructive surgery, with the clinical presentation of upper gastrointestinal bleeding because of the increasing number of elective aortic aneurysm repairs in the aging population, it is likely that more patients with SAF will present to the clinical physicians in the future. Hence, a high index of suspicion is necessary for prompt diagnosis and treatment of this lifethreatening event. The patient treated medically and finally expiration of the patient and review of the literature currently available in Medline. Conclusion: The aim of this case report is to emphasize early diagnosis and management of all gastrointestinal bleeding in patients who have a history of aortic reconstructive surgery.

  18. Session 21.7 - Education Programs Promoting Light Pollution Awareness and IYL2015

    Science.gov (United States)

    Walker, Constance E.

    2016-10-01

    By proclaiming the IYL2015, the United Nations recognized the importance of light and light based technology in the lives of the citizens of the world and for the development of global society on many levels. Light and application of light science and technology are vital for existing and future advances in many scientific areas and culture. Light is a key element in astronomy: as astronomers, it is what we study and makes our science possible, but it is also what threatens our observations when it is set-off from the ground (light pollution). The UN-designated year 2015 represented a magnificent and unique opportunity for the global astronomical community to disseminate these messages and raise the awareness of the importance and preservation of dark skies for heritage and the natural environment. As such, the International Year of Light served as a launching pad for several projects during 2015. Two other projects with equally as impressive programs are highlighted and begin the narrative for this section on public education and outreach programs on light pollution issues and solutions.

  19. Q/SdR.04.896-2008 SQR7130A217/Model A Car

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    1.Background As the development of global economy demands an increasingly large quantity of energy,the energy crisis is getting more severe.Auto manufacturers in Japan,America,and Europe have all began to develop hybrid power vehicles or its technology platform since 1990s,so as to save energy.Relied on its THS system which consists of the planet wheel and e-CVT,TOYOTA developed a series of strong hybrid power vehicles,such as Prius,Lexus,Highlander,Camry,etc.Based on its IMA system,HONDA developed a series of mild hybrid power vehicles,such as Insight,Civic,Accord,etc.On the basis of its Belt-driven Starter Generator (BSG) system,French SPA Group developed a series of weak hybrid power vehicles,such as Citroen C3,Citroen C2,Citroen 1007,Citroen 207,etc.In America the research of hybrid power vehicle is being done actively by a group of relevant parties consisting of Department of Transport,Department of Defense,major auto companies and relevant organizations under the leadership of Department of Energy and with the large quantity ofinvestment from GE Motors Co.and CHRYSLER.

  20. Mid IR-fiber spectroscopy in the 2-17μm range

    Science.gov (United States)

    Artyushenko, Viatcheslav G.; Bocharnikov, A.; Colquhoun, Gary; Leach, Clive A.; Lobachov, Vladimir; Pirogova, Lyudmila; Sakharova, Tatjana; Savitskij, Dmitrij; Ezhevskaya, Tatjana; Bublikov, Alexandr

    2007-10-01

    The latest development in IR-fibre optics enables us to expand the spectral range of process spectroscopy from 2μm out to 17μm (5000 to 600cm-1) i.e. into the most informative "finger-print" part of the spectrum. Mid-IR wavelength ranges from 2 to 6-10μm may be covered by Chalcogenide IR-glass CIR-fibres while Polycrystalline PIR-fibres made of Silver Halides solid solutions transmit 4-17 μm wavelength radiation. PIR-fibre immersion ATR probes and Transmission/Reflection probes had been manufactured and successfully tested with different FTIR spectrometers in the field of remote spectroscopy for forensic substances identification, chemical reaction control, and monitoring of exhaust or exhalation gases. Using these techniques no sample preparation is necessary for fibre probes to measure evanescent, reflection and transmission spectra, in situ and in real time. QCL spectrometer may be used as a portable device for multispectral gas analysis at 1ppb level of detectivity for various applications in environmental pollution monitoring.

  1. Order No. 217 of 29 April 1977 on X-ray diagnostic equipment for medical use

    International Nuclear Information System (INIS)

    1978-01-01

    This Order was made by the National Health Service and is divided into several parts covering inter alia approval and notification of X-ray installations, conditions of liability, occupational radiation protection, construction of X-ray apparatus and its shielding and inspection of such equipment by the National Health Service. (NEA) [fr

  2. 49 CFR 232.217 - Train brake tests conducted using yard air.

    Science.gov (United States)

    2010-10-01

    ... reduction of brake pipe air pressure at the same, or slower, rate as an engineer's brake valve. (b) The yard... 49 Transportation 4 2010-10-01 2010-10-01 false Train brake tests conducted using yard air. 232... Train brake tests conducted using yard air. (a) When a train air brake system is tested from a yard air...

  3. 22 CFR Appendix A to Part 217 - Federal Financial Assistance to Which These Regulations Apply

    Science.gov (United States)

    2010-04-01

    ... and other qualified agricultural universities and colleges in the United States to develop their capabilities to assist developing countries in agricultural teaching, research and extension services. (Section... to research and educational institutions in the United States to strengthen their capacity to develop...

  4. People and things. CERN Courier, September 1981, v. 21(7)

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: The King of Belgium recently paid a state visit to the People's Republic of China and invited four Belgian scientists to accompany him — M. Engelborghs-Bertelsr P. Melchior (Royal Observatory of Brussels and Louvain), J. van der Veken (Louvain) and Y. Go/dschmidt-Clermont (Brussels and CERN). Yves Goldschmidt- Clermont provided us with the following report. Italian physicists are presently developing a large modular track detector to be installed in the future Gran Sasso underground laboratory. Such a 'Giant Underground track- Detector' (GUD), up to 10 Kt in mass, should be capable of investigating nucleon decay and the interactions of high energy cosmic neutrinos. An International Conference on Nucleus-Nucleus Collisions will be held at Michigan State University from 26 September to 1 October, 1982

  5. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Directory of Open Access Journals (Sweden)

    Ana Claudia Camargo Gonçalves da Silva

    2012-01-01

    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  6. : tous les projets | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...

  7. SU-D-217BCD-01: Corrupted DICOM Image Recovering: A Clinical Experience.

    Science.gov (United States)

    Chen, L; Walz-Flannigan, A; Langer, S

    2012-06-01

    Colored DICOM secondary capture images generated from CT perfusion studies were corrupted if they were sent directly from a Siemens acquisition workstation to a GE viewing workstation. However, those images were properly displayed in the GE viewing workstation if they were transferred through a GE PACS first. The purpose of this work is to investigate the cause of image corruption and determine why passing through PACS corrected it. DICOM headers of corrupted and non-corrupted (sent through the PACS) images were compared with a free DICOM software tool (http://DVTK.org); the differences were highlighted. Certain header tags were found in non-corrupted images, but not in corrupted images. These tags were sequentially removed until the non- corrupted image became corrupted. Once a candidate tag was found, fresh corrupt images were modified by adding a 'repair' tag and tested. It was found that the absence of Planar Configuration (0028, 0006) is the cause of image corruption. This attribute is used in the DICOM color image to specify whether the color pixel data are sent color-by-plane or color-by- pixel and should be present if the Sample per Pixel (0028, 0002) tag has a value greater than 1. In our DICOM color images, the values of (0028, 0002) and Photometric Interpretation (0028, 0004) are 3 and RGB, respectively. Thus (0028, 0006) should equal 0 (color-by-pixel), which is used for uncompressed or lossless compressed transfer syntaxes. Adding this tag and setting the value to zero manually repaired corrupt images. Using open source DICOM tools and following the described process can be a valuable ally in the search for causes of image corruption. Comparing the headers and finding the handful of different tags rapidly led to an explanation that could be used by the vendor for a permanent fix. © 2012 American Association of Physicists in Medicine.

  8. WE-E-217BCD-02: Update on the Upcoming ACR Digital Mammography QC Manual.

    Science.gov (United States)

    Berns, E

    2012-06-01

    We propose a new metric called Distance Discordance (DD), which is defined as the distance between two anatomic points from two moving images, which are co-located on some reference image, when deformed onto another reference image. To demonstrate the concept of DD, we created a reference software phantom which contains two objects. The first object (1) consists of a hollow box with a fixed size core and variable wall thickness. The second object (2) consists of a solid box of fixed size and arbitrary location. 7 different variations of the fixed phantom were created. Each phantom was deformed onto every other phantom using two B-Spline DIR algorithms available in Elastix and Plastimatch. Voxels were sampled from the reference phantom [1], which were also deformed from moving phantoms [2…6], and we find the differences in their corresponding location on phantom [7]. Each voxel results in a distribution of DD values, which we call distance discordance histogram (DDH). We also demonstrate this concept in 8 Head & Neck patients. The two image registration algorithms produced two different DD results for the same phantom image set. The mean values of the DDH were slightly lower for Elastix (0-1.28 cm) as compared to the values produced by Plastimatch (0-1.43 cm). The combined DDH for the H&N patients followed a lognormal distribution with a mean of 0.45 cm and std. deviation of 0.42 cm. The proposed distance discordance (DD) metric is an easily interpretable, quantitative tool that can be used to evaluate the effect of inter-patient variability on the goodness of the registration in different parts of the patient anatomy. Therefore, it can be utilized to exclude certain images based on their DDH characteristics. In addition, this metric does not rely on 'ground truth' or the presence of contoured structures. © 2012 American Association of Physicists in Medicine.

  9. 24 CFR 200.217 - Filing of previous participation certificate on prescribed form.

    Science.gov (United States)

    2010-04-01

    ... occurrence of any of the events below: (1) With an Application for a Site Appraisal/Market Analysis Letter, Feasibility Letter, Conditional Commitment for Mortgage Insurance, or Firm Commitment for Mortgage Insurance... change ownership of a property regulated or controlled by a HUD “use agreement”; (8) With an application...

  10. Subtask 2.17 - CO2 Storage Efficiency in Deep Saline Formations

    Energy Technology Data Exchange (ETDEWEB)

    Gorecki, Charles D. [Univ. of North Dakota, Grand Forks, ND (United States); Liu, Guoxiang [Univ. of North Dakota, Grand Forks, ND (United States); Braunberger, Jason R. [Univ. of North Dakota, Grand Forks, ND (United States); Klenner, Robert C. L. [Univ. of North Dakota, Grand Forks, ND (United States); Ayash, Scott C. [Univ. of North Dakota, Grand Forks, ND (United States); Dotzenrod, Neil W. [Univ. of North Dakota, Grand Forks, ND (United States); Steadman, Edward N. [Univ. of North Dakota, Grand Forks, ND (United States); Harju, John A. [Univ. of North Dakota, Grand Forks, ND (United States)

    2014-02-01

    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO2) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO2. Geologic CO2 storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO2 emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO2 in DSFs but until now have not directly compared CO2 storage resource estimates made with volumetric methodologies to estimates made using dynamic CO2 storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO2 storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO2 storage resource potential is timedependent and it asymptotically approaches the volumetric CO2 storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  11. SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Y; Smith, M; Mistry, N [University of Maryland School of Medicine, Baltimore, MD (United States)

    2014-06-01

    Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable freebreathing small animal micro-CT imaging to fuel longitudinal studies of lung function.

  12. 77 FR 217 - Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment; Ambulatory Surgical...

    Science.gov (United States)

    2012-01-04

    ... lines was not applied correctly. We have corrected our programming logic in the OPPS data process to... made to the programming logic described in the CY 2012 OPPS/ASC final (see 76 FR 74141). The correct...

  13. 42 CFR 436.217 - Individuals receiving home and community-based services.

    Science.gov (United States)

    2010-10-01

    ... THE VIRGIN ISLANDS Options for Coverage as Categorically Needy Options for Coverage of Families and... receiving home and community-based services. The agency may provide Medicaid to any group or groups of individuals in the community who meet the following requirements: (a) The group would be eligible for Medicaid...

  14. P2-17: Individual Differences in Dynamic Criterion Shifts during Perceptual Decision Making

    Directory of Open Access Journals (Sweden)

    Issac Rhim

    2012-10-01

    Full Text Available Perceptual decision-making involves placing an optimal criterion on the axis of encoded sensory evidence to maximize outcomes for choices. Optimal criterion setting becomes critical particularly when neural representations of sensory inputs are noisy and feedbacks for perceptual choices vary over time in an unpredictable manner. Here we monitored time courses of decision criteria that are adopted by human subjects while abruptly shifting the criterion of stochastic feedback to perceptual choices with certain amounts in an unpredictable direction and at an unpredictable point of time. Subjects viewed a brief (0.3 s, thin (.07 deg annulus around the fixation and were forced to judge whether the annulus was smaller or larger than an unknown boundary. We estimated moment-to-moment criteria by fitting a cumulative Gaussian function to the data within a sliding window of trials that are locked to a shift in feedback criterion. Unpredictable shifts in feedback criterion successfully induced shifts in actual decision criterion towards an optimal criterion for many of subjects, but with time delay and amount of shifts varying across individual subjects. There were disproportionately more numbers of overshooters (reaching and then surpassing the optimal criterion required than undershooters (subpar reach, with a significant anti-correlation with sensory sensitivity. To find a mechanism that generates these individual differences, we developed a dynamic criterion learning model by modifying a reinforcement learning model, which assumes that a criterion is adjusted every trial by a weighted discrepancy between actual and expected rewards.

  15. Comparison of vaccine efficacy for different antigen delivery systems for infectious pancreatic necrosis virus vaccines in Atlantic salmon (Salmo salar L.) in a cohabitation challenge model.

    Science.gov (United States)

    Munang'andu, Hetron M; Fredriksen, Børge N; Mutoloki, Stephen; Brudeseth, Bjørn; Kuo, Tsun-Yung; Marjara, Inderjit S; Dalmo, Roy A; Evensen, Øystein

    2012-06-08

    Two strains of IPNV made by reverse genetics on the Norwegian Sp strain NVI-015 (GenBank AY379740) backbone encoding the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs were used to prepare inactivated whole virus (IWV), nanoparticle vaccines with whole virus, Escherichia coli subunit encoding truncated VP2-TA and VP2-PT, VP2-TA and VP2-PT fusion antigens with putative translocating domains of Pseudomonas aeruginosa exotoxin, and plasmid DNA encoding segment A of the TA strain. Post challenge survival percentages (PCSP) showed that IWV vaccines conferred highest protection (PCSP=42-53) while nanoparticle, sub-unit recombinant and DNA vaccines fell short of the IWV vaccines in Atlantic salmon (Salmo salar L.) postsmolts challenged with the highly virulent Sp strain NVI-015 (TA strain) of IPNV after 560 degree days post vaccination. Antibody levels induced by these vaccines did not show antigenic differences between the virulent and avirulent motifs for vaccines made with the same antigen dose and delivery system after 8 weeks post vaccination. Our findings show that fish vaccinated with less potent vaccines comprising of nanoparticle, DNA and recombinant vaccines got infected much earlier and yielded to higher infection rates than fish vaccinated with IWV vaccines that were highly potent. Ability of the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs to limit establishment of infection showed equal protection for vaccines made of the same antigen dose and delivery systems. Prevention of tissue damage linked to viral infection was eminent in the more potent vaccines than the less protective ones. Hence, there still remains the challenge of developing highly efficacious vaccines with the ability to eliminate the post challenge carrier state in IPNV vaccinology. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Thermodynamic Temperatures of the Triple Points of Mercury and Gallium and in the Interval 217 K to 303 K

    OpenAIRE

    Moldover, M. R.; Boyes, S. J.; Meyer, C. W.; Goodwin, A. R. H.

    1999-01-01

    We measured the acoustic resonance frequencies of an argon-filled spherical cavity and the microwave resonance frequencies of the same cavity when evacuated. The microwave data were used to deduce the thermal expansion of the cavity and the acoustic data were fitted to a temperature-pressure surface to deduce zero-pressure speed-of-sound ratios. The ratios determine (T?T 90), the difference between the Kelvin thermodynamic temperature T and the temperature on the International Temperature Sca...

  17. Incorporation of Operating Precepts of Roman Rhetoric in Medieval and Renaissance Handbooks on Letter Writing. Working Paper No. 217.

    Science.gov (United States)

    Hildebrandt, Herbert W.

    The ancient world, as exemplified in the theoretical writings of the Greek and Roman rhetoricians, directly influenced the teaching and practice of dictamen as taught for business, for the church, and for law in the Middle Ages and into the Renaissance. Prescriptions on how to communicate in the ancient world formed the core of preparation for the…

  18. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping...

    Science.gov (United States)

    2010-03-08

    ...) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials... Applications Numerical Requirements Guidance Materials Data Quality Wednesday, April 14 Continuation of... Planning SC-214 Requirements Review and Response Planning Thursday, April 15 Document Agreements DO-272...

  19. 30 CFR 250.217 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ... What solid and liquid wastes and discharges information and cooling water intake information must accompany the EP? The following solid and liquid wastes and discharges information and cooling water intake... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What solid and liquid wastes and discharges...

  20. Examining the "Matthew Effect" on the motivation and ability to make lifestyle changes in 217 heart rehabilitation patients.

    Science.gov (United States)

    Mildestvedt, Thomas; Meland, Eivind

    2007-01-01

    Those who are socioeconomically disadvantaged and people with emotional problems have a poorer prognosis for cardiovascular disease. The authors wanted to examine: (1) what effect household income, emotional status, high-risk smoking status, and severity of heart disease had on the ability of individuals to make dietary and exercise improvements after heart disease and (2) to what extent unfavourable lifestyle outcomes among disadvantaged people were mediated by motivational problems. A two-year follow-up study of the combined cohorts of a randomized controlled trial. Level of exercise and present dietary habits were measured at inclusion and after 6 and 24 months. Different motivational factors and emotional distress were measured during rehabilitation. Autonomous self-regulation was lowest among smokers (b = -0.31, p = 0.02) and female participants (b = 0.39, p = 0.004). Participants with high scores of emotional distress predicted lower motivation for all the measures. We found no association between socioeconomic status (household income) and the ability to perform lifestyle changes. Current smoking status predicted lower ability to obtain lifestyle changes on all measures. Emotional distress was related to lower ability to increase physical activity at 6 months' but not at 24 months' follow-up. The mediating effects of motivational factors were insignificant. The results of this study do not support the suspicion that preventive efforts accentuate the socioeconomic differences in cardiovascular health. Health-promotive efforts after heart disease should safeguard that high-risk groups such as smokers are not discouraged from improving their lifestyle in other areas.

  1. 76 FR 70531 - Tenth Meeting: RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases

    Science.gov (United States)

    2011-11-14

    .... Discussion the differences between AIXM and the Modeling Effort for Terrain and Obstacles within the... structure'' in DO-272. Determine if and how to re-write Appendix E. Review work on Temporality. ASRN V&V... to space availability. With the approval of the chairman, members of the public may present oral...

  2. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and...

    Science.gov (United States)

    2012-03-12

    ... Modeling Effort for Terrain and Obstacles within the Committee [ssquf] Decided on a method for addressing the use of the term ``obstacle'' in DO-276 and ``vertical structure'' in DO-272. [ssquf] Determine if... Meeting Adjourn Attendance is open to the interested public but limited to space availability. With the...

  3. 76 FR 6179 - Eighth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping...

    Science.gov (United States)

    2011-02-03

    ..., Spain. The contact person(s) are Maarten Uijt de Haag, Ph.D., Aerospace Research and Technology Center... Politecnica de Catalunya (UPC), Barcelona, Spain, e-mail: [email protected] . EETAC is located in...

  4. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    DEFF Research Database (Denmark)

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina

    2012-01-01

    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...

  5. 41 CFR 101-6.217 - Laws authorizing Federal financial assistance for programs to which this subpart applies.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Laws authorizing Federal... Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT..., preserving and compiling, and publishing of documentary sources significant to the history of the United...

  6. A tunable dual-wavelength pump source based on simulated polariton scattering for terahertz-wave generation

    International Nuclear Information System (INIS)

    Sun, Bo; Liu, Jinsong; Yao, Jianquan; Li, Enbang

    2013-01-01

    We propose a dual-wavelength pump source by utilizing stimulated polariton scattering in a LiNbO 3 crystal. The residual pump and the generated tunable Stokes waves can be combined to generate THz-wave generation via difference frequency generation (DFG). With a pump energy of 49 mJ, Stokes waves with a tuning range from 1067.8 to 1074 nm have been generated, and an output energy of up to 14.9 mJ at 1070 nm has been achieved with a conversion efficiency of 21.7%. A sum frequency generation experiment was carried out to demonstrate the feasibility of the proposed scheme for THz-wave DFG. (paper)

  7. Genetic and serological typing of European infectious haematopoietic necrosis virus (IHNV) isolates

    Science.gov (United States)

    Johansson, T.; Einer-Jensen, K.; Batts, W.; Ahrens, P.; Bjorkblom, C.; Kurath, G.; Bjorklund, H.; Lorenzen, N.

    2009-01-01

    Infectious haematopoietic necrosis virus (IHNV) causes the lethal disease infectious haematopoietic necrosis (IHN) in juvenile salmon and trout. The nucleocapsid (N) protein gene and partial glycoprotein (G) gene (nucleotides 457 to 1061) of the European isolates IT-217A, FR-32/87, DE-DF 13/98 11621, DE-DF 4/99-8/99, AU-9695338 and RU-FR1 were sequenced and compared with IHNV isolates from the North American genogroups U, M and L. In phylogenetic studies the N gene of the Italian, French, German and Austrian isolates clustered in the M genogroup, though in a different subgroup than the isolates from the USA. Analyses of the partial G gene of these European isolates clustered them in the M genogroup close to the root while the Russian isolate clustered in the U genogroup. The European isolates together with US-WRAC and US-Col-80 were also tested in an enzyme-linked immunosorbent assay (ELISA) using monoclonal antibodies (MAbs) against the N protein. MAbs 136-1 and 136-3 reacted equally at all concentrations with the isolates tested, indicating that these antibodies identify a common epitope. MAb 34D3 separated the M and L genogroup isolates from the U genogroup isolate. MAb 1DW14D divided the European isolates into 2 groups. MAb 1DW14D reacted more strongly with DE-DF 13/98 11621 and RU-FR1 than with IT-217A, FR- 32/87, DE-DF 4/99-8/99 and AU-9695338. In the phylogenetic studies, the Italian, French, German and Austrian isolates clustered in the M genogroup, whereas in the serological studies using MAbs, the European M genogroup isolates could not be placed in the same specific group. These results indicate that genotypic and serotypic classification do not correlate. ?? 2009 Inter-Research.

  8. Primary structure of human pancreatic protease E determined by sequence analysis of the cloned mRNA

    International Nuclear Information System (INIS)

    Shen, W.; Fletcher, T.S.; Largman, C.

    1987-01-01

    Although protease E was isolated from human pancreas over 10 years ago, its amino acid sequence and relationship to the elastases have not been established. The authors report the isolation of a cDNA clone for human pancreatic protease E and determination of the nucleic acid sequence coding for the protein. The deduced amino acid sequence contains all of the features common to serine proteases. The substrate binding region is highly homologous to those of porcine and rat elastases 1, explaining the similar specificity for alanine reported for protease E and these elastases. However, the amino acid sequence outside the substrate binding region is less than 50% conserved, and there is a striking difference in the overall net charge for protease E (6-) and elastases 1 (8+). These findings confirm that protease E is a new member of the serine protease family. They have attempted to identify amino acid residues important for the interaction between elastases and elastin by examining the amino acid sequence differences between elastases and protease E. In addition to the large number of surface charge changes which are outside the substrate binding region, there are several changes which might be crucial for elastolysis: Leu-73/Arg-73; Arg-217A/Ala-217A; Arg-65A/Gln-65A; and the presence of two new cysteine residues (Cys-98 and Cys-99B) which computer modeling studies predict could form a new disulfide bond, not previously observed for serine proteases. They also present evidence which suggests that human pancreas does not synthesize a basic, alanine-specific elastase similar to porcine elastase 1

  9. VizieR Online Data Catalog: JHK lightcurves of red giants in the SMC (Takayama+, 2015)

    Science.gov (United States)

    Takayama, M.; Wood, P. R.; Ita, Y.

    2017-11-01

    This is JHK light curves of 7 oxygen rich stars and 14 carbon stars which show the variability of prominent long secondary periods (LSPs). Those stars are cross-identified with OGLE LSP variables in the Small Magellanic Cloud (Soszynski et al. 2011, J/AcA/61/217). A long-term multiband near-IR photometric survey for variable stars in the Large and Small Magellanic Clouds has been carried out at the South African Astronomical Observatory at Sutherland (Ita et al., in preparation). The SIRIUS camera attached to the IRSF 1.4 m telescope was used for this survey and more than 10 yr of observations in the near-IR bands J(1.25 μm), H(1.63 μm) and KS(2.14 μm) band were obtained. In this work, we select the SMC stars from the SIRIUS data base. We obtained the V- and I-band time series of SMC red giants from the OGLE project (Soszynski et al. 2011, J/AcA/61/217). (2 data files).

  10. Topographic Map of Quadrangles 3770 and 3870, Maymayk (211), Jamarj-I-Bala (212), Faydz-Abad (217), and Parkhaw (218) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  11. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  12. TU-E-217BCD-06: Cone Beam Breast CT with a High Resolution Flat Panel Detector-Improvement of Calcification Visibility.

    Science.gov (United States)

    Shen, Y; Zhong, Y; Lai, C; Wang, T; Shaw, C

    2012-06-01

    To investigate the advantage of a high resolution flat panel detector for improving the visibility of microcalcifications (MCs) in cone beam breast CT Methods: A paraffin cylinder was used to simulate a 100% adipose breast. Calcium carbonate grains, ranging from 125-140 μm to 224 - 250 μm in size, were used to simulate the MCs. Groups of 25 same size MCs were embedded at the phantom center. The phantom was scanned with a bench-top CBCT system at various exposure levels. A 75μm pitch flat panel detector (Dexela 2923, Perkin Elmer) with 500μm thick CsI scintillator plate was used as the high resolution detector. A 194 μm pitch detector (Paxscan 4030CB, Varian Medical Systems) was used for reference. 300 projection images were acquired over 360° and reconstructed. The images were reviewed by 6 readers. The MC visibility was quantified as the fraction of visible MCs and averaged for comparison. The visibility was plotted as a function of the estimated dose level for various MC sizes and detectors. The MTFs and DQEs were measured and compared. For imaging small (200 μm and smaller) MCs, the visibility achieved with the 75μm pitch detector was found to be significantly higher than those achieved with the 194μm pitch detector. For imaging larger MCs, there was little advantage in using the 75μm pitch detector. Using the 75μm pitch detector, MCs as small as 180 μm could be imaged to achieve a visibility of 78% with an isocenter tissue dose of ∼20 mGys versus 62% achieved with the 194 μm pitch detector at the same dose level. It was found that a high pitch flat panel detector had the advantages of extending its imaging capability to higher frequencies thus helping improve the visibility when used to image small MCs. This work was supported in part by grants CA104759, CA13852 and CA124585 from NIH-NCI, a grant EB00117 from NIH-NIBIB, and a subcontract from NIST-ATP. © 2012 American Association of Physicists in Medicine.

  13. SU-E-J-217: Accuracy Comparison Between Surface and Volumetric Registrations for Patient Setup of Head and Neck Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Y [Stanford University School of Medicine, Stanford, CA (United States); Korea Institute of Science and Technology, Seoul (Korea, Republic of); Li, R; Na, Y; Jenkins, C; Xing, L [Stanford University School of Medicine, Stanford, CA (United States); Lee, R [Ewha Womans University, Seoul (Korea, Republic of)

    2014-06-01

    Purpose: Optical surface imaging has been applied to radiation therapy patient setup. This study aims to investigate the accuracy of the surface registration of the optical surface imaging compared with that of the conventional method of volumetric registration for patient setup in head and neck radiation therapy. Methods: Clinical datasets of planning CT and treatment Cone Beam CT (CBCT) were used to compare the surface and volumetric registrations in radiation therapy patient setup. The Iterative Closest Points based on point-plane closest method was implemented for surface registration. We employed 3D Slicer for rigid volumetric registration of planning CT and treatment CBCT. 6 parameters of registration results (3 rotations and 3 translations) were obtained by the two registration methods, and the results were compared. Digital simulation tests in ideal cases were also performed to validate each registration method. Results: Digital simulation tests showed that both of the registration methods were accurate and robust enough to compare the registration results. In experiments with the actual clinical data, the results showed considerable deviation between the surface and volumetric registrations. The average root mean squared translational error was 2.7 mm and the maximum translational error was 5.2 mm. Conclusion: The deviation between the surface and volumetric registrations was considerable. Special caution should be taken in using an optical surface imaging. To ensure the accuracy of optical surface imaging in radiation therapy patient setup, additional measures are required. This research was supported in part by the KIST institutional program (2E24551), the Industrial Strategic technology development program (10035495) funded by the Ministry of Trade, Industry and Energy (MOTIE, KOREA), and the Radiation Safety Research Programs (1305033) through the Nuclear Safety and Security Commission, and the NIH (R01EB016777)

  14. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Carleer, Michel R.; Csaszar, Attila G.; Gamache, Robert R.; Hodges, Joseph T.; Jenouvrier, Alain; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Toth, Robert A.; Vandaele, Ann Carine; Zobov, Nikolai F.; Daumont, Ludovic; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Mikhailenko, Semen N.

    2009-01-01

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H 2 17 O and H 2 18 O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H 2 17 O and H 2 18 O are 0-17125cm -1 . The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H 2 17 O, and 4839 and 29 364 for H 2 18 O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  15. 26 CFR 1.217-1 - Deduction for moving expenses paid or incurred in taxable years beginning before January 1, 1970.

    Science.gov (United States)

    2010-04-01

    ..., nor an individual such as a servant, governess, chauffeur, nurse, valet, or personal attendant. (c... reimbursed $600 by M. After working for M for a period of 3 months, A becomes dissatisfied with the job and... return will become invalid if, as of the date prescribed by law for filing the return, it is not possible...

  16. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    DEFF Research Database (Denmark)

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal

    2011-01-01

    and forms a homologous pair with cylindrite, which has thinner Q slabs. The Q slabs in franckeite are four atomic layers thick. The two components have their own lattices and a common modulation. The Q slab of the refined franckeite structure, Pb21.74Sn9.34Fe3.95Sb8.08S56.87, is an MS layer (M = Pb2+, Sn2...... layer (M = Sn4+, Fe2+) with a = 3.665(8), b = 6.2575(16), c = 17.419(5) Å, a = 95.25(2)°, ß = 95.45(2)°, ¿ = 89.97(2)°; the modulation vector is q = –0.00087(8) a* + 0.13725(16) b* – 0.0314(4) c*. The a and b vectors of both subsystems are parallel; the c vectors diverge. (3+2)D superspace refinement...... was refined as Pb0.74(Sn,Sb)0.26, whereas that of cations, which are adjacent to the interspace with lone electron pairs, with a configuration analogous to that observed in orthorhombic SnS, corresponds to (Sn,Sb)0.73Pb0.27. Iron is dispersed over the octahedral Sn4+ sites in the H layer. Transversal...

  17. Hyperspectral surface materials map of quadrangle 3770, Faizabad (217) and Parkhaw (218) quadrangles, Afghanistan, showing iron-bearing minerals and other materials

    Science.gov (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Giles, Stuart A.; Johnson, Michaela R.

    2013-01-01

    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  18. SU-E-J-217: Accuracy Comparison Between Surface and Volumetric Registrations for Patient Setup of Head and Neck Radiation Therapy

    International Nuclear Information System (INIS)

    Kim, Y; Li, R; Na, Y; Jenkins, C; Xing, L; Lee, R

    2014-01-01

    Purpose: Optical surface imaging has been applied to radiation therapy patient setup. This study aims to investigate the accuracy of the surface registration of the optical surface imaging compared with that of the conventional method of volumetric registration for patient setup in head and neck radiation therapy. Methods: Clinical datasets of planning CT and treatment Cone Beam CT (CBCT) were used to compare the surface and volumetric registrations in radiation therapy patient setup. The Iterative Closest Points based on point-plane closest method was implemented for surface registration. We employed 3D Slicer for rigid volumetric registration of planning CT and treatment CBCT. 6 parameters of registration results (3 rotations and 3 translations) were obtained by the two registration methods, and the results were compared. Digital simulation tests in ideal cases were also performed to validate each registration method. Results: Digital simulation tests showed that both of the registration methods were accurate and robust enough to compare the registration results. In experiments with the actual clinical data, the results showed considerable deviation between the surface and volumetric registrations. The average root mean squared translational error was 2.7 mm and the maximum translational error was 5.2 mm. Conclusion: The deviation between the surface and volumetric registrations was considerable. Special caution should be taken in using an optical surface imaging. To ensure the accuracy of optical surface imaging in radiation therapy patient setup, additional measures are required. This research was supported in part by the KIST institutional program (2E24551), the Industrial Strategic technology development program (10035495) funded by the Ministry of Trade, Industry and Energy (MOTIE, KOREA), and the Radiation Safety Research Programs (1305033) through the Nuclear Safety and Security Commission, and the NIH (R01EB016777)

  19. Post irradiation fatigue tests of type 316 LN stainless steel. Final report for the ITER Task T511, Subtask 1. European Technology Programme Task GB5-T217

    Energy Technology Data Exchange (ETDEWEB)

    Norring, K.; Koenig, M

    2002-01-01

    The main objective of this Subtask was to estimate the corrosion fatigue behaviour of 316L Stainless Steel (SS) and SS/SS joints, and to check among others the influence of irradiation. Joints were produced by solid Hot Isostatic Pressure (HIP) and powder HIP. Conventional material was used for comparison. The specimens were supplied by EFDA and were irradiated to 4 dpa in Dimitrovgrad (Russia). All specimens were tested at 150 deg C in hydrogenated high purity water. Testing was performed with a stepwise decrease in {delta}K keeping K{sub max} constant. The crack growth rates of irradiated as well as unirradiated specimens tested earlier are of the same magnitude, around 2x10{sup -5} mm/cycle at {delta}K= 18 MPa{radical}m. Thus, irradiation does not seem to enhance the fatigue crack growth rate, at least not up to irradiation levels of 4 dpa. But it is worth noting that the exponents in the da/dN versus {delta}K equation, also known as Paris' law, seems to fall within two areas, either around 3.5 or just below 2. Both Powder HIPed and Solid HIPed specimens are found in both groups. The reason for this is not evident. The fracture surfaces of the specimens show typical fatigue appearance.

  20. SU-F-J-217: Accurate Dose Volume Parameters Calculation for Revealing Rectum Dose-Toxicity Effect Using Deformable Registration in Cervical Cancer Brachytherapy: A Pilot Study

    Energy Technology Data Exchange (ETDEWEB)

    Zhen, X; Chen, H; Liao, Y; Zhou, L [Southern Medical University, Guangzhou, Guangdong (China); Hrycushko, B; Albuquerque, K; Gu, X [UT Southwestern Medical Center, Dallas, TX (United States)

    2016-06-15

    Purpose: To study the feasibility of employing deformable registration methods for accurate rectum dose volume parameters calculation and their potentials in revealing rectum dose-toxicity between complication and non-complication cervical cancer patients with brachytherapy treatment. Method and Materials: Data from 60 patients treated with BT including planning images, treatment plans, and follow-up clinical exam were retrospectively collected. Among them, 12 patients complained about hematochezia were further examined with colonoscopy and scored as Grade 1–3 complication (CP). Meanwhile, another 12 non-complication (NCP) patients were selected as a reference group. To seek for potential gains in rectum toxicity prediction when fractional anatomical deformations are account for, the rectum dose volume parameters D0.1/1/2cc of the selected patients were retrospectively computed by three different approaches: the simple “worstcase scenario” (WS) addition method, an intensity-based deformable image registration (DIR) algorithm-Demons, and a more accurate, recent developed local topology preserved non-rigid point matching algorithm (TOP). Statistical significance of the differences between rectum doses of the CP group and the NCP group were tested by a two-tailed t-test and results were considered to be statistically significant if p < 0.05. Results: For the D0.1cc, no statistical differences are found between the CP and NCP group in all three methods. For the D1cc, dose difference is not detected by the WS method, however, statistical differences between the two groups are observed by both Demons and TOP, and more evident in TOP. For the D2cc, the CP and NCP cases are statistically significance of the difference for all three methods but more pronounced with TOP. Conclusion: In this study, we calculated the rectum D0.1/1/2cc by simple WS addition and two DIR methods and seek for gains in rectum toxicity prediction. The results favor the claim that accurate dose deformation and summation tend to be more sensitive in unveiling the dose-toxicity relationship. This work is supported in part by grant from VARIAN MEDICAL SYSTEMS INC, the National Natural Science Foundation of China (no 81428019 and no 81301940), the Guangdong Natural Science Foundation (2015A030313302)and the 2015 Pearl River S&T Nova Program of Guangzhou (201506010096).

  1. Diagnostic value of a new myocardial perfusion agent, teboroxime (SO 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    International Nuclear Information System (INIS)

    Hendel, R.C.; McSherry, B.; Karimeddini, M.; Leppo, J.A.

    1990-01-01

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxoime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed

  2. Espécies de Anopheles no município de Pinheiro (Maranhão, área endêmica de malária Species of Anopheles in Pinheiro municipality (Maranhão, endemic area of malaria

    Directory of Open Access Journals (Sweden)

    Yrla Nívea Oliveira-Pereira

    2000-10-01

    Full Text Available A riqueza, abundância relativa, flutuação sazonal, preferência por ambiente (peri e intradomicílio e horários de hematofagismo de espécies de Anopheles foram estudados no município de Pinheiro, Maranhão. As fêmeas foram capturadas mensalmente sobre iscas humanas de maio/1998 a abril/1999, das 18 às 6 horas. Foram coletados 1.321 espécimens pertencentes a 10 espécies de Anopheles, todas do subgênero Nyssorhynchus: A. argyritarsis com 62%, A. darlingi (21,7%, A. albitarsis (4,5%, A. galvaoi (4%, A. triannulatus (3,1% e A. evansae (2,8%. As espécies A. nuneztovari, A. braziliensis, A. rondoni e A. strodei representaram juntas 1,9%. Os anofelinos ocorreram o ano todo, não havendo diferença significativa no número de exemplares capturados entre as estações chuvosa (51,7% e seca (48,3%. A freqüência dos anofelinos no peridomicílio foi significativamente maior (p The Anophelae species of the municipal district of Pinheiro, Maranhão State, Brazil, were studied, considering their variety, relative abundance, seasonal fluctuation, preference by the peri and intra domiciles as well as the hours of hematophagism. The females were captured using human bait, on a monthly basis from May/1998 to April/1999, from 6 p.m. to 6 a.m. A total of 1,321 specimens of 10 species were captured, all belonging to the subgenus Nyssorhynchus. The most frequent species were A. argyritarsis (62%, A. darlingi (21.7%, A. albitarsis (4.5%, A. galvaoi (4.0%, A. triannulatus (3.1% and A. evansae (2.8%. The species A. nuneztovari, A. braziliensis, A. rondoni and A. strodei together represented 1.9%. The anophelines occurred all year round, with no significant difference in the number of specimens captured between the rainy (51.7% and dry season (48.3%. The frequency of the females in the peridomicile was significantly higher (p < 0.01 (82%, than in the intradomicile (18%, preferring to suck blood at dusk and in the first hours of the night.

  3. Video image analysis in the Australian meat industry - precision and accuracy of predicting lean meat yield in lamb carcasses.

    Science.gov (United States)

    Hopkins, D L; Safari, E; Thompson, J M; Smith, C R

    2004-06-01

    A wide selection of lamb types of mixed sex (ewes and wethers) were slaughtered at a commercial abattoir and during this process images of 360 carcasses were obtained online using the VIAScan® system developed by Meat and Livestock Australia. Soft tissue depth at the GR site (thickness of tissue over the 12th rib 110 mm from the midline) was measured by an abattoir employee using the AUS-MEAT sheep probe (PGR). Another measure of this thickness was taken in the chiller using a GR knife (NGR). Each carcass was subsequently broken down to a range of trimmed boneless retail cuts and the lean meat yield determined. The current industry model for predicting meat yield uses hot carcass weight (HCW) and tissue depth at the GR site. A low level of accuracy and precision was found when HCW and PGR were used to predict lean meat yield (R(2)=0.19, r.s.d.=2.80%), which could be improved markedly when PGR was replaced by NGR (R(2)=0.41, r.s.d.=2.39%). If the GR measures were replaced by 8 VIAScan® measures then greater prediction accuracy could be achieved (R(2)=0.52, r.s.d.=2.17%). A similar result was achieved when the model was based on principal components (PCs) computed from the 8 VIAScan® measures (R(2)=0.52, r.s.d.=2.17%). The use of PCs also improved the stability of the model compared to a regression model based on HCW and NGR. The transportability of the models was tested by randomly dividing the data set and comparing coefficients and the level of accuracy and precision. Those models based on PCs were superior to those based on regression. It is demonstrated that with the appropriate modeling the VIAScan® system offers a workable method for predicting lean meat yield automatically.

  4. Health technology prioritization: which criteria for prioritizing new technologies and what are their relative weights?

    Science.gov (United States)

    Golan, Ofra; Hansen, Paul; Kaplan, Giora; Tal, Orna

    2011-10-01

    To review the criteria and 'other' considerations used internationally for prioritizing new health technologies, and to demonstrate a conjoint-analysis methodology (also known as discrete choice experiments) for deriving relative weights for the criteria. We searched the literature for criteria and other considerations for prioritizing new technologies. A convenience sample of 74 respondents completed a conjoint-analysis survey involving criteria related to technologies' 'benefits'. Encompassing 11 countries and the US state of Oregon, we were able to distinguish three main groups of criteria: (a) Need, appropriateness and clinical benefits; (b) Efficiency (including cost-effectiveness); and (c) Equality, solidarity and other ethical or social values. For several countries, the quality of the clinical and economic evidence and factors related to strategic issues and procedural justice respectively are also considered. The criteria and their weights from the conjoint-analysis survey are: 'Lives saved'=0.343, 'Life-prolongation benefits'=0.243, 'Quality-of-life gains'=0.217, a criterion representing the availability of alternative treatments=0.107, and 'Other important social/ethical benefits'=0.087. The criteria represent a pluralistic combination of needs-based, maximizing and egalitarian principles, and we demonstrated a methodology for deriving the weights for criteria related to technologies' 'benefits'. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  5. Powder-in-tube (PIT) Nb$_{3}$Sn conductors for high-field magnets

    CERN Document Server

    Lindenhovius, J L H; den Ouden, A; Wessel, W A J; ten Kate, H H J

    2000-01-01

    New Nb/sub 3/Sn conductors, based on the powder-in-tube (PIT) process, have been developed for application in accelerator magnets and high-field solenoids. For application in accelerator magnets, SMI has developed a binary 504 filament PIT conductor by optimizing the manufacturing process and adjustment of the conductor lay-out. It uniquely combines a non-copper current density of 2680 A/mm/sup 2/@10 T with an effective filament diameter of about 20 mu m. This binary conductor may be used in a 10 T, wide bore model separator dipole magnet for the LHC, which is being developed by a collaboration of the University of Twente and CERN. A ternary (Nb/7.5wt%Ta)/sub 3/Sn conductor containing 37 filaments is particularly suited for application in extremely high-field superconducting solenoids. This wire features a copper content of 43%, a non-copper current density of 217 A/mm/sup 2/@20 T and a B/sub c2/ of 25.6 T. The main issues and the experimental results of the development program of PIT Nb/sub 3/Sn conductors a...

  6. Experimental and analytical studies on the vibration serviceability of long-span prestressed concrete floor

    Science.gov (United States)

    Cao, Liang; Liu, Jiepeng; Li, Jiang; Zhang, Ruizhi

    2018-04-01

    An extensive experimental and theoretical research study was undertaken to study the vibration serviceability of a long-span prestressed concrete floor system to be used in the lounge of a major airport. Specifically, jumping impact tests were carried out to obtain the floor's modal parameters, followed by an analysis of the distribution of peak accelerations. Running tests were also performed to capture the acceleration responses. The prestressed concrete floor was found to have a low fundamental natural frequency (≈ 8.86 Hz) corresponding to the average modal damping ratio of ≈ 2.17%. A coefficients β rp is proposed for convenient calculation of the maximum root-mean-square acceleration for running. In the theoretical analysis, the prestressed concrete floor under running excitation is treated as a two-span continuous anisotropic rectangular plate with simply-supported edges. The calculated analytical results (natural frequencies and root-mean-square acceleration) agree well with the experimental ones. The analytical approach is thus validated.

  7. CRIMES CONTRA A DIGNIDADE SEXUAL DOS CRIMES HEDIONDOS – O ESTUPRO E O ESTUPRO DE VULNERÁVEL

    Directory of Open Access Journals (Sweden)

    Carlly Eich Alves

    2014-11-01

    Full Text Available A dignidade sexual é um bem jurídico constitucional e penal. Nele está inserida a liberdade sexual; a autodeterminação; a formação da personalidade sexual; e a escolha de com quem, quando e sob quais circunstâncias irá praticar o ato sexual. A prática deste ato sem o consentimento da pessoa configura-se crime de estupro - art.213 do CP -, qualificado quando resultar grave lesão ou morte, como também, quando praticado com vulnerável - art.217-A do CP. Vulnerável é um termo usado quando o indivíduo se encontra em estado que não possa exprimir sua vontade por determinadas circunstâncias. O Código Penal prescreve sobre alguém com enfermidade ou deficiência mental ou que por outra causa não pode oferecer resistência, como pessoas sob efeito de álcool ou drogas. E no caput do artigo os menores de 14 (quatorze anos. Apesar da lei prever esta faixa etária, doutrina e jurisprudência defendem a relativização da mesma, por legislação especial que define 12 (doze anos, abstração da realidade e severidade excessiva do Código Penal.

  8. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069501)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  9. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.

    2014-01-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D 2 16 O, D 2 17 O, and D 2 18 O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm −1 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. For D 2 16 O, D 2 17 O, and D 2 18 O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm −1 , from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D 2 O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  10. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Science.gov (United States)

    2012-01-01

    Windows. To determine differences be- tween the groups and between time points, one-way analysis of variances (ANOVAs) and paired Student ’ t-tests were...Katz, “Neuropathic pain in patients with upper-extremity nerve injury,” Physiotherapy Canada, vol. 62, no. 3, pp. 190–201, 2010. Pain Research and

  11. The crystal structure of franckeite, Pb.sub.21.7./sub.Sn.sub.9.3./sub.Fe.sub.4.0./sub.Sb.sub.8.1./sub.S.sub.56.9./sub..

    Czech Academy of Sciences Publication Activity Database

    Makovicky, E.; Petříček, Václav; Dušek, Michal; Topa, D.

    2011-01-01

    Roč. 96, 11-12 (2011), s. 1686-1702 ISSN 0003-004X Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : franckeite * Pb-Sn-Sb-Fe sulfide * modulated layer-misfit crystal structure * 2D–non-commensurate layer structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2011

  12. Toxicidad, acumulación y efectos fisiológicos del colorante premetalizado C.I. Acid Violet 66 y su base azoica C.I. Acid Red 217 en la trucha Arcoiris Salmo Gairdneri R.

    OpenAIRE

    Riva Juan, María del Carmen

    1989-01-01

    El objetivo fundamental de esta Tesis ha sido una ampliación de conocimientos sobre toxicidad y efectos de los colorantes premetalizados en la trucha arcoiris Salmogairdneri. Se ha dedicado especial atención a la toxicocinética del colorante premetalizado (acumulación y eliminación, tanto de colorante como de cromo y base azoica, en diferentes órganos y partes del cuerpo de los animales), así como a los efectos a nivel sanguíneo y en algunas características histológicas. The main objective...

  13. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  14. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  15. Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte - DOI: 10.4025/actascianimsci.v29i2.217 Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations - DOI: 10.4025/actascianimsci.v29i2.217

    Directory of Open Access Journals (Sweden)

    Jorge Vitor Ludke

    2007-11-01

    Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.

  16. Adjuvant Chemotherapy Seemed Not to Have Survival Benefit in Rectal Cancer Patients with ypTis-2N0 After Preoperative Radiotherapy and Surgery from a Population-Based Propensity Score Analysis.

    Science.gov (United States)

    Hu, Xiang; Li, Ya-Qi; Li, Qing-Guo; Ma, Yan-Lei; Peng, Jun-Jie; Cai, San-Jun

    2018-04-19

    Adjuvant chemotherapy is currently offered routinely, as standard, after radical resection for patients with rectal cancer receiving neo-adjuvant chemoradiation. However, the efficacy of adjuvant chemotherapy in patients with ypTis-2N0M0 has not been documented to the same extent, and the survival benefit remained controversial. The purpose of this work was to determine the role of chemotherapy in patients with ypTis-2N0M0 classification. Data were obtained from the Surveillance, Epidemiology, and End Results database ( n  = 4,217). A propensity score model was utilized to balance baseline covariates. Of the 4,217 included patients, 335 with ypTis-2N0M0 did not receive adjuvant chemotherapy. There were comparable cancer-specific survivals (CSS) between those undergoing adjuvant chemotherapy or not (log-rank test = 0.136, p  = .712) in the overall sample. After propensity score matching, the cancer-specific survival did not differ between the chemotherapy and observation groups (log-rank test = 0.089, p  = .765). Additionally, the Cox model did not demonstrate adjuvant chemotherapy as the prognostic factor, with hazard ratio = 0.95 (95% confidence interval 0.69-1.32) for CSS. Furthermore, the 10-year cumulative CSS was 78.7% and 79.4% between the chemotherapy and observation groups, indicating no significance, and no impact of adjuvant chemotherapy on survival was observed in different subgroups stratified by T stage, histological grade, histology, lymph nodes, and tumor size. Patients with ypTis-2N0 rectal cancer did not benefit from adjuvant chemotherapy after preoperative radiology and radical surgery in this cohort study. These results provided new insight into the routine use of adjuvant chemotherapy for patients with rectal cancer with completed neo-adjuvant radiotherapy and curative surgery. Inconsistent recommendations for patients with rectal cancer receiving neo-adjuvant chemoradiation are offered by clinical guidelines. Adjuvant

  17. Primary structure of human pancreatic elastase 2 determined by sequence analysis of the cloned mRNA

    International Nuclear Information System (INIS)

    Fletcher, T.S.; Shen, W.F.; Largman, C.

    1987-01-01

    A cDNA encoding elastase 2 has been cloned from a human pancreatic cDNA library. The cDNA contains a translation initiation site and a poly(A) recognition site and encodes a protein of 269 amino acids, including a proposed 16-residue signal peptide. The amino acid sequence of the deduced mature protein contains a 12-residue activation peptide containing a cysteine at residue 1 similar to that of chymotryspin. The proposed active enzyme contains all of the characteristic active-site amino acids, including His-57, Asp-102, and Ser-195. The S1 binding pocket is bounded by Gly-216 and Ser-226, making this pocket intermediate in size between chymotrypsins and elastase 1 or protease E, consistent with the substrate specificity of elastase 2 for long-chain aliphatic or aromatic amino acids. Computer modeling studies using the amino acid sequence of elastase 2 superimposed on the X-ray structure of porcine elastase 1 suggest that a change of Gln-192 in elastase 1 to Asn-192 in elastase 2 may account for the lower catalytic efficiency of the latter enzyme. Several basic residues appear to be near the ends of the extended binding pocket of elastases which might serve to anchor the enzyme to the elastin substrate. These studies indicate that elastases 2 and elastase 1 both contain an Arg-65A as well as a basic dipeptide at 223/224 which is not present in chymotrypsins. In addition, Arg-217A is present in humaan elastase 2 but absent in rat pancreatic protein which has been proposed to be an elastase 2 on the basis of sequence homology, but which was not isolated during screening of rat pancreatic tissue extracts for elastolytic activity

  18. High androgen levels protect against hypothyroidism.

    Science.gov (United States)

    Schmidt, Johanna; Dahlgren, Eva; Bryman, Inger; Berntorp, Kerstin; Trimpou, Penelope; Wilhelmsen, Lars; Landin-Wilhelmsen, Kerstin

    2017-01-01

    Hypothyroidism is a common disorder, appearing mainly in women although less frequently found in women with polycystic ovary syndrome (PCOS). The objective was to test the hypothesis that hyperandrogenism might protect against hypothyroidism. The data from three prospective follow-up studies (up to 21 years) and one register study were compared: women with PCOS (Rotterdam criteria), n = 25, women with Turner syndrome, n = 217, a random population sample of women, n = 315, and men, n = 95 (the WHO MONICA study). Findings were to be verified or rejected in all females, n = 553 716, from the same region. The proportion of hypothyroidism was calculated and thyroid peroxidase antibodies (TPO) in serum were measured. Hypothyroidism at >50 years of age was found in 8% of women with PCOS, 4% in men (PCOS vs. men; ns), 43% of women with Turner syndrome, irrespective of karyotype (p Hypothyroidism increased with age in all groups except PCOS women and men. In the register study, hypothyroidism was less common in women with PCOS >25 years (5.5%) than in women without PCOS (6.8%) from the same region (p Hypothyroidism was less frequently seen in women with PCOS and in men compared with women in the general population and among women with Turner syndrome. This was not explained by altered autoimmunity or the Y-chromosome. Androgens seem to protect against hypothyroidism. © 2016 The Authors. Acta Obstetricia et Gynecologica Scandinavica published by John Wiley & Sons Ltd on behalf of Nordic Federation of Societies of Obstetrics and Gynecology.

  19. Brucella serology in abattoir workers

    International Nuclear Information System (INIS)

    Mukhtar, F.; Kokab, F.

    2008-01-01

    Brucellosis is an occupational hazard with those particularly at risk either living in close proximity with animals or handling them. It is a public health problem in developing countries with adverse health implications both for animals and human beings as well as economic implications for individuals and communities. The Objectives were to estimate the seroprevalence of brucellosis among abattoir workers of Lahore District and to determine the association of brucellosis with nature of job of the workers. Data was collected in April 2008. It was a cross-sectional study in which four main slaughterhouses in Lahore were included. The slaughterhouse workers were divided into seven strata based on their nature of job: meat sellers, slaughterers, animal keepers, drivers, cleaners, loaders and vets/paravets. A total of 360 such workers were selected using stratified random sampling technique. Sampling frames for different strata were prepared and from each frame, proportionate numbers, were selected through simple random method using random number tables. Data was obtained using a questionnaire. Additionally blood samples were collected and analyzed for anti-Brucella Immunoglobulin G (IgG) using enzyme-linked immunosorbent assay (ELISA) technique. The seroprevalence of anti-Brucella IgG was found to be 21.7%. A statistically significant difference was observed between the immune status of the respondents and their nature of job (p=0.005), age groups (p=0.013), and duration of job (p=0.003). The disease is an important public health problem in Pakistan. The disease can be prevented in the slaughterhouse workers through the use of personal protective devices. Public health authorities should educate the general public regarding prevention of the disease with specific emphasis on people working in slaughterhouses. (author)

  20. Efeito de diferentes temperaturas na germinação de sementes e no crescimento inicial de plântulas de Miconia albicans (Melastomataceae

    Directory of Open Access Journals (Sweden)

    A.K.M. Oliveira

    2014-01-01

    Full Text Available Miconia albicans (Sw. Triana é uma espécie nativa do Brasil utilizada na medicina tradicional em comunidades rurais. O objetivo deste estudo foi investigar a temperatura mais adequada para a germinação de sementes e formação de plântulas de M. albicans. Para avaliar o efeito da temperatura sobre a germinação da espécie foram utilizadas 1200 sementes postas a germinar sob temperaturas constantes de 20, 25, 30 e 35 ºC e nas temperaturas alternadas de 20-30 e 25-35 ºC. Foram avaliados a percentagem de germinação (PG, o índice de velocidade de germinação (IVG, o tempo médio de germinação (TMG, e o comprimento das raízes primárias e do caule das plântulas. Os resultados encontrados indicaram PG acima de 63% paras as sementes sob temperaturas de 20, 25, 30 e 20-30 ºC. Para o IVG, foram observados valores entre 2,17 a 2,93 para as sementes sob temperaturas de 20, 25, 30 e 20-30 ºC, indicando maior vigor; em relação ao TMG, a maioria dos tratamentos alcançou resultado acima de 15 dias, indicando que as sementes germinaram lentamente. Levando-se em consideração todos os parâmetros avaliados, a temperatura de 25 ºC propiciou o melhor desempenho para as sementes da espécie.

  1. Espectro de gotas de pulverização e controle da ferrugem-asiática-da-soja em cultivares com diferentes arquiteturas de planta

    Directory of Open Access Journals (Sweden)

    Mônica Paula Debortoli

    2012-07-01

    Full Text Available O objetivo deste trabalho foi determinar o espectro de gotas de pulverização ideal para o controle da ferrugem-asiática-da-soja (Phakopsora pachyrhizi, em cultivares com diferentes arquiteturas de planta. O experimento foi conduzido na safra de 2009/2010. A aplicação de fungicida (piraclostrobina + epoxiconazol, com óleo mineral foi avaliada com quatro espectros de gotas de pulverização - muito fino, <119 μm; fino, 119 a 216 μm; médio, 217 a 352 μm; e grosso, 353 a 464 μm -, em quatro cultivares de soja (BMX Apollo RR, NA 7636 RR, Fcep 53 RR e TMG 4001 RR contrastantes quanto a índice de área foliar, estatura de plantas e número de ramos por planta. Foram quantificadas as variáveis: número de gotas por cm², diâmetro mediano volumétrico das gotas, área abaixo da curva de progresso da ferrugem-asiática e produtividade da soja. A definição do espectro de gotas a ser utilizado deve considerar a cultivar e as condições ambientais em que a pulverização será realizada. A magnitude da proteção exercida pelo fungicida varia de acordo com a cobertura de plantas e a penetração de gotas no dossel, proporcionada pelos diferentes espectros de gota. O espectro de gotas fino proporciona boa deposição de gotas, controle da doença e produtividade, independentemente da cultivar avaliada.

  2. Comportamiento reproductivo de un hato Angus en el Bajío mexicano

    Directory of Open Access Journals (Sweden)

    S. P. Castillo

    2012-01-01

    Full Text Available El objetivo del presente estudio fue evaluar algunos factores ambientales sobre el comportamiento reproductivo de un hato Angus, bajo condiciones de pastoreo en el Bajío Mexicano. Se utilizaron los registros de una explotación de pie de cría del municipio de León, Guanajuato. La región presenta clima templado subhúmedo con lluvias en verano; los animales pastoreaban en agostaderos de pastizal mediano abierto y pastizal amacollado. La reproducción es a través de periodos de empadre definidos; uno, de mayo a julio, y otro de diciembre a enero, y los destetes son a la edad de siete meses, aproximadamente. Los datos fueron analizados usando el método de mínimos cuadrados para determinar el efecto de año de parto (1991-2007, época de parto (frío: diciembre- marzo; sequía: abril-junio y lluvias: julionoviembre, y número de parto de la vaca (1, 2,...¿9, sobre las variables de edad al primer parto (epp e intervalo entre partos (iep. Las medias y sus desvíos típicos para epp e iep fueron 793.5 ± 165.8 días (2.17 años y 407.5 ± 83.5 días (13.47 meses, respectivamente. El año de parto, la época de parto y el número de parto de la vaca afectaron (P < 0.01 el iep. De los resultados obtenidos en el presente estudio se concluye que el año, la época y el número de parto son importantes en el comportamiento reproductivo del ganado Angus bajo condiciones de pastoreo.

  3. Defining the Intrinsic Cardiac Risks of Operations to Improve Preoperative Cardiac Risk Assessments.

    Science.gov (United States)

    Liu, Jason B; Liu, Yaoming; Cohen, Mark E; Ko, Clifford Y; Sweitzer, Bobbie J

    2018-02-01

    Current preoperative cardiac risk stratification practices group operations into broad categories, which might inadequately consider the intrinsic cardiac risks of individual operations. We sought to define the intrinsic cardiac risks of individual operations and to demonstrate how grouping operations might lead to imprecise estimates of perioperative cardiac risk. Elective operations (based on Common Procedural Terminology codes) performed from January 1, 2010 to December 31, 2015 at hospitals participating in the American College of Surgeons National Surgical Quality Improvement Program were studied. A composite measure of perioperative adverse cardiac events was defined as either cardiac arrest requiring cardiopulmonary resuscitation or acute myocardial infarction. Operations' intrinsic cardiac risks were derived from mixed-effects models while controlling for patient mix. Resultant risks were sorted into low-, intermediate-, and high-risk categories, and the most commonly performed operations within each category were identified. Intrinsic operative risks were also examined using a representative grouping of operations to portray within-group variation. Sixty-six low, 30 intermediate, and 106 high intrinsic cardiac risk operations were identified. Excisional breast biopsy had the lowest intrinsic cardiac risk (overall rate, 0.01%; odds ratio, 0.11; 95% CI, 0.02 to 0.25) relative to the average, whereas aorto-bifemoral bypass grafting had the highest (overall rate, 4.1%; odds ratio, 6.61; 95% CI, 5.54 to 7.90). There was wide variation in the intrinsic cardiac risks of operations within the representative grouping (median odds ratio, 1.40; interquartile range, 0.88 to 2.17). A continuum of intrinsic cardiac risk exists among operations. Grouping operations into broad categories inadequately accounts for the intrinsic cardiac risk of individual operations.

  4. Structural basis for new pattern of conserved amino acid residues related to chitin-binding in the antifungal peptide from the coconut rhinoceros beetle Oryctes rhinoceros.

    Science.gov (United States)

    Hemmi, Hikaru; Ishibashi, Jun; Tomie, Tetsuya; Yamakawa, Minoru

    2003-06-20

    Scarabaecin isolated from hemolymph of the coconut rhinoceros beetle Oryctes rhinoceros is a 36-residue polypeptide that has antifungal activity. The solution structure of scarabaecin has been determined from twodimensional 1H NMR spectroscopic data and hybrid distance geometry-simulated annealing protocol calculation. Based on 492 interproton and 10 hydrogen-bonding distance restraints and 36 dihedral angle restraints, we obtained 20 structures. The average backbone root-mean-square deviation for residues 4-35 is 0.728 +/- 0.217 A from the mean structure. The solution structure consists of a two-stranded antiparallel beta-sheet connected by a type-I beta-turn after a short helical turn. All secondary structures and a conserved disulfide bond are located in the C-terminal half of the peptide, residues 18-36. Overall folding is stabilized by a combination of a disulfide bond, seven hydrogen bonds, and numerous hydrophobic interactions. The structural motif of the C-terminal half shares a significant tertiary structural similarity with chitin-binding domains of plant and invertebrate chitin-binding proteins, even though scarabaecin has no overall sequence similarity to other peptide/polypeptides including chitin-binding proteins. The length of its primary structure, the number of disulfide bonds, and the pattern of conserved functional residues binding to chitin in scarabaecin differ from those of chitin-binding proteins in other invertebrates and plants, suggesting that scarabaecin does not share a common ancestor with them. These results are thought to provide further strong experimental evidence to the hypothesis that chitin-binding proteins of invertebrates and plants are correlated by a convergent evolution process.

  5. Desenvolvimento biométrico de mudas de eucalipto sob diferentes lâminas de irrigação na fase de crescimento

    Directory of Open Access Journals (Sweden)

    Carla Raphaela Araújo Silva

    2015-12-01

    Full Text Available Este estudo teve como objetivo a avaliação do desenvolvimento de mudas de eucalipto sob distintas lâminas de irrigação na etapa de crescimento.  Híbridos de Eucalyptus urograndis (clone A e Eucalyptus uroglobulos (clone B foram submetidas às lâminas de 5, 9, 11, 14 e 15 mm. Foram mensuradas a altura, diâmetro do colo, biomassa fresca, biomassa seca e calculado o IQD. Do início ao fim do experimento, a altura das mudas variou de 17,75 a 30,27 cm e de 12,03 a 26,70 cm; o diâmetro do colo de 2,17 a 4,38 mm e de 1,88 a 3,13 mm; a biomassa fresca de 2,60 a 7,86 g muda-1 e 1,66 a 8,04 g muda-1; a biomassa seca de 0,89 a 2,45 g muda-1 e 0,42 a 1,97 g muda-1; e o IQD de 0,06 a 0,238 e 0,04 a 0,189, para os clones A e B, respectivamente. Para o clone A, a lâmina de 11 mm é a melhor a ser adotada para a fase de crescimento, pois permite o desenvolvimento de mudas de boa qualidade. Para o clone B a melhor lâmina foi a de 15 mm. O clone A apresentou desenvolvimento superior quando comparado ao clone B.

  6. Hipertensão arterial na Ilha do Governador, Brasil: II. Prevalência

    Directory of Open Access Journals (Sweden)

    Klein Carlos Henrique

    1995-01-01

    Full Text Available Este segundo artigo (de uma série de dois tem como finalidade apresentar apenas os resultados básicos de um estudo, em amostra representativa de população, sobre Hipertensão Arterial na Ilha do Governador (região administrativa do município do Rio de Janeiro, em três estratos de acordo com a renda média domiciliar (baixa, média e alta de setores censitários. No conjunto da Ilha do Governador a prevalência de hipertensão não controlada foi de 16,1 % (I.C. de 95%: 13,4 a 18,9%, e incluindo-se os hipertensos controlados, este índice subiu para 24,9% (I.C. de 95%: 21,7 a 28,1 %. Por ambos os critérios (incluindo ou não os hipertensos controlados, as prevalências mais elevadas foram as do estrato de renda baixa e as menores do estrato de renda alta. Porém, só foi possível rejeitar a homogeneidade de prevalências de hipertensão (incluindo os controlados entre os estratos, e ainda assim para uma significância de 10%, quando se ajustou o efeito de confusão da idade. As mulheres hipertensas parecem controlar em maior proporção seus níveis de pressão arterial em qualquer faixa etária dos adultos, do que os homens.

  7. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GDFFGPMTVVAVYVDAKQIPLLKELGVKDSKNLNDEQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQF...DELSKKAGMPLPKGAGKQV 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV 180 ...

  8. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FFGPMTVVAVYVDAKQIPLLKELGVKDSKNLNDDQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDE...LSKKAGMPLPKGAGKQV 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV 180 ...

  9. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IPLLKELGVKDSKNLNDEQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQ...V 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQV 180 ...

  10. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD 217 ... PDG...LRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD Sbjct: 1 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHIS

  11. NCBI nr-aa BLAST: CBRC-PABE-26-1117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-26-1117 ref|ZP_01033920.1| hypothetical protein ROS217_18782 [Roseovarius... sp. 217] gb|EAQ26601.1| hypothetical protein ROS217_18782 [Roseovarius sp. 217] ZP_01033920.1 2.5 28% ...

  12. Escalas de exploração vocacional (EEV para universitários Escalas de exploración vocacional (EEV para universitarios Vocational exploration scales (VES for university students

    Directory of Open Access Journals (Sweden)

    Marco Antônio Pereira Teixeira

    2007-04-01

    Full Text Available O comportamento exploratório tem sido descrito na literatura como um aspecto fundamental do desenvolvimento de uma carreira ao longo do ciclo vital. O objetivo deste estudo foi criar um instrumento para avaliar as duas dimensões principais do comportamento exploratório vocacional (exploração de si mesmo e exploração do ambiente em universitários. O instrumento foi aplicado a 384 universitários com idade média de 21,7 anos, dos quais 65% eram mulheres. Análises dos componentes principais permitiram identificar as duas dimensões postuladas, demonstrando validade do construto. Os índices de consistência interna observados (0,85 e 0,89 também foram satisfatórios. Não houve diferenças de sexo para exploração de si e do ambiente. Estudantes em fim de curso apresentaram níveis mais elevados de exploração do ambiente do que os de início de curso. Embora ainda sejam necessários estudos complementares, os resultados desta pesquisa indicam que este instrumento construído apresenta evidências iniciais de validade e fidedignidade.El comportamiento exploratorio ha sido descrito en la literatura como un aspecto fundamental del desarrollo de una carrera a lo largo del ciclo vital. El objetivo de este estudio fue el de crear un instrumento para evaluar las dos dimensiones principales del comportamiento exploratorio vocacional (exploración de sí mismo y exploración del ambiente en universitarios. El instrumento fue aplicado a 384 universitarios con edad media de 21,7 años, de los cuales el 65% eran mujeres. Análisis de los componentes principales permitieron identificar las dos dimensiones postuladas, demostrando validad del constructo. Los índices de consistencia interna observados (0,85 y 0,89 también fueron satisfactorios. No hubo diferencias de género para exploración de sí y del ambiente. Estudiantes concluyentes de curso presentaron niveles más elevados de exploración del ambiente si comparados a los que estaban a

  13. 75 FR 32418 - Notice of Intent To Grant Partially Exclusive License of the United States Patent Application No...

    Science.gov (United States)

    2010-06-08

    ...-1076. FOR FURTHER INFORMATION CONTACT: Ms. Bea Shahin (217) 373-7234, FAX (217) 373-7210, e-mail: Bea.S... applications to achieve increased soil strength, reduced air transport, and decreased soil erosion. During...

  14. 75 FR 9103 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; NOX

    Science.gov (United States)

    2010-03-01

    ... recommend that you telephone John Summerhays, Environmental Scientist, at (312) 886-6067, before visiting... 35 IAC 217 Subpart W. Illinois' revision would add 35 IAC 217.751, the full text of which is: The...

  15. Spatial variability in the density, distribution and vectorial capacity of anopheline species in a high transmission village (Equatorial Guinea

    Directory of Open Access Journals (Sweden)

    Buatiche Jesús N

    2006-03-01

    Full Text Available Abstract Background Malaria transmission varies from one country to another and there are also local differences in time and space. An important variable when explaining the variability in transmission is the breeding behaviour of the different vector species and the availability of breeding sites. The aim of this study was to determine the geographical variability of certain entomological parameters: human biting rate (HBR, sporozoitic index (SI for Plasmodium falciparum and entomological inoculation rate (EIR. Methods The study was carried out in a small village in the mainland region of Equatorial Guinea. Adult mosquitoes were collected by CDC light traps. Polymerase Chain Reaction was employed to identify the species within the Anopheles gambiae complex and to detect P. falciparum sporozoites. The geographical position of all the dwellings in the village were taken using a global positioning system receiver unit. Data relating to the dwelling, occupants, use of bednets and the mosquitoes collection data were used to generate a geographical information system (GIS. This GIS allowed the minimum distance of the dwellings to the closest water point (potential breeding sites to be determined. Results A total of 1,173 anophelines were caught: 279 A. gambiae s.l. (217 A. gambiae s.s. and one Anopheles melas, 777 Anopheles moucheti and 117 Anopheles carnevalei. A. moucheti proved to be the main vector species and was responsible for 52.38 [95% IC: 33.7–71] night infective bites during this period. The highest SI was found in A. carnevalei (24%, even though the HBR was the lowest for this species. A significant association was found between the distance from the dwellings to the closest water point (River Ntem or secondary streams and the total HBR. Conclusion A clear association has been observed between the distance to potential breeding sites and the variability in the anopheline density, while the other parameters measured do not seem to

  16. Affect of Presenilin Mutations on APP Cleavage; Insights into the Pathogenesis of FAD

    Directory of Open Access Journals (Sweden)

    Nuomin eLi

    2016-03-01

    Full Text Available Alzheimer disease (AD is characterized by progressive memory loss, reduction in cognitive functions, and damage to the brain. The β-amyloid precursor protein can be sequentially cleaved by β- secretase and γ-secretase. Mutations in the presenilin1(PS1) are the most common cause of Familial Alzheimer’s disease ( FAD. PS1 mutations can alter the activity of γ-secretase on the cleavage of the β-amyloid precursor protein, causing increased Aβ production. Previous studies show that the βAPP-C-terminal fragment is first cleaved by β-scretase, primarily generating long fragments of Aβ48 and Aβ49, followed by the stepwise cleavage of every three amino acid residues at the C terminus, resulting in Aβ48-, 45-, 42 line and Aβ49-, 46-, 43-, 40 line. Here, we used LC-MS/MS to analyze unique peptides IAT, VVIA, ITL,TVI,IVI through sequential cleavage, combined with ELISA to test the level of Aβ42 and Aβ40 for validation. The results show that most FAD mutant PS1 can alter the level of Aβ42 and Aβ40 monitored by the Aβ42/Aβ40 ratio. Among them, 6 mutants (I143T, H163P, S170F, Q223R, M233V and G384A affect the Aβ42/40 ratio through both Aβ49-40 and Aβ48-38 lines; L166P through decreasing the Aβ49-40 line, 6 mutants (I143V, M146V, G217A, E280A, L381V and L392V through increasing the Aβ48-42 line. More importantly, we found some mutations can affect the γ-secretase cleavage preference of α-CTF and β-CTF. In conclusion, we found that the FAD PS1 mutations mainly increase the generation of Aβ42 by decreasing the cleavage of Aβ42-Aβ38 and Aβ43-Aβ40.

  17. Cluster analysis on summer precipitation field over Qinghai-Tibet Plateau from 1961 to 2004%1961-2004年青藏高原夏季降水的时空分布

    Institute of Scientific and Technical Information of China (English)

    卢鹤立; 邵全琴; 刘纪远; 王军邦; 陈沈斌; 陈卓奇

    2008-01-01

    The summer day-by-day precipitation data of 97 meteorological stations on the Qinghai-Tibet Plateau from 1961 to 2004 were selected to analyze the temporal-spatial dis- tribution through accumulated variance, correlation analysis, regression analysis, empirical orthogonal function, power spectrum function and spatial analysis tools of GIS. The result showed that summer precipitation occupied a relatively high proportion in the area with less annual precipitation on the Plateau and the correlation between summer precipitation and annual precipitation was strong. The altitude of these stations and summer precipitation ten- dency presented stronger positive correlation below 2000 m, with correlation value up to 0.604 (a=0.01). The subtracting tendency values between 1961-1983 and 1984-2004 at five altitude ranges (2000-2500 m, 2500-3000 m, 3500-4000 m, 4000-4500 m and above 4500 m) were above zero and accounted for 71.4% of the total. Using empirical orthogonal function, summer precipitation could be roughly divided into three precipitation pattern fields: the Southeast Plateau Pattern Field, the Northeast Plateau Pattern field and the Three Rivers' Headstream Regions Pattern Field. The former two ones had a reverse value from the north to the south and opposite line was along 35°N. The potential cycles of the three pattern fields were 5.33a, 21.33a and 2.17a respectively, tested by the confidence probability of 90%. The station altitudes and summer precipitation potential cycles presented strong negative corre- lation in the stations above 4500 m, with correlation value of -0.626 (a=0.01). In Three Rivers Headstream Regions summer precipitation cycle decreased as the altitude rose in the sta- tions above 3500 m and increased as the altitude rose in those below 3500 m. The empirical orthogonal function analysis in June precipitation, July precipitation and August precipitation showed that the June precipitation pattern field was similar to the July's, in which

  18. Inclusion of persons with disabilities in systems of social protection: a population-based survey and case–control study in Peru

    Science.gov (United States)

    Bernabe-Ortiz, Antonio; Diez-Canseco, Francisco; Vasquez, Alberto; Kuper, Hannah; Walsham, Matthew; Blanchet, Karl

    2016-01-01

    Objective This study aims to assess the needs of people with disabilities and their level of inclusion in social protection programmes. Design Population based-survey with a nested case–control study. Setting Morropon, a semiurban district located in Piura, northern Peru. Participants For the population survey, a two-stage sampling method was undertaken using data from the most updated census available and information of each household member aged ≥5 years was collected. In the nested case–control study, only one participant, case or control, per household was included in the study. Primary and secondary outcome measures Disability was screened using the Washington Group short questionnaire. A case, defined as an individual aged ≥5 years with disabilities, was matched with one control without disabilities by sex and age (±5 years). Information was collected on socioeconomic status, education, health and rehabilitation and social protection participation. Results The survey included 3684 participants, 1848 (50.1%) females, mean age: 36.4 (SD: 21.7). A total of 290 participants (7.9%; 95% CI 7.0% to 8.7%) were classified as having disability. Adults with disabilities were more likely to be single (OR=3.40; 95% CI 1.54 to 7.51) and not to be working (OR=4.36; 95% CI 2.26 to 8.40), while those who did work were less likely to receive the national minimum wage (ie, 750 PEN or about US$265; p=0.007). People with disabilities were more likely to experience health problems. There was no difference between those enrolled in any social protection programme among participants with and without disabilities. Conclusions People with disabilities were found to have higher needs for social protection, but were not more likely to be enrolled in social protection programmes. The Peruvian social protection system should consider adding disability status to selection criteria in their cash transfer programmes as well as implementing disability-specific interventions

  19. Recuperación de la biomasa mediante la sucesión secundaria, Cordillera Central de los Andes, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Ignacio del Valle

    2011-09-01

    Full Text Available En bosques secundarios premontanos tropicales es escasa la información sobre el tiempo requerido para recuperar la biomasa aérea y subterránea de los primarios. Por lo tanto, establecimos 33 parcelas de 0.1ha entre 550 y 1 700m en bosques secundarios que cubrían estadios serales de 3 a 36 años y estimamos la biomasa de las plantas y de las raíces gruesas con ecuaciones locales. Así como la biomasa de las pasturas y barbechos por cosecha de 54 y 18 parcelas, respectivamente. También se calculó la edad de las parcelas con informantes locales, sensores remotos, C14 y anillos de crecimiento. En cada parcela medimos la biomasa aérea viva por hectárea (Bav y la de las raíces gruesas por hectárea (Brg. Modelamos la Bav y Brg en función de la edad mediante la ecuación de von Bertalanfy con asíntotas de 247t/ha (Bav y 66t/ha (Brg resultantes de la medición de 33 parcelas de 0.1ha en los bosques primarios. Con la razón Brg/Bav=f(t estimamos 87 años para que los bosques secundarios recuperen la Bav existente en los primarios y 217 años para recuperar la Brg. La tasa máxima de crecimiento instantáneo de la Bav fue 6.95t/ha/año a los 10 años y la tasa media máxima de crecimiento 6.26t/ha/año a los 17 años. La media ponderada de la tasa de crecimiento absoluto de la Bav alcanzó 4.57t/ha/año y la relativa 10% anual. La razón Brg/Bav inicialmente aumenta muy aceleradamente hasta 4-5 años (25%, luego disminuye hasta 25 años (18% para luego incrementar hasta 26.7

  20. Inclusion of persons with disabilities in systems of social protection: a population-based survey and case-control study in Peru.

    Science.gov (United States)

    Bernabe-Ortiz, Antonio; Diez-Canseco, Francisco; Vasquez, Alberto; Kuper, Hannah; Walsham, Matthew; Blanchet, Karl

    2016-08-26

    This study aims to assess the needs of people with disabilities and their level of inclusion in social protection programmes. Population based-survey with a nested case-control study. Morropon, a semiurban district located in Piura, northern Peru. For the population survey, a two-stage sampling method was undertaken using data from the most updated census available and information of each household member aged ≥5 years was collected. In the nested case-control study, only one participant, case or control, per household was included in the study. Disability was screened using the Washington Group short questionnaire. A case, defined as an individual aged ≥5 years with disabilities, was matched with one control without disabilities by sex and age (±5 years). Information was collected on socioeconomic status, education, health and rehabilitation and social protection participation. The survey included 3684 participants, 1848 (50.1%) females, mean age: 36.4 (SD: 21.7). A total of 290 participants (7.9%; 95% CI 7.0% to 8.7%) were classified as having disability. Adults with disabilities were more likely to be single (OR=3.40; 95% CI 1.54 to 7.51) and not to be working (OR=4.36; 95% CI 2.26 to 8.40), while those who did work were less likely to receive the national minimum wage (ie, 750 PEN or about US$265; p=0.007). People with disabilities were more likely to experience health problems. There was no difference between those enrolled in any social protection programme among participants with and without disabilities. People with disabilities were found to have higher needs for social protection, but were not more likely to be enrolled in social protection programmes. The Peruvian social protection system should consider adding disability status to selection criteria in their cash transfer programmes as well as implementing disability-specific interventions. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a

  1. In children allergic to ragweed pollen, nasal inflammation is not influenced by monosensitization or polysensitization

    Directory of Open Access Journals (Sweden)

    Gelardi M

    2016-04-01

    Full Text Available Matteo Gelardi,1 Mariangela Bosoni,2 Marco Morelli,2 Silvia Beretta,2 Cristoforo Incorvaia,3 Serena Buttafava,4 Massimo Landi,5 Simonetta Masieri,6 Franco Frati,4 Nicola Quaranta,1 Gian Vincenzo Zuccotti21Otolaryngology Section, Department of Neuroscience and Sensory Organs, University of Bari, 2Department of Pediatrics, Luigi Sacco Hospital, University of Milan, 3Allergy/Pulmonary Rehabilitation Unit, ICP Hospital, 4Medical and Scientific Department, Stallergenes Italy, Milan, 5Department of Pediatrics, ASL TO1, Turin, 6Department of Otorhinolaryngology, Sapienza University of Rome, Rome, ItalyBackground: In patients polysensitized to pollen allergens, the priming effect, by which the sensitivity of the nasal mucosa to an allergen is increased by the previous exposure to another allergen, is a known phenomenon. This study was aimed at evaluating the degree of nasal inflammation, assessed by nasal cytology, in children with allergic rhinitis (AR from ragweed pollen according to being monosensitized or polysensitized.Methods: The study included 47 children. Of them, 24 suffered from AR caused by sensitization to grass pollen and ragweed pollen (group A and 23 were sensitized only to ragweed pollen (group B. In all patients, the severity of AR was assessed according to the Allergic Rhinitis and Its Impact on Asthma guidelines, and comorbidities were also evaluated.Results: In group A, 16.7% of children had a mild intermittent AR, 4.2% a moderate-to-severe intermittent, 33.3% a mild persistent, and 45.8% a moderate-to-severe persistent; in group B, 26.1% of children had a mild intermittent AR, 0% a moderate-to-severe intermittent, 52.2% a mild persistent, and 21.7% a moderate-to-severe persistent. No significant difference was detected in the number of the considered comorbidities between the two groups. The cell counts of neutrophils, eosinophils, lymphocytes/plasma cells, and mast cells were high but not significantly different in the two groups

  2. Gclust Server: 173731 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 173731 TET_217.m00049 Cluster Sequences - 82 hypothetical protein chr_0_8254489_217...; no annotation 1 1.00e-40 0.0 11.11 0.0 0.0 0.0 0.0 Show 173731 Cluster ID 173731 Sequence ID TET_217.m0004

  3. Extraction optimization of soluble compounds of yerba maté

    Directory of Open Access Journals (Sweden)

    César Sambiassi

    2002-06-01

    Full Text Available The objective of this research was the extraction optimization of water soluble compounds of yerba maté. Measures variables were extract concentration and weight of leaves and twigs. Controlled variables were time and temperature of extraction and water/solid relation. A surface response method of three variables was used as experimental design, with 20 experiences in each case. The range of each variable, defined in the experimental design, was: extraction time, 13.2 to 46.8 minutes; temperature, 48.2 to 81.8°C and water solid relation, 4.64 to 11.36 g water/100 g of dry solid. Extract weight varied from 13.14 to 29.56 g in leaves and 8.98 to 16.32 g in twigs (each one per 100 g of dry solid. Extract concentration varied between 2.17 and 3.43 g/100 ml in leaves and between 1.32 and 2.31 g/100 ml in twigs. The results were fit to a linear equation in each case.O objetivo desta pesquisa foi a otimização da extração aquosa da erva mate. As variáveis medidas foram a concentração do extrato e a massa das folhas e ramos. As variáveis controladas foram: o tempo e a temperatura de extração e a relação água/sólido. Como desenho experimental foi utilizado o método de resposta superficial de três variáveis, com vinte experiências em cada caso. A faixa de variação definida para as variáveis no desenho experimental foram: tempo de extração, de 13,2 a 46,8 minutos; temperatura, de 48,2 a 81,8 °C; relação água/sólido, de 4,64 a 11,36 gramas de água por gramas de sólido seco. A massa do extrato variou de 13,14 a 29,56 gramas para as folhas desramificadas e de 8,98 a 16,32 para os ramos (cada por 100 gramas de sólido seco. A concentração de extrato variou entre 2,17 a 3,43 g/ 100 ml nas folhas e entre 1,32 e 2,31 g/ 100 ml nos ramos. Os resultados foram, em ambos casos, ajustados para uma equação linear.

  4. Superação de dormência em sementes de Gleditschia amorphoides Taub. Overcoming of seed dormancy in Gleditschia amorphoides Taub.

    Directory of Open Access Journals (Sweden)

    Michele Fernanda Bortolini

    2011-05-01

    Full Text Available O trabalho teve como objetivo avaliar métodos para a superação da dormência de sementes de sucará. As sementes receberam os seguintes tratamentos: 1 testemunha; 2 escarificação mecânica; 3 escarificação mecânica + água/24h; 4 escarificação mecânica + água quente/24h; 5 água quente/24h; 6 ácido sulfúrico (H2SO4/1h; 7 H2SO4/2h; 8 H2SO4/1h + água/24h; 9 H2SO4/30min + água corrente/4h; 10 escarificação mecânica + água corrente/4h. O teste de germinação foi conduzido em rolos de papel Germitest acondicionados em câmara de germinação, à 25°C, com fotoperíodo de 12h por 26 dias. Avaliou-se também o tempo e a velocidade média de germinação. O delineamento experimental foi inteiramente casualizado, com quatro repetições de 25 sementes. O melhor desempenho germinativo foi registrado para as sementes submetidas à escarificação mecânica e química, com médias entre 76 e 98% de germinação, respectivamente, 2,17 a 2,88 dias para tempo médio de germinação e 0,46 a 0,47 sementes/dia para velocidade média de germinação, demonstrando serem estes os melhores métodos para superação da dormência de sementes dessa espécie.The objective of this research was to evaluate methods to overcome dormancy of seeds of Gleditschia amorphoides. For dormancy's overcoming the seeds received the following treatments: 1 control; 2 mechanical scarfication 3 mechanical scarfication + water/24h; 4 mechanical scarfication + hot water/24h; 5 hot water/24h; 6 sulfuric acid (H2SO4/1h; 7 H2SO4/2h; 8 H2SO4/1h + water/24h; 9 H2SO4/30min + flowing water/4h; 10 mechanical scarfication + flowing water/4h. Germination was done in rolls of Germitest conditioned in a germination chamber under 25°C, during 12h for 26 days. Percentage, time and average speed of germination were evaluated. The experimental design was completely casual with 10 treatments, 4 repetitions and 25 seeds. The best results were recorded for treatments with mechanical

  5. Hipertensão arterial na Ilha do Governador, Brasil: II. Prevalência Arterial hypertension in Ilha do Governador, Rio de Janeiro, Brazil: II. Prevalence

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Klein

    1995-09-01

    Full Text Available Este segundo artigo (de uma série de dois tem como finalidade apresentar apenas os resultados básicos de um estudo, em amostra representativa de população, sobre Hipertensão Arterial na Ilha do Governador (região administrativa do município do Rio de Janeiro, em três estratos de acordo com a renda média domiciliar (baixa, média e alta de setores censitários. No conjunto da Ilha do Governador a prevalência de hipertensão não controlada foi de 16,1 % (I.C. de 95%: 13,4 a 18,9%, e incluindo-se os hipertensos controlados, este índice subiu para 24,9% (I.C. de 95%: 21,7 a 28,1 %. Por ambos os critérios (incluindo ou não os hipertensos controlados, as prevalências mais elevadas foram as do estrato de renda baixa e as menores do estrato de renda alta. Porém, só foi possível rejeitar a homogeneidade de prevalências de hipertensão (incluindo os controlados entre os estratos, e ainda assim para uma significância de 10%, quando se ajustou o efeito de confusão da idade. As mulheres hipertensas parecem controlar em maior proporção seus níveis de pressão arterial em qualquer faixa etária dos adultos, do que os homens.The aim of this paper (the second of two is to present the basic results of a cross–sectional study on arterial hypertension in adults in Ilha do Governador (a district of the city of Rio de Janeiro, Brazil, with a representative sample of the population, stratified by the census tracts' mean household incorre (low, median, and high. Overall, prevalence of uncontrolled hypertension in Ilha do Governador was 16.1% (C.I. of 95%: 13.4 to 18.9%, and with the inclusion of controlled hypertensive individuals this figure rose to 24.9% (C I. of 95%: 21.7 to 28.7%. Under both criteria (whether including controlled hypertensive individuais or not, higher prevalences were from low‑incorre strata, while lower ones were from the high‑incorre strata. However, it was only possible to reject the hypothesis of strata homogeneity

  6. “… Those could just as well be the rocky mountains…” Consumption, spectacularity and much more in obstetrical ultrasound in Rio de Janeiro at the turn of the century - DOI: 10.3395/reciis.v3i4.217en

    Directory of Open Access Journals (Sweden)

    Lilian Krakowski Chazan

    2009-12-01

    Full Text Available This work calls upon the so called ANT (actor-network theory to approach the obstetric ultrasound technology as an ‘indispensable’ technology in prenatal monitoring in Rio de Janeiro at the turn of the 21st century. It does not envisage to build an exhaustive list but rather to perform a set of heterogeneous elements which by acting in juxtaposition configure the specificity of the studied technology, allowing for its delimitation and naming. The hybrid elements that are presented here - equipment, didacticism, assurance, oracle, affections, prestige, market, media, pathology, purification – are configured and understood as agents or actants which simultaneously are: 1 natural but without previously established forms that are already out there to be ‘simply’ discovered (not “things-in-themselves”; 2 collective but not social if this adjective refers to belonging to an exclusive world of relations of “humans-among-themselves”; and yet 3 narrated but not constituted solely by discourse.The purpose of this work is to perform a distance from the tradition of the great a priori dividers which predominate in the studies of the so-called modern knowledge in the last few centuries: natural x social, public x private, heart x mind, science x belief, human x non-human, male x female, macro x micro, local x global. Our special interest is that, to the extent that this distance is obtained, other landscapes can be reached by Brazilian and Latin American STS (science-technology-society studies – there, to say it somewhat crudely, that which exists is that which acts, and only hybrids have the capacity to act. The next step of this work, here indicated but not completed, is to study where the actions that configure the above elements take place and by which means (material vehicles they communicate, articulate and act one upon other among themselves.

  7. Report made on the behalf of the Commission of foreign affairs, defence and armed forces on the bill project, adopted by the National Assembly, authorizing the approval of the amendment to the Convention on the physical protection of nuclear material - Nr 217

    International Nuclear Information System (INIS)

    Pintat, Xavier

    2012-01-01

    After a presentation of the content of the international Convention (1979) on the physical protection of nuclear material, this report comments how the evolution of the international context during the 2000's induced a strengthening of the Convention measures through an amendment which expands the infractions to be introduced in the national law, and expands the protection to nuclear installations (however, the application is left to the initiative of member States). It discusses the consequences for France of the approval of the amendment. Two other texts are provided in appendix: the report on nuclear safety in 2012 made by the IAEA Director General, and the resolution nr 1540 of the U N Security Council

  8. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  9. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QALPVYYVQDGVAF 60 ... Query: 217 ASVRGLWXXXXXXXXXXXXXXRHPELFGRVASHSGAFIARPGATYANGVID...TTTAGEWLR 276 ... ASVRGLW ... RHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR Sbjct: 121 ASVRGLWGASL...GGLISLYLGSRHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR 180 ... Query: 337 EALLFL 342 ... EALLFL Sbjct: 241 EALLFL 246

  10. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Symbiobacterium thermophilum IAM 14863] ... Length = 217 ... Query: 15 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEM...IAGAILVQNVAWSNAAKAVRALAEAGX 74 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEM...IAGAILVQNVAWSNAAKAVRALAEAG ... Sbjct: 1 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEMIAGAILVQNVAWSNAAKAVRALAEAGL 60 ... Q

  11. Espécies de Phytophthora associadas à gomose em pomares de citros no Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Marilda Pereira Caixeta

    2013-12-01

    Full Text Available A gomose dos citros é considerada uma doença de grande importância para a citricultura no Brasil e em nível mundial. A etiologia desta doença compreende um complexo de espécies de Phytophthora. Embora importante, pouco se conhece sobre a gomose nas regiões produtoras de citros no Estado do Paraná. Por isso, este trabalho teve como objetivo identificar espécies de Phytophthora associadas à gomose em pomares de citros no Paraná. Nas regiões Norte, Noroeste e Vale do Ribeira foram retiradas amostras de raízes de plantas com sintomas de gomose e também de solo da rizosfera. Em laboratório, empregando pêra cv. D'anjou como isca e meio de cultivo batata-dextrose-ágar, foram obtidos 21 isolados de Phytophthora spp. Todos os isolados infectaram mudas de limão 'Cravo', reproduzindo os sintomas de gomose e também apresentaram crescimento micelial a 8º C e a 36º C, com exceção do isolado PR20 para 36º C . "In vitro", esses isolados foram heterotálicos, sendo 20 compatíveis ao tipo padrão A2 e um compatível ao tipo padrão A1. Vinte isolados formaram esporângios persistentes e papilados, com 25,5 - 62,0 µm de comprimento (C e 27,9 - 49,6 µm de largura (L e a relação C/L foi de 1,38:1. Um isolado (PR20 apresentou esporângios medindo 40,3 - 55,8 µm de comprimento e 27,9 - 37,2 µm de largura, formando esporângios persistentes, papilados ou bipapilados e de formas distorcidas, não formando clamidósporos. A temperatura ótima para crescimento desse isolado foi entre 20 a 28º C, enquanto para os demais foi de 24 a 32º C, tendo estes produção abundante de clamidósporos globosos de diâmetro variando entre 21,7 a 43,4 µm. De acordo com as características morfofisiológicas apresentadas, dos 21 isolados analisados, 20 pertenceram à espécie P. nicotianae e um à espécie P. citrophthora. A análise de sequências de genes da região ITS1-5.8S-ITS2 do rDNA e usando o teste de "Single-Strand Conformation Polymorphism

  12. Analysing employers’ expectations of employee skills in the South African tourism industry

    Directory of Open Access Journals (Sweden)

    Faith N. Zwane

    2014-03-01

    Full Text Available Orientation: Owing to the nature of the tourism industry, which is highly service orientated, employees should possess certain skills such as self-reliance, people and certain specialist skills, and general employability when working in this industry. However, it seems that employees are not well enough prepared and equipped with these skills to satisfy the requirements of employers. Thus human resource practitioners need to provide more in-service training. Furthermore, there is a high turnover of employees, which adds pressure to the management of human resources. Research purpose: This study focused on comparing employers’ expectations of employee skills in the tourism industry and the skills acquired by learners in the Culture, Art, Tourism, Hospitality and Sport Skills Education Training Authorities’ (CATHSSETA programmes with regard to self-reliance, people and certain specialist skills, and general employability. Motivation for the study: Education, training and the creation of employment are amongst the key priorities of the South African government for improving the current labour situation in the tourism industry. However, the industry has complained that learners are not prepared for the workplace. Thus, it is important to determine the skills that are supposedly lacking. Research design, approach and method: Descriptive research, following a quantitative approach, was chosen, whereby questionnaires were distributed amongst tourism and hospitality employers listed with CATHSSETA (N = 217. A total of 141 (n = 141 completed questionnaires were received (a response rate of 65%. Between 2008 and 2012, 5633 learners participated in the CATHSSETA programmes. Descriptive statistics and t-tests were used to analyse the data. Main findings: Employers expect higher levels of competence than those which learners in the CATHSSETA programme can deliver. More specifically, employers indicate that learners lack skills in handling customers

  13. Genome Sequences of Three Highly Copper-Resistant Salmonella enterica subsp. I Serovar Typhimurium Strains Isolated from Pigs in Denmark

    DEFF Research Database (Denmark)

    Qin, Yanan; Hasman, Henrik; Aarestrup, Frank Møller

    2014-01-01

    Salmonella typhimurium is the causative agent of typhoid fever, which causes nearly 21.7 million illnesses and 217,000 deaths around the world each year. Here, we describe the draft genome sequences of the Salmonella typhimurium strains S7, S15, and S23, isolated from copper-fed pigs in Denmark...

  14. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities in Support of Marine and Hydrokinetic Energy Deployment

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Copping, Andrea E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Van Cleve, Frances B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2011-09-01

    This fiscal year 2011 progress report summarizes activities carried out under DOE Water Power Task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the marine and hydrokinetic (MHK) energy industry, including regulatory and resource management agencies, tribes, nongovernmental organizations, and industry.

  15. 76 FR 11411 - Defense Federal Acquisition Regulation Supplement; Multiyear Contracting (DFARS Case 2009-D026)

    Science.gov (United States)

    2011-03-02

    ... economic order quantity procurement, are merged into 217.170, General, and 217.172, Multiyear contracts for... guided by the following principles when entering into a multiyear contract for services: (1) The portion... authorized by law (10 U.S.C. 2306b and 10 U.S.C. 2306c). A multiyear supply contract may be authorized by an...

  16. Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

    DEFF Research Database (Denmark)

    Adam, R.; Ade, P. A R; Aghanim, N.

    2016-01-01

    The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the d...

  17. 48 CFR 1217.7001 - Clauses.

    Science.gov (United States)

    2010-10-01

    ... CONTRACT TYPES SPECIAL CONTRACTING METHODS Fixed Price Contracts for Vessel Repair, Alteration or... acceptance tests will afford full protection to the Government in ascertaining conformance to specifications... through (TAR) 48 CFR 1252.217-80. (c) (TAR) 48 CFR 1252.217-75 may be included in sealed bid fixed-price...

  18. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  19. Biochemical composition of zooplankton from the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L.; Sreepada, R.A; Ansari, Z.A

    stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S.; Ansari, Z.A; Parulekar, A

    stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-01-0068 ref|ZP_01038050.1| Nitric oxide reductase large subunit, cytochrome b [Rose...ovarius sp. 217] gb|EAQ23442.1| Nitric oxide reductase large subunit, cytochrome b [Roseovarius sp. 217] ZP_01038050.1 2.6 29% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  3. 77 FR 76939 - Defense Federal Acquisition Regulation Supplement: Definition of Cost or Pricing Data (DFARS Case...

    Science.gov (United States)

    2012-12-31

    ... cost or pricing data'' in its place. PART 217--SPECIAL CONTRACTING METHODS 217.7401 [Amended] 0 11... Cost or Pricing Data (DFARS Case 2011-D040) AGENCY: Defense Acquisition Regulations System, Department... ``certified cost or pricing data'' and ``data other than certified cost or pricing data.'' The DFARS changes...

  4. Non small cell lung cancer – Comparison between clinical and pathological staging

    Directory of Open Access Journals (Sweden)

    G. Fernandes

    2006-07-01

    Full Text Available Lung cancer (LC staging remains a clinical challenge as it determines the disease's prognosis and treatment. Surgery is the best option for controlling non-small cell lung cancer (NSCLC and the only potential cure. In this setting, lung cancer staging helps select patients who will benefit from surgery, excluding inoperable patients and including patients with resectable lesions. The aim of this study is to compare clinical staging (TNMc with pathological staging (TNMp and to evaluate diagnosis, complementary treatment and survival of these patients.This is a retrospective study that included patients with non-small cell lung cancer or with highly sus- picious lesions who had undergone surgery and were followed up in the Hospital de São João lung cancer unit between January 1999 and December 2003. It is based on clinical files and pathology reports.73.3% of this group of 60 patients were male, with median age 59.2 years. The most frequent TNMc stages were 41.7% T1N0M0 and 36.7% T2N0M0. Thoracotomy for therapeutic purpose was performed in 80% and thoracotomy for diagnostic purpose also in the remaining 20%. In 6.7% the resection was incomplete. The most frequent TNMp stages were T2N0p in 33.3%, T2N1p in 15.0% and T2N2p in 13.3%. There was a significant difference between the two staging types, with upstaging in 65.0%, down staging in 67% and only 28.3% keeping the same stage. The most frequent differences were from T1N0c to T2N0p and from T2N0c to T2N1p. The global agreement between both staging methods was 21.7%. Median global survival was 43 months.In conclusion, while clinical staging was less accurate, it did not determine important changes in therapeutic strategy and survival. For the future, we should consider using other diagnostic tools and other biological factors to complement the anatomical information that we currently use. Resumo: O estadiamento do cancro do pulmão (CP permanece um desafio clínico, sendo fundamental para

  5. Cancro do pulmão de não pequenas células: Comparação entre o estadiamento clínico e o patológico Non small cell lung cancer: Comparison between clinical and pathological staging

    Directory of Open Access Journals (Sweden)

    G Fernandes

    2006-07-01

    Full Text Available O estadiamento do cancro do pulmão (CP permanece um desafio clínico, sendo fundamental para estabelecer o prognóstico e a terapêutica da doença. É reconhecido que o tratamento cirúrgico do cancro de pulmão de não pequenas células (CPNPC constitui a única estratégia com potencial curativo. Neste âmbito, pretende-se, com o estadiamento, seleccionar correctamente os doentes que beneficiarão de cirurgia, evitando submeter doentes inoperáveis a cirurgias desnecessárias e, simultaneamente, não excluindo doentes com lesões potencialmente ressecáveis. O objectivo principal deste estudo foi comparar o estadiamento TNM clínico (TNMc com o estadiamento TNM anatomopatológico (TNMp e avaliar aspectos do diagnóstico, tratamento e sobrevida dos doentes. Consistiu num estudo retrospectivo de doentes com CPNPC ou com lesões altamente suspeitas, submetidos a cirurgia, seguidos na Consulta de Pneumologia Oncológica do Hospital de São João, de Janeiro de 1999 a Dezembro de 2003; baseou-se na revisão de processos clínicos e de relatórios anatomopatológicos. Foram incluídos 60 doentes, 73,3% do sexo masculino, com mediana de idades de 59,5 anos. Os TNMc mais frequentes foram: T1N0M0 em 41,7% e T2N0M0 em 36,7%. Foi efectuada toracotomia com objectivo terapêutico em 80% dos doentes; nos restantes 20% esta foi também diagnóstica. Em 6,7% dos casos, a ressecção foi incompleta. Quanto ao TNMp, os mais frequentes foram: T2N0p em 33,3%, T2N1p em 15,0% e T2N2p em 13,3%. Quando comparados, verificou-se que a diferença entre os estadiamentos foi significativa, tendo ocorrido subida de estádio em 65,0% e descida em 6,7%; apenas 28,3% mantiveram o mesmo estádio. As principais alterações foram de T1N0c para T2N0p e de T2N0c para T2N1p. A concordância global entre os dois métodos de estadiamento foi de 21,7%. A sobrevida mediana global foi de 43 meses. Em conclusão, o estadiamento clínico revelou-se menos rigoroso, apesar de não ter

  6. Recuperación de la biomasa mediante la sucesión secundaria, Cordillera Central de los Andes, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Ignacio del Valle

    2011-09-01

    Full Text Available En bosques secundarios premontanos tropicales es escasa la información sobre el tiempo requerido para recuperar la biomasa aérea y subterránea de los primarios. Por lo tanto, establecimos 33 parcelas de 0.1ha entre 550 y 1 700m en bosques secundarios que cubrían estadios serales de 3 a 36 años y estimamos la biomasa de las plantas y de las raíces gruesas con ecuaciones locales. Así como la biomasa de las pasturas y barbechos por cosecha de 54 y 18 parcelas, respectivamente. También se calculó la edad de las parcelas con informantes locales, sensores remotos, C14 y anillos de crecimiento. En cada parcela medimos la biomasa aérea viva por hectárea (Bav y la de las raíces gruesas por hectárea (Brg. Modelamos la Bav y Brg en función de la edad mediante la ecuación de von Bertalanfy con asíntotas de 247t/ha (Bav y 66t/ha (Brg resultantes de la medición de 33 parcelas de 0.1ha en los bosques primarios. Con la razón Brg/Bav=f(t estimamos 87 años para que los bosques secundarios recuperen la Bav existente en los primarios y 217 años para recuperar la Brg. La tasa máxima de crecimiento instantáneo de la Bav fue 6.95t/ha/año a los 10 años y la tasa media máxima de crecimiento 6.26t/ha/año a los 17 años. La media ponderada de la tasa de crecimiento absoluto de la Bav alcanzó 4.57t/ha/año y la relativa 10% anual. La razón Brg/Bav inicialmente aumenta muy aceleradamente hasta 4-5 años (25%, luego disminuye hasta 25 años (18% para luego incrementar hasta 26.7Biomass recovery through secondary succession in the Cordillera Central de los Andes, Colombia. Estimations on biomass recovery rates by secondary tropical forests are needed to understand the complex tropical succession, and their importance on CO2 capture, to offset the warming of the planet. We conducted the study in the Porce River Canyon between 550 and 1 700m.a.s.l. covering tropical and premontane moist belts. We established 33 temporary plots of 50mx20m in secondary

  7. Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

    LENUS (Irish Health Repository)

    Delanty, Norman

    2012-02-01

    Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

  8. 27 CFR 24.210 - Classes of wine other than standard wine.

    Science.gov (United States)

    2010-04-01

    ... fermentation wine, produced as provided in § 24.212; (b) Heavy bodied blending wine, produced as provided in...; (f) Vinegar stock, produced as provided in § 24.217; and (g) Wines other than those in classes listed...

  9. Emergency centre investigation of first-onset seizures in adults in the ...

    African Journals Online (AJOL)

    Subgroup analyses were conducted regarding HIV status and inter-facility variation. ... Lumbar puncture (LP) was performed in 67 (21.7%) patients, with normal cerebrospinal fluid findings in 51 (76.1%). ..... There are clear indications for.

  10. ETHNICITY AND NIGERIA'S UNDERDEVELOPMENT Cletus ...

    African Journals Online (AJOL)

    Ike Odimegwu

    Ogirisi: a new journal of African studies vol 9 2012. 217 prediction of CIA that ... by M. Pakaluk, Indianapolis: Hackett Publishing Company, 1991, p.86. 6 Roosens, E., “Interest .... unfriendly and unstable business environment. Nigeria has a.

  11. Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

    Czech Academy of Sciences Publication Activity Database

    Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.

    2012-01-01

    Roč. 79, č. 2 (2012), s. 212-217 ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

  12. Adaptation to different climates results in divergent phenotypic ...

    Indian Academy of Sciences (India)

    The phenotypic plasticity of wing size and wing shape of Zaprionus indianus was ... C) in two natural populations living under different climates, equatorial and ... size and shape in an invasive drosophilid. J. Genet. 87, 209–217]. Introduction.

  13. 40 CFR 408.71 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c...

  14. FastStats: Oral and Dental Health

    Science.gov (United States)

    ... What's this? Submit Button NCHS Home Oral and Dental Health Recommend on Facebook Tweet Share Compartir Data ... States, 2016, table 60 [PDF – 9.8 MB] Dental visits Percent of children aged 2-17 years ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 217 ... ... macrocarpon L.) produced under different nitrogen fertilizer rates, Abstract ... Vol 12, No 1 (2017), Groundwater hydrochemical assessment of the ... Vol 10, No 2 (2015), Informal Knowledge Institutions and Market ...

  16. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs

    Czech Academy of Sciences Publication Activity Database

    Robovská-Havelková, P.; Aerts, P.; Roček, Zbyněk; Přikryl, Tomáš; Fabre, A.-C.; Herrel, A.

    2014-01-01

    Roč. 217, č. 20 (2014), s. 3637-3644 ISSN 0022-0949 Institutional support: RVO:67985831 Keywords : Anura * kinematics * locomotion * swimming Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  17. 26 CFR 31.3306(b)(9)-1 - Moving expenses.

    Science.gov (United States)

    2010-04-01

    ... expenses. (a) The term “wages” does not include remuneration paid on or after November 1, 1964, to or on... director or the courts finally to establish that a deduction is allowable under section 217. The reasonable...

  18. The use of biodegradable polymers for the stabilization of copper ...

    Indian Academy of Sciences (India)

    2017-08-03

    Aug 3, 2017 ... nanoparticles synthesized by chemical reduction method ... and the reaction temperature on the size and size distribution of copper nanoparticles were investigated using the ..... on chemical and process engineering p 217.

  19. Conjugated oestrogen during the menstrual cycle measured by a direct radioimmunoassay with an antiserum prepared against oestradiol-17-glucosiduronate-(C-6)-BSA conjugate

    Energy Technology Data Exchange (ETDEWEB)

    Honjo, H.; Otsubo, K.; Yasuda, J.; Kitawaki, J.; Okada, H. (Department of Obstetrics and Gynaecology, Kyoto Prefectural University of Medicine, Kyoto); Ohkubo, T.; Nambara, T. (Pharmaceutical Institute, Tohoku University, Sendai, Japan)

    1984-01-01

    Early morning and 24 h urine samples and serum were collected daily throughout the menstrual cycle in women. Urinary oestradiol-17-glucosiduronate (E/sub 2/-17G) was measured with a direct radioimmunoassay whose antiserum has been prepared against E/sub 2/-17-G-(C-6)-bovine serum albumin conjugate and was very specific. On the average, E/sub 2/-17-G in early morning and 24 h urine samples showed a prominent peak one day before the peak of urinary LH. The time relationship between these urinary E/sub 2/-17-G and serum E/sub 2/ levels and peaks was also investigated.

  20. Go4Life

    Medline Plus

    Full Text Available ... ago 20,217 views Trainer Sandy and Irene practice Back Leg Raises, a lower body exercise from ... 19 Play next Play now Choosing Nutrient Dense Foods - Duration: 6 minutes, 19 seconds. National Institute On ...

  1. No evidence for cumulative effects in a Dnmt3b hypomorph across multiple generations

    Czech Academy of Sciences Publication Activity Database

    Youngson, N.A.; Epp, Trevor; Roberts, A.R.; Daxinger, L.; Ashe, A.; Huang, E.; Lester, K.L.; Harten, S.K.; Kay, G.F.; Cox, T.; Matthews, J.M.; Chong, S.; Whitelaw, E.

    2013-01-01

    Roč. 24, 5-6 (2013), s. 206-217 ISSN 0938-8990 Institutional support: RVO:68378050 Keywords : epigenetic inheritance * mammalian development * transgenerational Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.883, year: 2013

  2. Teadlasena poliitikas - võimalused ja piirid = Als Wissenschaftler in der Politik - Chancen und Grenzen / Eiki Berg

    Index Scriptorium Estoniae

    Berg, Eiki, 1970-

    2005-01-01

    Autori hinnangul lasub teadlasel poliitikas suurem vastutus kui mistahes valdkonna esindajal, sest teaduslikult argumenteeritud poliitilised otsused on teadmiste jõu ja poliitilise võimu sümbioos. Vt. ka kommentaare lk. 217-222,467-472

  3. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  4. Meeting Report: Minutes from EMBO: Ten Years of Comparative Genomics of Eukaryotic Microorganisms

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Julius; López-García, P.; Louis, E.; Boekhout, T.

    2016-01-01

    Roč. 167, č. 3 (2016), s. 217-221 ISSN 1434-4610 Institutional support: RVO:60077344 Keywords : protist * eukaryotic microorganisms * genomics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.794, year: 2016

  5. 78 FR 35837 - North Carolina: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2013-06-14

    ... the docket are listed in the www.regulations.gov index. Although listed in the index, some information... Natural Resources, 217 West Jones Street, Raleigh, North Carolina 27603; telephone number (919) 707-8219...

  6. Wüstehubové. Ďáblovo plémě nebo tvůrcové kulturní krajiny?

    Czech Academy of Sciences Publication Activity Database

    Kouřil, Pavel; Wihoda, M.

    2001-01-01

    Roč. 50, č. 3 (2001), s. 205-217 ISSN 0323-0678 Institutional research plan: CEZ:AV0Z8001916 Keywords : Moravia, Silesia * colonisation * castles and material culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Diabetic Retinopathy.

    African Journals Online (AJOL)

    AmL

    diabetic foot were significantly associated with DR. Within patients' practice, regular .... Major limb complications included foot ulcer, claudication .... Flat. 217 44.5 66 30.6. Family income / month (KD). 1500. 45 9.2 24 ...

  8. 77 FR 27777 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2012-05-11

    ... Hours: 1,217. (For policy questions regarding this collection contact Kim Roche at 410- 786-3524. For... include the bundling of separately billed drugs, clinical laboratory tests, and other items ``to maximum...

  9. Genomic and Functional Characterization of the Unusual pLOCK 0919 Plasmid Harboring the spaCBA Pili Cluster in Lactobacillus casei LOCK 0919

    Czech Academy of Sciences Publication Activity Database

    Aleksandrzak-Piekarczyk, T.; Koryszewska-Baginska, A.; Grynberg, M.; Nowak, A.; Cukrowska, B.; Kozáková, Hana; Bardowski, J.

    2016-01-01

    Roč. 8, č. 1 (2016), s. 202-217 ISSN 1759-6653 Institutional support: RVO:61388971 Keywords : adhesion * spaCBA pilus cluster * lactobacillus Subject RIV: EC - Immunology Impact factor: 3.979, year: 2016

  10. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available monas ... oryzae pv. oryzae KACC10331] ... Length = 130 ... Query: 158 PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHIS...ITGHTDTTAYSSD 217 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHIS...ITGHTDTTAYSSD Sbjct: 1 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHISITGHTDTTAYSSD 60 ... Query: 278 TQDAES 283 ... TQDAES Sbjct: 121 TQDAES 126

  11. Možnosti mediální výchovy v učebnicích českého jazyka

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2012-01-01

    Roč. 62, č. 5 (2012), s. 209-217 ISSN 0009-0786 Institutional support: RVO:68378092 Keywords : media literacy * media education * communication training * Czech language * Framework Educational Programme * cross-sectional subject Subject RIV: AI - Linguistics

  12. Human factors issues in motorcoach emergency egress

    Science.gov (United States)

    2009-08-01

    FMVSS 217, Bus Emergency Exits and Window Retention and Release specifies a series of dimensional and physical requirements : for emergency exits. The intent of NHTSA is to minimize the likelihood of occupants being ejected from the bus and to pro...

  13. African Journal of Biomedical Research - Vol 18, No 3 (2015)

    African Journals Online (AJOL)

    Analgesic and Central Nervous System Depressant Activities of Kolaviron (a Garcinia kola biflavonoid complex) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GF Ibironke, AA Fasanmade, 217-223 ...

  14. Age at weaning, immunocompetence and ectoparasite performance in a precocial desert rodent

    Czech Academy of Sciences Publication Activity Database

    Dlugosz, E. M.; Goüy de Bellocq, Joëlle; Khokhlova, I. S.; Degen, A. A.; Pinshow, B.; Krasnov, B. R.

    2014-01-01

    Roč. 217, č. 17 (2014), s. 3078-3084 ISSN 0022-0949 Institutional support: RVO:68081766 Keywords : Fleas * PHA response * Weaning * Spiny mouse Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  15. 76 FR 22054 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2011-04-20

    .... June 24, 2010 230169 1143). 01-1532P). 19, 2010; The Times Henderson, Chairman, Record. Board of.... Selectboard, P.O. Box 217, Wilmington, VT 05363. Virginia: Independent City of City of Fairfax (10-03- June 14...

  16. Protein (Cyanobacteria): 504984487 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_015171589.1 ... 1117:22124 ... 1150:57295 1301283:79049 ... 63132:217 1173025:1268 ... hypothetical protein Geit...lerinema sp. PCC 7407 MAQLQRLDIVGDDGQTIEIFVEEKDAPVLATSPNRDGRPSMGAGSPSVKMQQMQQVIRGYATYALNAFKDFSAAEVEEITLMFGVKLSASAGIPYIANGTTDSNLEVQVKCRFPAKDG

  17. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Czech Academy of Sciences Publication Activity Database

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

    2015-01-01

    Roč. 285, 1 July (2015), s. 217-226 ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.333, year: 2015

  18. Wnt signaling pathway involvement in genotypic and phenotypic variations in Waardenburg syndrome type 2 with MITF mutations.

    Science.gov (United States)

    Wang, Xue-Ping; Liu, Ya-Lan; Mei, Ling-Yun; He, Chu-Feng; Niu, Zhi-Jie; Sun, Jie; Zhao, Yu-Lin; Feng, Yong; Zhang, Hua

    2018-05-01

    Mutation in the gene encoding microphthalmia-associated transcription factor (MITF) lead to Waardenburg syndrome 2 (WS2), an autosomal dominantly inherited syndrome with auditory-pigmentary abnormalities, which is clinically and genetically heterogeneous. Haploinsufficiency may be the underlying mechanism for WS2. However, the mechanisms explaining the genotypic and phenotypic variations in WS2 caused by MITF mutations are unclear. A previous study revealed that MITF interacts with LEF-1, an important factor in the Wnt signaling pathway, to regulate its own transcription through LEF-1-binding sites on the MITF promoter. In this study, four different WS2-associated MITF mutations (p.R217I, p.R217G, p.R255X, p.R217del) that are associated with highly variable clinical features were chosen. According to the results, LEF-1 can activate the expression of MITF on its own, but MITF proteins inhibited the activation. This inhibition weakens when the dosage of MITF is reduced. Except for p.R217I, p.R255X, p.R217G, and p.R217del lose the ability to activate TYR completely and do not inhibit the LEF-1-mediated activation of the MITF-M promoter, and the haploinsufficiency created by mutant MITF can be overcome; correspondingly, the mutants' associated phenotypes are less severe than that of p.R217I. The dominant negative of p.R217del made it have a second-most severe phenotype. This study's data imply that MITF has a negative feedback loop of regulation to stabilize MITF gene dosage that involves the Wnt signaling pathway and that the interaction of MITF mutants with this pathway drives the genotypic and phenotypic differences observed in Waardenburg syndrome type 2 associated with MITF mutations.

  19. Spectroscopic Investigations of High-Power Laser Sparks in Gas Mixtures Containing Methane: A Laboratory Model of Energetic Events in Strongly Reduced Planetary Atmospheres

    Czech Academy of Sciences Publication Activity Database

    Civiš, Svatopluk; Civiš, Martin; Rašín, R.; Kamas, Michal; Dryahina, Kseniya; Španěl, Patrik; Juha, Libor; Ferus, Martin

    2009-01-01

    Roč. 39, 3-4 (2009), s. 217-217 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : planetary atmosphere * lasers * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009

  20. Reliability Information Analysis Center 1st Quarter 2007, Technical Area Task (TAT) Report

    Science.gov (United States)

    2007-02-05

    Library or [twField/Test 217Plus Ally w/ a.romtu DAAData Experience Data Need t( rdito Trqnd • s aa(Model) develol analisis Mappng & ANLED217Plu...of collected reliability data and have discovered that even with sparse data, analysis of the data shows clustering of reliability data by equipment...intended search target. Conceptually cluster discovered data to allow more detailed analysis by equipment type. For example, it may be useful to

  1. Radioisotope space power generator. Annual report, July 1, 1975--September 30, 1976

    International Nuclear Information System (INIS)

    Elsner, N.B.; Chin, J.; Staley, H.G.; Steeger, E.J.; Gantzel, P.K.

    1977-09-01

    TPM-217 P-type selenide usefulness in thermoelectric converters depends on its dimensional, electrical and thermal stability at high temperature and its compatibility with other converter component materials in a low pressure environment. Experimental efforts have been directed at determining: the vaporization behavior at 900 0 C, the partial pressures of vaporizing species versus temperature, vapor suppression coatings, thermal expansion, dimensional stability, and the high temperature compatibility of TPM-217 with proposed end cap materials

  2. Minimal Representation and Decision Making for Networked Autonomous Agents

    Science.gov (United States)

    2015-08-27

    University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S...Laboratory University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 tel: 217-333-1368, fax: 217-244-1653 email: voulgari@illinois.edu...a mobile sensor network (MSN) when some of the nodes in the network fail. We posed the problem as a multi-stage decision process, and used forward

  3. Nematodes from the genus Ascaridia parasitizing psittaciform birds: a review and determination key

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 6 (2004), s. 217-223 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * parrots * morphometry Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-6-217.pdf

  4. Radioisotope space power generator annual report, July 1, 1974--June 30, 1975

    International Nuclear Information System (INIS)

    Elsner, N.B.; Chin, J.; Staley, H.G.

    1976-01-01

    The Isotec Technology Program for FY-75 concentrated on materials development efforts in two areas: TPM-217 P-type material and SiGe technology. TPM-217 P-type material is a 3M proprietary thermoelectric material whose principal components are Cu, Ag, and Se. The usefulness of TPM-217 P-type selenide in thermoelectric converters depends on its dimensional, electrical, and thermal stability at high temperature and its compatibility with other converter component materials in a low-pressure environment. Experimental efforts were directed toward determining (1) the vapor species above TPM-217 from 700 0 to 1100 0 C, (2) the weight loss rate for TPM-217 at 900 0 C in vacuo, and (3) the stability of TPM-217 material in contact with Mo, Fe, 316 stainless steel, and pyrocarbon. The Si-Ge program is a continuation of the experimental work performed during FY-74. The development of coatings to suppress the vaporization of SiMo and SiGe continued. Techniques for applying ion-plated and chemical-vapor-deposited coatings of Si 3 N 4 and (Si,Al)N alloys on SiMo were examined. Methods of controlling morphology and the chemical composition of these coatings were developed. Rates of vaporization for coated samples at 1100 0 C were measured

  5. Antibacterial activities of coagulase-negative staphylococci from bovine teat apex skin and their inhibitory effect on mastitis-related pathogens.

    Science.gov (United States)

    Braem, G; Stijlemans, B; Van Haken, W; De Vliegher, S; De Vuyst, L; Leroy, F

    2014-05-01

    To explore antibacterial activities of coagulase-negative staphylococci (CoNS) from teat apices of dairy cows towards mastitis-causing pathogens. Of 254 CoNS, 38 displayed bacteriocin-like activity after a first screening. Seven of these strains displayed activity against at least one mastitis-related pathogen (Streptococcus uberis, Streptococcus dysgalactiae and Staphylococcus aureus). Staphylococcus chromogenes L217 displayed the strongest inhibitory effect, being active against all tested mastitis-related pathogens and most tested CoNS. Based on cation exchange and reversed-phase chromatography, in addition to N-terminal Edman degradation and PCR, the antibacterial peptide was identified as a nukacin-type bacteriocin and named nukacin L217. Although staphylococcal bacteriocins are generally found in the cell-free supernatants of liquid cultures, Staph. chromogenes L217 only led to detectable activity when grown on agar medium. Bacteriocin-like activities are not uncommon among CoNS from teat apices and may inhibit mastitis-causing pathogens, as found for nukacin L217 production by Staph. chromogenes L217. Nukacin L217 is the first identified bacteriocin of the species Staph. chromogenes and displays unusual production kinetics, that is, requiring surface growth of its producer. The fact that nukacins are produced by different CoNS species suggests a role in the teat skin ecosystem. © 2014 The Society for Applied Microbiology.

  6. Digital Breast Tomosynthesis versus Supplemental Diagnostic Mammographic Views for Evaluation of Noncalcified Breast Lesions

    Science.gov (United States)

    Bandos, Andriy I.; Ganott, Marie A.; Sumkin, Jules H.; Kelly, Amy E.; Catullo, Victor J.; Rathfon, Grace Y.; Lu, Amy H.; Gur, David

    2013-01-01

    Purpose: To compare the diagnostic performance of breast tomosynthesis versus supplemental mammography views in classification of masses, distortions, and asymmetries. Materials and Methods: Eight radiologists who specialized in breast imaging retrospectively reviewed 217 consecutively accrued lesions by using protocols that were HIPAA compliant and institutional review board approved in 182 patients aged 31–60 years (mean, 50 years) who underwent diagnostic mammography and tomosynthesis. The lesions in the cohort included 33% (72 of 217) cancers and 67% (145 of 217) benign lesions. Eighty-four percent (182 of 217) of the lesions were masses, 11% (25 of 217) were asymmetries, and 5% (10 of 217) were distortions that were initially detected at clinical examination in 8% (17 of 217), at mammography in 80% (173 of 217), at ultrasonography (US) in 11% (25 of 217), or at magnetic resonance imaging in 1% (2 of 217). Histopathologic examination established truth in 191 lesions, US revealed a cyst in 12 lesions, and 14 lesions had a normal follow-up. Each lesion was interpreted once with tomosynthesis and once with supplemental mammographic views; both modes included the mediolateral oblique and craniocaudal views in a fully crossed and balanced design by using a five-category Breast Imaging Reporting and Data System (BI-RADS) assessment and a probability-of-malignancy score. Differences between modes were analyzed with a generalized linear mixed model for BI-RADS–based sensitivity and specificity and with modified Obuchowski-Rockette approach for probability-of-malignancy–based area under the receiver operating characteristic (ROC) curve. Results: Average probability-of-malignancy–based area under the ROC curve was 0.87 for tomosynthesis versus 0.83 for supplemental views (P tomosynthesis, the false-positive rate decreased from 85% (989 of 1160) to 74% (864 of 1160) (P tomosynthesis, more cancers were classified as BI-RADS category 5 (39% [226 of 576] vs 33% [188

  7. Thermoelectric materials evaluation program. Quarterly technical task report No. 46

    International Nuclear Information System (INIS)

    Hampl, E.F. Jr.

    1976-02-01

    This forty-sixth Technical Task Report prepared under contract E(11-1)-2331 with the U.S. AEC and U.S. ERDA covers the performance period from October 1, 1975, to December 31, 1975. Highlights include the following tasks: N-type material development (material synthesis--gadolinium selenide compositions; material analyses; material processing; element contacting; ingradient compatibility and life testing; mechanical property characterization), TPM-217 P-type characterization (material preparation and analyses; element contacting; thermodynamic stability; isothermal chemical compatibility; ingradient compatibility and ingradient life testing; performance mapping of contacted and noncontacted elements; high-temperature partitioned P-legs), couple development (design and development of TPM-217/gadolinium selenide rare earth chalcogenide couple; design and development of TPM-217/3N-PbTe couples; advanced generator concepts), module development, liaison with Jet Propulsion Laboratory and material supply, liaison with GGA, and program management. 24 figures, 27 tables

  8. Comparison of the effects of pretreatment with Veramix sponge (medroxyprogesterone acetate) or CIDR (natural progesterone) in combination with an injection of estradiol-17β on ovarian activity, endocrine profiles, and embryo yields in cyclic ewes superovulated in the multiple-dose Folltropin-V (porcine FSH) regimen.

    Science.gov (United States)

    Bartlewski, Pawel M; Seaton, Patricia; Szpila, Patrycja; Oliveira, Maria E F; Murawski, Maciej; Schwarz, Tomasz; Kridli, Rami T; Zieba, Dorota A

    2015-10-15

    Follicular wave status at the beginning of exogenous FSH administration is an important contributor to variability in superovulatory responses in ruminants. Studies in ewes have shown a decrease in the number of ovulations when superovulation is initiated in the presence of ostensibly ovulatory-sized ovarian follicles. Hormonal ablation of large antral follicles with the progestin-estradiol (E2-17β) treatment significantly reduces this variability in superovulated anestrous ewes, but the effects of the treatment in cycling ewes have not yet been assessed. Sixteen Rideau Arcott × Polled Dorset ewes (November-December) received either medroxyprogesterone acetate (MAP)-releasing intravaginal sponges (60 mg) or controlled internal drug release (CIDR) devices (containing 300 mg of natural progesterone) for 14 days (Days 0-14), with a single intramuscular injection of 350 μg of E2-17β on Day 6. The superovulatory treatment consisted of six injections of porcine FSH (Folltropin-V) given twice daily, followed by a bolus GnRH injection (50 μg intramuscular) on Day 15. There were no differences (P ewes. In both subsets of animals, the next follicular wave emerged ∼2.5 days after an E2-17β injection (P > 0.05). A decline in maximum follicle size after an E2-17β injection was more abrupt in CIDR- compared with MAP-treated animals, and the ewes pretreated with exogenous progesterone had significantly more 3-mm follicles at the start of the superovulatory treatment. The metabolic clearance rate of exogenous E2-17β appeared to be greater in MAP-treated ewes, but circulating concentrations of porcine FSH failed to increase significantly after each Folltropin-V injection in CIDR-treated animals. The CIDR-treated ewes exceeded (P ewes receiving E2-17β before ovarian superstimulation, there were no differences in superovulatory responses. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Thyroid cancer: experiences at Uttar Pradesh

    International Nuclear Information System (INIS)

    Varma, K.D.

    1999-01-01

    The highest incidence of goitre and also carcinoma of the thyroid was found to be in Terai. Although patients having thyroid carcinoma are being treated since 1964, because of the poor follow-up of the patients, only 1140 patients seen over 20 years (1978-1997) have been included in the study. Of the 217 cases of anaplastic carcinomas, surgery was feasible in only 19.4% (43/217) of cases. Even in these cases, the disease recurred within a short period to poor results. The main treatment has been external beam radiotherapy with doxorubicin as a radiosensitiser

  10. Planck 2013 results. VI. High Frequency Instrument data processing

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

    2013-01-01

    We describe the processing of the 531 billion raw data samples from the High Frequency Instrument (HFI), which we performed to produce six temperature maps from the first 473 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143,217, 353, 545......, these two high frequency channels are calibrated to within 5% and the 353 GHz channel to the percent level. The 100 and217 GHz channels, which together with the 143 GHz channel determine the high-multipole part of the CMB power spectrum (50

  11. Pre-Exposure Prophylaxis YouTube Videos: Content Evaluation.

    Science.gov (United States)

    Kecojevic, Aleksandar; Basch, Corey; Basch, Charles; Kernan, William

    2018-02-16

    Antiretroviral (ARV) medicines reduce the risk of transmitting the HIV virus and are recommended as daily pre-exposure prophylaxis (PrEP) in combination with safer sex practices for HIV-negative individuals at a high risk for infection, but are underused in HIV prevention. Previous literature suggests that YouTube is extensively used to share health information. While pre-exposure prophylaxis (PrEP) is a novel and promising approach to HIV prevention, there is limited understanding of YouTube videos as a source of information on PrEP. The objective of this study was to describe the sources, characteristics, and content of the most widely viewed PrEP YouTube videos published up to October 1, 2016. The keywords "pre-exposure prophylaxis" and "Truvada" were used to find 217 videos with a view count >100. Videos were coded for source, view count, length, number of comments, and selected aspects of content. Videos were also assessed for the most likely target audience. The total cumulative number of views was >2.3 million, however, a single Centers for Disease Control and Prevention video accounted for >1.2 million of the total cumulative views. A great majority (181/217, 83.4%) of the videos promoted the use of PrEP, whereas 60.8% (132/217) identified the specific target audience. In contrast, only 35.9% (78/217) of the videos mentioned how to obtain PrEP, whereas less than one third addressed the costs, side effects, and safety aspects relating to PrEP. Medical and academic institutions were the sources of the largest number of videos (66/217, 30.4%), followed by consumers (63/217, 29.0%), community-based organizations (CBO; 48/217, 22.1%), and media (40/217, 18.4%). Videos uploaded by the media sources were more likely to discuss the cost of PrEP (PYouTube videos can be used to share reliable PrEP information with individuals. Further research is needed to identify the best practices for using this medium to promote and increase PrEP uptake. ©Aleksandar Kecojevic

  12. Environmental Impact Analysis Process. Final Environmental Impact Statement Supersonic Flight Operations in the Valentine Military Operations Area

    Science.gov (United States)

    1983-11-04

    Federal Activities, U.S. Environmental Protection Agency, Washington, D.C. Sincerely yours,, PD k Whittington , P.E Regional Administrator Enclosure I I I I...many of the residents are deprived , disadvantaged; uninformed and part of a minority); nor is anyone certain the AF will make full restitUtion in light...only wash 217 our home away but would deprive to us of water for the pipelines that supply 217 water over the whole ranch. This reservoir has been here

  13. Diethylstilbestrol can effectively accelerate estradiol-17-O-glucuronidation, while potently inhibiting estradiol-3-O-glucuronidation

    International Nuclear Information System (INIS)

    Zhu, Liangliang; Xiao, Ling; Xia, Yangliu; Zhou, Kun; Wang, Huili; Huang, Minyi; Ge, Guangbo; Wu, Yan; Wu, Ganlin; Yang, Ling

    2015-01-01

    This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K m values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V max values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V max from 0.016 to 0.81 nmol/min/mg, while lifting K m in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K A , α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the activity of UGT1A4

  14. Několik poznámek k problematice ochrany duševního vlastnictví

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2011-01-01

    Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

  15. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  16. Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

    DEFF Research Database (Denmark)

    Sørensen, M B; Pedersen, B L; Nyrnberg, L E

    2000-01-01

    Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...... setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception...

  17. 75 FR 76069 - Random Drug and Alcohol Testing Percentage Rates of Covered Aviation Employees for the Period of...

    Science.gov (United States)

    2010-12-07

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Random Drug and Alcohol Testing... minimum random drug and alcohol testing percentage rates for the period January 1, 2011, through December... Regulations Title 14, section 120.109(b) (for drug testing), and 120.217(c) (for alcohol testing). Issued in...

  18. 77 FR 71669 - Random Drug and Alcohol Testing Percentage Rates of Covered Aviation Employees for the Period of...

    Science.gov (United States)

    2012-12-03

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Random Drug and Alcohol Testing... the minimum random drug and alcohol testing percentage rates for the period January 1, 2013, through... Regulations Title 14, Sec. Sec. 120.109(b) (for drug testing), and 120.217(c) (for alcohol testing). Issued in...

  19. 76 FR 74843 - Random Drug and Alcohol Testing Percentage Rates of Covered Aviation Employees for the Period of...

    Science.gov (United States)

    2011-12-01

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Random Drug and Alcohol Testing... the minimum random drug and alcohol testing percentage rates for the period January 1, 2012, through... Regulations Title 14, Sec. 120.109(b) (for drug testing), and 120.217(c) (for alcohol testing). Issued in...

  20. 78 FR 77196 - Random Drug and Alcohol Testing Percentage Rates of Covered Aviation Employees for the Period of...

    Science.gov (United States)

    2013-12-20

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Random Drug and Alcohol Testing... the minimum random drug and alcohol testing percentage rates for the period January 1, 2014, through... Federal Regulations Title 14, section 120.109(b) (for drug testing), and 120.217(c) (for alcohol testing...

  1. Horn antenna design studies. Citations from the International Aerospace Abstract data base

    Science.gov (United States)

    Gallagher, M. K.

    1980-01-01

    These citations from the international literature describe the antenna radiation patterns, polarization characteristics, wave propagation, noise temperature, wave diffraction, and wideband communication of various horn antennas. This updated bibliography contains 217 citations, 63 of which are new entries to the previous edition.

  2. Storytelling Slide Shows to Improve Diabetes and High Blood Pressure Knowledge and Self-Efficacy: Three-Year Results among Community Dwelling Older African Americans

    Science.gov (United States)

    Bertera, Elizabeth M.

    2014-01-01

    This study combined the African American tradition of oral storytelling with the Hispanic medium of "Fotonovelas." A staggered pretest posttest control group design was used to evaluate four Storytelling Slide Shows on health that featured community members. A total of 212 participants were recruited for the intervention and 217 for the…

  3. Assessment of magmatic vs. metasomatic processes in rare-metal granites: A case study of the Cínovec/Zinnwald Sn–W–Li deposit, Central Europe

    Czech Academy of Sciences Publication Activity Database

    Breiter, Karel; Ďurišová, Jana; Hrstka, Tomáš; Korbelová, Zuzana; Hložková Vaňková, M.; Vašinová Galiová, M.; Kanický, V.; Rambousek, P.; Knésl, I.; Dobeš, P.; Dosbaba, M.

    292/293, November (2017), s. 198-217 ISSN 0024-4937 R&D Projects: GA ČR GA14-13600S Institutional support: RVO:67985831 Keywords : rare-metal granite * Cínovec/Zinnwald deposit * rock textures * metasomatic processes * magmatic processes Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  4. Vapor Phase Self-assembled Monolayers for Anti-stiction Applications in MEMS

    DEFF Research Database (Denmark)

    Zhuang, Yanxin; Hansen, Ole; Knieling, Thomas

    2007-01-01

    (CF2)7(CH2)2SiCl3 (FDTS), and CH3(CH2)17(CH2)2SiCl3 (OTS). The SAM coatings that were grown on silicon substrates were characterized with respect to static contact angle, surface energy, roughness, nanoscale adhesive force, nanoscale friction force, and thermal stability. The best overall anti...

  5. The Prevalence of Depression During Pregnancy and The Affecting Factors

    Directory of Open Access Journals (Sweden)

    Bahtisen Kartal

    2017-09-01

    Conclusion: As a result, it can be suggested that psychosocial follow-ups of pregnant women who are under risk of depression should be made regularly and they should be directed to appropriate counselling services. [J Contemp Med 2017; 7(3.000: 217-224

  6. From COBRA to the Seine, August 1944: A Microcosm of the Operational Art

    Science.gov (United States)

    1986-05-09

    while Patto , c,,rducted operational maneuvers in the German rear. Hill 217 was decisive t erra i r. The 2nd SS Piz Div reached almost to St.Hilaire by...with Eberbach as a r-eplacement for- vonr Funick. But the combined effects oif TOTALIZE, stiffening pressure at lortamii aria Patto -n’ 5 cuit north

  7. 77 FR 64409 - Designation of Taiwan for the Visa Waiver Program

    Science.gov (United States)

    2012-10-22

    ... of Man); it does not refer to British overseas citizens, British dependent territories' citizens, or...: 8 U.S.C. 1103, 1187; 8 CFR part 2. 0 2. In Sec. 217.2 the definition of the term ``Designated... Kingdom (England, Scotland, Wales, Northern Ireland, the Channel Islands and the Isle of Man); it does not...

  8. 75 FR 15991 - Designation of Greece for the Visa Waiver Program

    Science.gov (United States)

    2010-03-31

    ... Channel Islands and the Isle of Man); it does not refer to British overseas citizens, British dependent.... * * * * * 0 2. In section 217.2 the definition of the term ``Designated country'' in paragraph (a) is revised..., Northern Ireland, the Channel Islands and the Isle of Man); it does not refer to British overseas citizens...

  9. Dropout prediction in a public mental health intervention for sub-threshold and mild panic disorder

    NARCIS (Netherlands)

    Meulenbeek, Petrus Antonius Maria; Seeger, Kristin; ten Klooster, Peter M.

    2015-01-01

    Dropout is a common and serious problem in psychological research and practice. When participants terminate treatment prematurely, this may have methodological and clinical consequences. The aim of this study was to identify predictors of dropout in a sample of patients (N = 217) with sub-threshold

  10. Investigating the environmental adaptability of promising subtropical ...

    African Journals Online (AJOL)

    Trees were assessed for frost sensitivity at 15 months, and height and basal area at 48 months. Eucalyptus longirostrata, E. pilularis, Corymbia citriodora subsp. citriodora, C. henryi and C. maculata, species that performed well in forerunner ICFR coastal Zululand site-species trials (MAT range 21.7–21.9°C), generally ...

  11. Some new generalizations of Hardy's integral inequalities

    International Nuclear Information System (INIS)

    Oguntuase, James Adedayo

    2002-07-01

    In this paper, some new generalizations of Hardy's integral inequalities are obtained. These inequalities on the one hand generalize and on the other hand improve some existing results by Bicheng et al. [J. Math. Anal. Appl. 217(1998), 321-327]. (author)

  12. JUNE 2010.for Ogidi (final).cdr

    African Journals Online (AJOL)

    User

    and creatinine, urinalysis, liver function test and intravenous urography were normal. Apart from her packed cell volume of ... of epithelial ovarian tumours accounting for approximately 10-20% of these neoplasia . About 75 ... Heinemann Educational Books (Nig.) Plc;. 2006: 197-217. Benign and malignant ovarian masses.

  13. Ultrastructural characterization of RPA - containing domains in nuclei assembled in xenopus egg extracts

    Czech Academy of Sciences Publication Activity Database

    Eltsov, Michail; Grandi, P.; Raška, Ivan

    2000-01-01

    Roč. 129, - (2000), s. 211-217 ISSN 1047-8477 R&D Projects: GA ČR GA302/99/0587; GA ČR GA304/00/1481 Institutional research plan: CEZ:AV0Z5039906 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.255, year: 2000

  14. Climate change and cashew (Anacardium occidentale L ...

    African Journals Online (AJOL)

    217 RESULTS ... change effect on cashew productivity and to identify the adaptation ... Keywords: Adaptation strategies, Benin, cashew tree, climate change, ..... in the medium production area (Northwest) ... 75.9. 96.3. 89.7. 74.3. Widower. 24.1. 3.7. 7.7. 24.3. Origine. Native. 100 ..... a state of leaves plasmolysis unfavorable to.

  15. Dioscorea trifida L.

    African Journals Online (AJOL)

    SAM

    2014-04-09

    Apr 9, 2014 ... Oxidation reached a similar level on medium S, T and ZR (2.17 - 2.40) while it was only 1.63 on medium. EBR. Well-developed shoots were ... pathogens, both in the field and during tuber storage, and viruses can accumulate .... Our objective was to study if these changes in. PGR content in the recovery ...

  16. Wave Optical Calculation of Probe Size in Low Energy Scanning Electron Microscope

    Czech Academy of Sciences Publication Activity Database

    Radlička, Tomáš

    2015-01-01

    Roč. 21, S4 (2015), s. 212-217 ISSN 1431-9276 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscope * optical calculation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.730, year: 2015

  17. Referral for assisted reproductive technology: Indications and ...

    African Journals Online (AJOL)

    Ramakantb

    Over an 8-year period, 23 consenting infertile patients/ couples were given referral for assisted conception. The median age was 36 years and mean duration of infertility was 43 months. Indications for referral as shown in Table 1 were male factor in five (21.7%) patients, female factor in seven (30.4%) patients, and both ...

  18. Fertility Preservation for Children Diagnosed with Cancer

    Medline Plus

    Full Text Available ... from adult survivors of childhood cancer and their parents. Cancer Treat Res. 2007;138:201-217. Redig AJ, Brannigan R, Stryker SJ, et al. Incorporating fertility preservation into the care of young oncology patients. Cancer. 2010;117:4- ...

  19. 75 FR 64951 - Approval and Promulgation of Implementation Plans; Illinois; Voluntary Nitrogen Oxides Controls

    Science.gov (United States)

    2010-10-21

    ...: I. What action is EPA taking? II. Did anyone comment on the proposed disapproval of the state's SIP... Illinois' 35 Illinois Administrative Code (IAC), part 217, subpart X (the Subpart X rule). II. Did anyone.... Together, these problems led us to propose disapproval of the Subpart X rule as a revision to the Illinois...

  20. External morphological differences between Crepidostomum farionis and Crepidostomum metoecus (Trematoda: Allocreadiidae), parasites of salmonids, as revealed by SEM

    Czech Academy of Sciences Publication Activity Database

    Moravec, František

    2002-01-01

    Roč. 49, č. 3 (2002), s. 211-217 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : Trematoda * Crepidostomum * surface morphology Subject RIV: EG - Zoology Impact factor: 0.515, year: 2002

  1. Hydrocarbon Synthesis from Carbon Dioxide and Hydrogen: A Two-Step Process

    Science.gov (United States)

    2013-08-14

    gases, where flows were set by mass flow controllers (Sierra Instruments) at 100 sccm (25 sccm CO2, 75 sccm H2) with 10 sccm of nitrogen as an internal ...77, 315-323. (42) Vít, Z.; Šolcová, O. Microporous Mesoporous Mater. 2006, 96, 197-204. (43) Nicolaides, C. P. Appl. Catal., A 1999, 185, 211-217

  2. AcEST: BP920738 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LNL 2101 Query: 217 PKNRLR 234 PK + R Sbjct: 2102 PKIKSR 2107 >sp|B2C4J1|NCAP_CHAVB Nucleoprotein OS=Chapare virus (isolate Human/Bol...ivia/810419/2003) GN=N PE=3 SV=1 Length = 562 Score = 29

  3. Mise au point

    African Journals Online (AJOL)

    dont 1,96% de cas de rhinoplastie, 2,17%des cas de chi- ... total thyroidectomy and histological exam. nine-month treatment with anti- .... 5. Lecerf j.m. Les thyroïdites. La gazette méd 1993 ; 101 : 10-14. 6. el malki HO, mohsine r, Benkhraba k.

  4. Русский стих : метрика системы стихосложения, просодия (генеративный подход) / Михаил Лотман

    Index Scriptorium Estoniae

    Лотман, Михаил, 1952-

    2000-01-01

    Russian verse: its metrics, versification systems, and prosody (generative synopsis). Lk. 217-218 ; Vene värss: meetrika, värsisüsteemid ja prosoodika (generatiivne ülevaade). Lk. 241. Üldisest värsimõõduteooriast ja selle rakendamisest vene värsile

  5. Early development and growth of sterlet (Acipenser ruthenus) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rybnikár, J.; Prokeš, Miroslav; Mareš, J.; Cileček, M.

    2011-01-01

    Roč. 59, č. 5 (2011), s. 217-225 ISSN 1211-8516 R&D Projects: GA MZe QH71305 Institutional research plan: CEZ:AV0Z60930519 Keywords : early ontogeny * specific growth rate * length-weight relationship * factor of weight condition Subject RIV: GL - Fishing http://www.mendelu.cz/dok_server/slozka.pl?id=51329;download=82072

  6. Personal ways of handling everyday life

    DEFF Research Database (Denmark)

    Jensen, Lasse Meinert

    at variations in everyday life pursuits:  How does a person's pursuit of goals and concerns lead him/her to experience and handle breaks, interruptions, and variation in everyday activities?  The research project so far holds quantitative data.  A convenient sample of 217 persons were administered...

  7. Single Neurosurgeon Operative Experience at Craig Joint Theater Hospital During the Afghanistan Surge (November 2010 to April 2011), Part II: Humanitarian Cases.

    Science.gov (United States)

    Steele, John Joseph

    2017-01-01

    The Afghanistan Surge saw NATO troops working with their Afghan partners to remove Taliban governance and replace it with a more democratic model. As part of this endeavor, medical support for both trauma and humanitarian cases was needed. Identify and discuss disease trends to better prepare for future combat medical treatments. Retrospective review of operative experience from a neurosurgeon from November 2010 to April 2011. 63 cases were performed on 20 NATO and 43 Afghan patients. Combat-related neurotrauma represented 73% (46/63) of cases and humanitarian cases represented the remainder. The most common diseases among humanitarian cases were benign tumors (29%, 5/17), cranioplasty (23%, 4/17), obstructive hydrocephalus (11%, 2/17), nonobstructive hydrocephalus (11%, 2/17), hemifacial spasm (11%, 2/17), and cerebral angiography (11%, 2/17). There was 1 death from ventriculitis for a complication rate of 6%. In select well-nourished, patients with minimal risk of needing tracheostomy, humanitarian neurosurgery can be safely performed in theater with a complication rate (6%) no worse than patients operated on in the United States. Reprint & Copyright © 2017 Association of Military Surgeons of the U.S.

  8. A Ghosh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A Ghosh. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 217-220 Synthesis. Effect of sillimanite beach sand composition on mullitization and properties of Al2O3–SiO2 system · H S Tripathi B Mukherjee S K Das A Ghosh G Banerjee.

  9. Regulatory ecotoxicity testing of nanomaterials – proposed modifications of OECD test guidelines based on laboratory experience with silver and titanium dioxide nanoparticles

    DEFF Research Database (Denmark)

    Hund-Rinke, Kerstin; Baun, Anders; Cupi, Denisa

    2016-01-01

    of the sediment-living worm Lumbriculus variegatus (TG 225), activity of soil microflora (TGs 216, 217), and reproduction of the invertebrates (Enchytraeus crypticus, Eisenia fetida, TGs 220, 222). Additionally, test descriptions for two further test systems (root elongation of plants in hydroponic culture; test...

  10. Bond behavior of reinforcing steel in ultra-high performance concrete.

    Science.gov (United States)

    2014-10-01

    Ultra-High Performance Concrete (UHPC) is a relatively new class of advanced cementitious composite : materials, which exhibits high compressive [above 21.7 ksi (150 MPa)] and tensile [above 0.72 ksi (5 MPa)] : strengths. The discrete steel fiber rei...

  11. 77 FR 5026 - Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review

    Science.gov (United States)

    2012-02-01

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review The meeting... SEP: Occupational Safety and Health Education and Research Centers, PAR 10-217. Contact Person For...

  12. 2015-2016 Travel and Hospitality Expense Reports for Jean Lebel ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    14. Destination(s):. Montreal. Airfare: $0.00. Other. Transportation: $217.23. Accommodation: $200.34. Meals and. Incidentals: $89.25. Other: $0.00. Total: $506.82. Comments: In connection with meeting on Grand Challenges in health.

  13. Long-term mannitol-induced osmotic stress leads to stomatal ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-13

    Sep 13, 2010 ... elasticity and solute adjustment in two Acacia nilotica subspecies. Physiol. Plant, 93: 217-224. Navarro A, Banon S, Olmos E, Sahchez-Blanco MJ (2007). Effect of sodium chloride on water potential components, hydraulic conductivity, gas exchange and leaf ultrastructure of Arbutus unedo plants. Plant Sci.

  14. Four new polypore species from the western United States

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Vlasák, J.; Ryvarden, L.

    2012-01-01

    Roč. 119, January (2012), s. 217-231 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Institutional support: RVO:60077344 Keywords : Hymenochaetaceae * Phellinus * ribosomal DNA Subject RIV: EF - Botanics Impact factor: 0.821, year: 2012

  15. Genetic variation of Phoma sorghina isolates from southern Africa and Texas

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie

    2009-01-01

    Roč. 54, č. 3 (2009), s. 217-229 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : phoma sorghina * phytopathogen * originating Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

  16. Komplikationer til langtidsbehandling med vitamin K-antagonister

    DEFF Research Database (Denmark)

    May, O; Garne, E; Mickley, H

    1990-01-01

    Long-term treatment with vitamin K antagonists (vKA) frequently involves complications. The commonest complication is haemorrhage and cases of serious haemorrhage are stated in the literature to occur with a frequency per 1,000 treatment years of 12-108, of which 2-17 are fatal. The majority...

  17. 40 CFR 81.409 - Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Hawaii. 81.409 Section 81.409... Visibility Is an Important Value § 81.409 Hawaii. Area name Acreage Public Law establishing Federal land manager Haleakala NP 27,208 87-744 USDI-NPS Hawaii Volcanoes 217,029 64-171 USDI-NPS ...

  18. 48 CFR 917.7403 - Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application. 917.7403 Section 917.7403 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACTING METHODS AND... Application. The clause at 48 CFR 952.217-70 shall be included in contracts or modifications where contractor...

  19. Comparison of Qinzhou bay wetland landscape information extraction by three methods

    Directory of Open Access Journals (Sweden)

    X. Chang

    2014-04-01

    and OO is 219 km2, 193.70 km2, 217.40 km2 respectively. The result indicates that SC is in the f irst place, followed by OO approach, and the third DT method when used to extract Qingzhou Bay coastal wetland.

  20. Comparison of chloroquine with artesunate in the treatment of cerebral malaria in Ghanaian children

    DEFF Research Database (Denmark)

    Goka, B Q; Adabayeri, V; Ofori-Adjei, E

    2001-01-01

    and neurological deficits were documented. There was no difference in mortality rates (chloroquine, 16.7 per cent; artesunate, 21.7 per cent; p = 0.6), neurological deficit at day 14 (chloroquine, 0 per cent; artesunate, 4.3 per cent; p = 0.3), resolution of fever (p = 0.55), and coma recovery time (p = 0...

  1. DMPD: Translational mini-review series on Toll-like receptors: recent advances inunderstanding the role of Toll-like receptors in anti-viral immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 17223961 Translational mini-review series on Toll-like receptors: recent advances i...147(2):217-26. (.png) (.svg) (.html) (.csml) Show Translational mini-review series on Toll-like receptors: r...nity. PubmedID 17223961 Title Translational mini-review series on Toll-like receptors: recent advances inund

  2. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R; Noronha, R; Fondekar, S.P.; SenGupta, R

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  3. Deromancing leadership: what are the behaviours of highly effective middle managers?

    NARCIS (Netherlands)

    van der Weide, J.G.; Wilderom, Celeste P.M.

    2004-01-01

    Title: Deromancing leadership: what are the behaviours of highly effective middle managers? Author: Joost Van der Weide, Celeste Wilderom Address: University of Twente, Department of Management and Organizational Behaviour, P.O. Box 217, 7500 AE Enschede, The Netherlands. ' University of Twente,

  4. Lidský potenciál jako psychologický konstrukt

    Czech Academy of Sciences Publication Activity Database

    Mudrák, J.; Zábrodská, Kateřina

    2013-01-01

    Roč. 57, č. 3 (2013), s. 201-217 ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional support: RVO:68081740 Keywords : learning * motivation * giftedness Subject RIV: AN - Psychology Impact factor: 0.292, year: 2013

  5. Developmental Surveillance and Screening Practices by Pediatric Primary Care Providers: Implications for Early Intervention Professionals

    Science.gov (United States)

    Porter, Sallie; Qureshi, Rubab; Caldwell, Barbara Ann; Echevarria, Mercedes; Dubbs, William B.; Sullivan, Margaret W.

    2016-01-01

    This study used a survey approach to investigate current developmental surveillance and developmental screening practices by pediatric primary care providers in a diverse New Jersey county. A total of 217 providers were contacted with a final sample size of 57 pediatric primary care respondents from 13 different municipalities. Most providers…

  6. Occurrence of indoor wood decay basidiomycetes in Europe

    Czech Academy of Sciences Publication Activity Database

    Gabriel, Jiří; Švec, Karel

    2017-01-01

    Roč. 31, č. 4 (2017), s. 212-217 ISSN 1749-4613 R&D Projects: GA ČR(CZ) GA17-05497S Institutional support: RVO:61388971 Keywords : Basidiomycetes * Fungi * Serpula lacrymans Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.231, year: 2016

  7. Studies in the Antrodia serialis group (Polyporales, Basidiomycota)

    Czech Academy of Sciences Publication Activity Database

    Spirin, V.; Vlasák, Josef; Miettinen, O.

    2017-01-01

    Roč. 109, č. 2 (2017), s. 217-230 ISSN 0027-5514 Institutional support: RVO:60077344 Keywords : fungi * Brown-rot fungi * phylogeny * taxonomy Subject RIV: EF - Botanics OBOR OECD: Mycology Impact factor: 2.550, year: 2016

  8. Quantum strips on surfaces

    Czech Academy of Sciences Publication Activity Database

    Krejčiřík, David

    2003-01-01

    Roč. 45, 1/2 (2003), s. 203-217 ISSN 0393-0440 R&D Projects: GA AV ČR IAA1048101 Institutional research plan: CEZ:AV0Z1048901 Keywords : bound states 292 wave-fuides * mechanics Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.105, year: 2003

  9. Progress in research of intellectual disability caused by genetic disorders: experimental treatments for the fragile X syndrome

    Directory of Open Access Journals (Sweden)

    Yolanda de Diego Otero

    2017-06-01

    Full Text Available De Diego Otero, Y. et al. (2017: “Avances en investigación de la discapacidad intelectual de origen genético: tratamientos experimentales en el síndrome X frágil”. Revista Española de Discapacidad, 5 (I: 217-227.

  10. 77 FR 73662 - Disease, Disability, and Injury Prevention and Control Special Emphasis Panel (SEP): Initial Review

    Science.gov (United States)

    2012-12-11

    ... announced below concerns Occupational Safety and Health Education and Research Centers (ERC) PAR 10-217... evaluation of applications received in response to ``Occupational Safety and Health Education and Research... Officer, CDC/NIOSH, 626 Cochrans Mill Road, Mailstop P-05, Pittsburgh, Pennsylvania 15236, Telephone: (412...

  11. 78 FR 27310 - Airworthiness Directives; the Boeing Company Airplanes

    Science.gov (United States)

    2013-05-10

    ... wiring; installation of new circuit breakers, relays, relay connectors, and wiring; and replacement of... Installation of wiring and changing 36 work-hours x $85 per $2,503 $5,563 $328,217 ELMS panel wiring. hour = $3... flames in the passenger cabin of various transport category airplanes related to the wiring for the...

  12. Déficit en la asistencia médica farmacológica y de seguimiento en el tratamiento del tabaquismo en México

    Directory of Open Access Journals (Sweden)

    Raúl H. Sansores

    2016-12-01

    Full Text Available El tabaquismo es una adicción que causa la muerte prema­tura de la mitad de sus consumidores. Con una prevalencia de hasta 21.7% y 60 000 muertes atribuibles en Mé­xico en 2010, se puede entender por qué el tabaquismo es un serio pro­blema de salud…

  13. Involvement of LCA5 in Leber congenital amaurosis and retinitis pigmentosa in the Spanish population

    NARCIS (Netherlands)

    Corton, M.; Avila-Fernandez, A.; Vallespin, E.; Lopez-Molina, M.I.; Almoguera, B.; Martin-Garrido, E.; Tatu, S.D.; Khan, M.I.; Blanco-Kelly, F.; Riveiro-Alvarez, R.; Brion, M.; Garcia-Sandoval, B.; Cremers, F.P.M.; Carracedo, A.; Ayuso, C.

    2014-01-01

    OBJECTIVE: We aimed to identify novel genetic defects in the LCA5 gene underlying Leber congenital amaurosis (LCA) in the Spanish population and to describe the associated phenotype. DESIGN: Case series. PARTICIPANTS: A cohort of 217 unrelated Spanish families affected by autosomal recessive or

  14. Challenges to Early Childhood Education in Rural China: Lessons from the Hebei Province

    Science.gov (United States)

    Hu, Bi Ying; Roberts, Sherron Killingsworth; Leng Ieong, Sylvia Sao; Guo, Haiying

    2016-01-01

    This research study examined the challenges faced by early childhood education (ECE) in rural China based on a qualitative study of 217 kindergarten classrooms in a large agricultural, rural province. This study utilised onsite teacher surveys, interviews, and observational field notes. This investigation's findings revealed important information…

  15. A colourful university life? Transnational higher education and the spatial dimensions of institutional social capital in Hong Kong

    NARCIS (Netherlands)

    Waters, J.; Leung, W.H.M.

    2013-01-01

    Transnational higher education represents a lesser-known aspect of the international education industry. In relation to the UK, transnational education is a booming business. British qualifications are offered in 217 countries outside the UK, representing in excess of 388,000 students in

  16. Asymbiotic seed germination and in vitro propagation of ...

    African Journals Online (AJOL)

    Joe Krawczyszyn

    2015-10-13

    Oct 13, 2015 ... Christenson. Plant Growth Regul. 65:381-387. Knudson L (1946). A new nutrient solution for the germination of orchid seed. Am. Orchid Soc. Bull. 14:214-217. Lloyd G, MCCown B (1980). Commercially-feasible micropropagation of mountain laurel, Kalmia latifolia, by use of shoot-tip culture. Int. Plant. Prop.

  17. Livelihood Diversification Sources of Female Household Heads in ...

    African Journals Online (AJOL)

    Majority (65.8%) of FHH did not have external sources of financial assistance while 21.7% were supported by their children. The study concluded that livelihoods of FHH were diversified mainly within agriculture and trading enterprises. Key words: Livelihood diversification, Female household heads, Rural communities.

  18. The Differential Contribution of Maternal and Paternal Values to Social Competence of Preschoolers

    Science.gov (United States)

    Bigras, Marc; Crepaldi, Maria Aparecida

    2013-01-01

    Multivariate analyses were conducted to clarify the nature of the influences of parental values on social behaviours of kindergarteners in the context of socio-demographic variables and sex of participants. This study included 217 mothers and 172 fathers from the same families, who completed a socio-demographic questionnaire and a new Q-sort that…

  19. Lectures in Complex Systems (1991)

    Science.gov (United States)

    1992-08-05

    of Development and Aging of the Nervous System, edited by J. M. Lauder , 217-225. New York: Plenum Press, 1990. 88. Keller, E. F. A Feeling for the...not every player wins an infinite amount of money just because the expected winning is infinite. The perception of this paradox in the 1700s was to cast

  20. Isothermal Vapour-Liquid Equilibrium in the Binary tert-Butanol or 2,2,4-Trimethylpentane + 1-tert-Butoxy-2-Propanol, and in the Ternary tert-Butanol + 2,2,4-Trimethylpentane + 1-tert-Butoxy-2-Propanol Systems

    Czech Academy of Sciences Publication Activity Database

    Bernatová, Svatoslava; Wichterle, Ivan

    2001-01-01

    Roč. 189, 1-2 (2001), s. 111-118 ISSN 0378-3812 R&D Projects: GA ČR GA104/99/0136 Institutional research plan: CEZ:AV0Z4072921 Keywords : vapour-liquid equilibrium * experimental data * molar excess volume Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001

  1. Isothermal Vapour-Liquid Equilibria in the Ternary System tert-Butyl Methyl Ether + tert-Butanol + 2,2,4-Trimethylpentane and the Three Binary Subsystems

    Czech Academy of Sciences Publication Activity Database

    Bernatová, Svatoslava; Wichterle, Ivan

    2001-01-01

    Roč. 180, 1-2 (2001), s. 235-245 ISSN 0378-3812 R&D Projects: GA ČR GA104/99/0136 Institutional research plan: CEZ:AV0Z4072921 Keywords : vapourůliquid equilibrium * experimental data * molar excess volume Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001

  2. Hyperfine splitting in positronium to O(α7me). One-photon annihilation contribution

    International Nuclear Information System (INIS)

    Baker, M.; Penin, A.A.; Karlsruher Institut fuer Technologie; Piclum, J.; RWTH Aachen; Steinhauser, M.

    2014-02-01

    We present the complete result for the O(α 7 m e ) one-photon annihilation contribution to the hyperfine splitting of the ground state energy levels in positronium. Numerically it increases the prediction of quantum electrodynamics by 217±1 kHz.

  3. Metastatic breast cancer - age has a significant effect on survival ...

    African Journals Online (AJOL)

    The data on 217 elderly (aged ≥ 65 years) and 209 middleaged postmenopausal patients with metastatic breast cancer treated in the Department of Medical Oncology, University of Pretoria, from 1976 to 1985 were analysed to determine the effect of age on survival. When considered as a group, the elderly have a more ...

  4. 48 CFR 970.1706-2 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 970.1706... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Special Contracting Methods 970.1706-2 Contract clause. The contracting officer shall insert the clause at 48 CFR 52.217-9, Option to Extend the Term of...

  5. A Study of How We Study: Methodologies of School Library Research 2007 through July 2015

    Science.gov (United States)

    Morris, Rebecca J.; Cahill, Maria

    2017-01-01

    In this study we investigated the research designs employed to study the interdisciplinary profession of school librarianship during a time period of notable changes across both the Pre-K-12 and school library domains. To conduct this work, we analyzed all 217 articles published in "School Library Research" (SLR) and "School…

  6. Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31

    Czech Academy of Sciences Publication Activity Database

    Lahoda, M.; Mesters, J. R.; Stsiapanava, A.; Chaloupková, R.; Kutý, Michal; Damborský, J.; Kutá-Smatanová, Ivana

    2014-01-01

    Roč. 70, FEB 2014 (2014), s. 209-217 ISSN 0907-4449 Institutional support: RVO:67179843 Keywords : DhaA31 * substrate-free * 3rk4 * complex with TCP * 4fwb * wild-type DhaA * 4hzg Subject RIV: CE - Biochemistry Impact factor: 7.232, year: 2013

  7. Evaluation of the Cepheid Xpert MTB/RIF assay for direct detection of Mycobacterium tuberculosis complex in respiratory specimens.

    Science.gov (United States)

    Marlowe, Elizabeth M; Novak-Weekley, Susan M; Cumpio, Joven; Sharp, Susan E; Momeny, Michelle A; Babst, Anna; Carlson, Jonathan S; Kawamura, Masae; Pandori, Mark

    2011-04-01

    A total of 217 specimens submitted for routine smear and culture from three different sites within the western United States were used to evaluate the GeneXpert MTB/RIF assay (for research use only) (Cepheid, Sunnyvale, CA). Overall agreement compared to culture was 89% (98% for smear positives and 72% for smear negatives) for detection of Mycobacterium tuberculosis.

  8. Evaluation of the Cepheid Xpert MTB/RIF Assay for Direct Detection of Mycobacterium tuberculosis Complex in Respiratory Specimens▿

    Science.gov (United States)

    Marlowe, Elizabeth M.; Novak-Weekley, Susan M.; Cumpio, Joven; Sharp, Susan E.; Momeny, Michelle A.; Babst, Anna; Carlson, Jonathan S.; Kawamura, Masae; Pandori, Mark

    2011-01-01

    A total of 217 specimens submitted for routine smear and culture from three different sites within the western United States were used to evaluate the GeneXpert MTB/RIF assay (for research use only) (Cepheid, Sunnyvale, CA). Overall agreement compared to culture was 89% (98% for smear positives and 72% for smear negatives) for detection of Mycobacterium tuberculosis. PMID:21289151

  9. 76 FR 82031 - Public Notice for Waiver of Aeronautical Land-use Assurance; DuPage Airport, West Chicago, IL

    Science.gov (United States)

    2011-12-29

    ... retained by the DAA. Parcel A includes portions of Parcels 209A (SOUTH OF THE Union Pacific Railroad, 231 (south of the Union Pacific Railroad) and all of Parcels 217, 218, 219, 220, 221, 314 and 315 as per the... AT THE FOUND CAST IRON MONUMENT MARKING THE WEST QUARTER CORNER OF SAID SECTION 18, PER DOCUMENT NO...

  10. Medical Journal of Zambia - Vol 44, No 4 (2017)

    African Journals Online (AJOL)

    Pancreatic cancer: Patterns in a low- to middle- income Ppopulation, Zambia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A.W. Asombang, R. Madsen, M. Simuyandi, G. Phiri, M. Bechtold, J.A. Ibdah, K. Lishimpi, L. Banda, 212-217 ...

  11. Prenatal risk factors influencing childhood BMI and overweight independent of birth weight and infancy BMI - a path analysis within the Danish National Birth Cohort

    DEFF Research Database (Denmark)

    Morgen, Camilla Schmidt; Ängquist, Lars; Lynn Baker, Jennifer

    2018-01-01

    BACKGROUND AND OBJECTIVES: Prenatal risk factors for childhood overweight may operate indirectly through development in body size in early life and/or directly independent hereof. We quantified the effects of maternal and paternal body mass index (BMI), maternal age, socioeconomic position (SEP),...... of Obesity advance online publication, 31 October 2017; doi:10.1038/ijo.2017.217....

  12. Managing urban parks for a racially and ethnically diverse clientele

    Science.gov (United States)

    Paul H. Gobster

    2002-01-01

    A major planning effort for Chicago's largest park provided an opprotunity yto examine outdoor recreation use patterns and preferences among a racially and ethnically diverse clientele. Results from on-site surveys of 898 park users (217 Black, 210 Latino, 182 Asian, and 289 White) showed that park users shared a core set of interests, preferences, and concerns...

  13. The Intergenerational Congruence of Mothers' and Preschoolers' Narrative Affective Content and Narrative Coherence

    Science.gov (United States)

    Sher-Censor, Efrat; Grey, Izabela; Yates, Tuppett M.

    2013-01-01

    Intergenerational congruence of mothers' and preschoolers' narratives about the mother-child relationship was examined in a sample of 198 Hispanic (59.1%), Black (19.2%), and White (21.7%) mothers and their preschool child. Mothers' narratives were obtained with the Five Minute Speech Sample and were coded for negative and positive affective…

  14. Exercising with Passion: Initial Validation of the Passion Scale in Exercise

    Science.gov (United States)

    Parastatidou, Irini S.; Doganis, Georgios; Theodorakis, Yannis; Vlachopoulos, Symeon P.

    2012-01-01

    The purpose of the researchers in the study was to psychometrically evaluate Passion Scale scores (Vallerand et al., 2003) in exercise. Self-report data were collected from two samples of Greek exercise participants. Sample 1 (n = 217) provided data on the Passion Scale and the self-determination theory variables of perceived autonomy support by…

  15. 49 CFR 218.22 - Utility employee.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Utility employee. 218.22 Section 218.22... employee. (a) A utility employee shall be subject to the Hours of Service Act, and the requirements for... parts 217, 219, and 228 of this chapter. (b) A utility employee shall perform service as a member of...

  16. Taraxacum koksaghyz Rodin definitely is not an example of overcollecting in the past. A reply to S. Volis et al. (2009)

    Czech Academy of Sciences Publication Activity Database

    van Dijk, P.; Kirschner, Jan; Štěpánek, Jan; Baitulin, I. O.; Černý, Tomáš

    2010-01-01

    Roč. 83, č. 2 (2010), s. 217-219 ISSN 1613-9216 R&D Projects: GA MŠk 7E09053 Institutional research plan: CEZ:AV0Z60050516 Keywords : Taraxacum * species * overcollecting Subject RIV: EF - Bot anics Impact factor: 0.391, year: 2010

  17. Crayfish in Czech cultural space: the longest documented relationship between humans and crayfish in Europe

    Czech Academy of Sciences Publication Activity Database

    Patoka, J.; Kocánová, Barbora; Kalous, L.

    2016-01-01

    Roč. 417, č. 5 (2016), s. 1-9 ISSN 1961-9502 Institutional support: RVO:67985955 Keywords : Freshwater invertebrate * exploitation * history * aquaculture * Czech Republic Subject RIV: AB - History Impact factor: 1.217, year: 2016 https://www.kmae-journal.org/articles/kmae/full_html/2016/01/kmae150112/kmae150112.html

  18. Planck early results. XIII. Statistical properties of extragalactic radio sources in the Planck Early Release Compact Source Catalogue

    DEFF Research Database (Denmark)

    Lähteenmäki, A.; Poutanen, T.; Natoli, P.

    2011-01-01

    The data reported in Planck's Early Release Compact Source Catalogue (ERCSC) are exploited to measure the number counts (dN/dS) of extragalactic radio sources at 30, 44, 70, 100, 143 and 217 GHz. Due to the full-sky nature of the catalogue, this measurement extends to the rarest and brightest sou...

  19. Deteriorated Concrete from Liner of WIPP Waste Shaft

    Science.gov (United States)

    1992-06-01

    for US Department of Energy. Bensted, J. 1989. "Novel Cements - Sorel and Related Chemical Cements," il Cemento , Vol 86, No. 4, pp 217-228. Ben-Yair, M...Waste Isolation Pilot Plant. Massazza, F. 1985. "Concrete Resistance to Sea Water and Marine Environment," il Cemento , Vol 82, No. 1, pp 3-26. Mather

  20. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

  1. Planck 2013 results. XXX. Cosmic infrared background measurements and implications for star formation

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

    2014-01-01

    We present new measurements of cosmic infrared background (CIB) anisotropies using Planck. Combining HFI data with IRAS, the angular auto-and cross-frequency power spectrum is measured from 143 to 3000 GHz, and the auto-bispectrum from 217 to 545 GHz. The total areas used to compute the CIB power...

  2. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Deepak Nandi. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 2 February 2018 pp 197-217 General Article. Thymus: The site for Development of Cellular Immunity · Shamik Majumdar Sanomy Pathak Deepak Nandi · More Details ...

  3. Tropical Veterinarian - Vol 20, No 4 (2002)

    African Journals Online (AJOL)

    Effect of organic contrast Media on the haematology and Serum Electrolytes in Xylazine Sedated Dogs · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RA Ajadi, O Ighalo, B Sarumoh, 209-217. http://dx.doi.org/10.4314/tv.v20i4.4486 ...

  4. 77 FR 44475 - Security Zones; Seattle's Seafair Fleet Week Moving Vessels, Puget Sound, WA

    Science.gov (United States)

    2012-07-30

    ...-AA87 Security Zones; Seattle's Seafair Fleet Week Moving Vessels, Puget Sound, WA AGENCY: Coast Guard... temporary rule, call or email Lieutenant Junior Grade Anthony P. LaBoy, Sector Puget Sound, Waterways Management Division, U.S. Coast Guard; telephone 206-217-6323, email SectorPugetSound[email protected] . If you...

  5. Atorvastatin affects low density lipoprotein and non-high density lipoprotein cholesterol relations with apolipoprotein B in type 2 diabetes mellitus : modification by triglycerides and cholesteryl ester transfer protein

    NARCIS (Netherlands)

    Kappelle, Paul J.W.H.; Zwang, Louwerens; Huisman, Menno V.; Banga, Jan Dirk; Sluiter, Wim. J.; Dallinga-Thie, Geesje M.; Dullaart, Robin P. F.

    Objectives: Non-HDL-cholesterol (non-HDL-C) and apolipoprotein (apo) B are proposed as treatment targets. The extent to which statin therapy affects relationships of LDL-C and non-HDL-C with apoB was examined in type 2 diabetes. Methods: Analyses were performed in 217 hypertriglyceridaemic type 2

  6. KAPPA: A Package for Synthesis of Optically Thin Spectra for the Non-Maxwellian kappa-distributions Based on the Chianti Database

    Czech Academy of Sciences Publication Activity Database

    Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena

    2015-01-01

    Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015

  7. WTO Dispute Settlement: Status of U.S. Compliance in Pending Cases

    Science.gov (United States)

    2010-01-29

    have rejected Charming Betsy arguments and (...continued) Jane A. Restani & Ira Bloom ...complaints were filed: DS217, filed jointly by Australia, Brazil, Chile , the European Union (EU), India, Indonesia, Japan, Korea and Thailand, and DS234...Members—Brazil, Chile , EU, India, Japan, Korea, Canada, and Mexico—asked the WTO in January 2004 for authorization to impose retaliatory measures.93

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Challenges in the Quest for Clean Energies - Background. Sheela K Ramasesha. Series Article Volume 18 Issue 3 March 2013 pp 206-217. Fulltext. Click here to view fulltext PDF. Permanent link:

  9. AcEST: DK957672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available te aldolase OS=Sesuvium portulacastrum GN=FBA PE=2 SV=1 Length = 357 Score = 363 bits (932), Expect = 5e-99 ...AA YKAL+DHHV Sbjct: 181 IVEPEILVDGPHDIDRCAEVTERVLAACYKALNDHHV 217 >tr|B5B3T4|B5B3T4_SESPO Fructose-biphospha

  10. Od Szczecina do Cieszyna, czyli I Kongres Czechoznawstwa Polskiego

    Czech Academy of Sciences Publication Activity Database

    Baron, Roman

    2017-01-01

    Roč. 23, 2(217) (2017), s. 34-36 ISSN 1425-798X Institutional support: RVO:67985963 Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  11. Coprime solutions to ax = b (mod n)

    Czech Academy of Sciences Publication Activity Database

    Grošek, O.; Porubský, Štefan

    2013-01-01

    Roč. 7, č. 3 (2013), s. 217-224 ISSN 1862-2984 R&D Projects: GA ČR(CZ) GAP201/12/2351 Institutional support: RVO:67985807 Keywords : coprime solutions * random linear congruences Subject RIV: BA - General Mathematics

  12. 78 FR 7458 - Petitions for Modification of Application of Existing Mandatory Safety Standards

    Science.gov (United States)

    2013-02-01

    .... Petitioner: Sterling Mining Corporation, P.O. Box 217, North Lima, Ohio 44452. Mines: Shean Hill, MSHA I.D... outlets and valves. 6. Due to the thin coal seam and low mining height, the pipes placed along the roof... Granules (Ione) LLC, 1101 Opal Court, Suite 315, Hagerstown, Maryland 21740. Mine: Ione Mine, MSHA I.D. No...

  13. 40 CFR 408.31 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  14. 40 CFR 408.101 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... shall apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  15. 40 CFR 408.91 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  16. 40 CFR 408.121 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall mean the raw material, including freshwater and saltwater...

  17. 40 CFR 408.51 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  18. 40 CFR 408.11 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  19. 40 CFR 408.21 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  20. 40 CFR 408.141 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  1. 40 CFR 408.41 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... shall apply to this subpart. (b) The term oil and grease shall mean those components of a waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c) The term seafood shall...

  2. The Effect of Type and Concentration of Modifier in Supercritical Carbon Dioxide on Crystallization of Nanocrystalline Titania Thin Films.

    Czech Academy of Sciences Publication Activity Database

    Sajfrtová, Marie; Cerhová, Marie; Jandová, Věra; Dřínek, Vladislav; Daniš, E.; Matějová, L.

    2018-01-01

    Roč. 133, MAR 2018 (2018), s. 211-217 ISSN 0896-8446 R&D Projects: GA ČR GA14-23274S Institutional support: RVO:67985858 Keywords : titania thin film * supercritical carbon dioxide * crystallization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.991, year: 2016

  3. Sensitivity of European wheat to extreme weather

    Czech Academy of Sciences Publication Activity Database

    Mäkinen, H.; Kaseva, J.; Trnka, Miroslav; Balek, Jan; Kersebaum, K. C.; Nendel, C.; Gobin, A.; Olesen, J. E.; Bindi, M.; Ferrise, R.; Moriondo, M.; Rodríguez, A.; Ruiz-Ramos, M.; Takáč, J.; Bezák, P.; Ventrella, D.; Ruget, F.; Capellades, G.; Kahiluoto, H.

    2018-01-01

    Roč. 222, jun (2018), s. 209-217 ISSN 0378-4290 R&D Projects: GA MŠk(CZ) LO1415; GA MZe(CZ) QJ1610072 Institutional support: RVO:86652079 Keywords : Climate change * Cultivar * European wheat * Extreme * Weather * Yield response Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.048, year: 2016

  4. Four Saccharomyces species differ in their tolerance to various stresses though they have similar basic physiological parameters

    Czech Academy of Sciences Publication Activity Database

    Zemančíková, Jana; Kodedová, Marie; Papoušková, Klára; Sychrová, Hana

    2018-01-01

    Roč. 63, č. 2 (2018), s. 217-227 ISSN 0015-5632 R&D Projects: GA ČR(CZ) GA15-03708S Institutional support: RVO:67985823 Keywords : saccharomyces * stress tolerance * intracellular pH * membrane potential Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.521, year: 2016

  5. The diet of reservoir perch before, during and after establishment of non-native tubenose goby

    Czech Academy of Sciences Publication Activity Database

    Všetičková, Lucie; Mikl, Libor; Adámek, Zdeněk; Prášek, Václav; Roche, Kevin Francis; Jurajda, Pavel

    2018-01-01

    Roč. 419, č. 419 (2018), č. článku 4. ISSN 1961-9502 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : dietary shift * food preference * Gobiidae * invasive species * Perca fluviatilis * piscivore diet Subject RIV: EG - Zoology Impact factor: 1.217, year: 2016

  6. Courtland Target Assembly Facility Environmental Assessment

    Science.gov (United States)

    2006-10-01

    Draft Environmental Assessment 2-17 tributyl phosphate (TBP)6, diatomaceous earth, talcum powder, cornmeal , water, steel, and plastic. 2.2.2... cornmeal , water, steel, and plastic that would not qualify as hazardous materials. TBP is non-explosive, non-flammable, and stable under normal

  7. Frýdlantsko a Liberecko v období baroka. Gallasovská architektura a umělci

    Czech Academy of Sciences Publication Activity Database

    Krummholz, Martin

    2016-01-01

    Roč. 17, č. 1 (2016), s. 2-17 ISSN 1213-5097 Institutional support: RVO:68378033 Keywords : architecture * religious architecture * nobility * Hejnice * Frýdlant * Liberec * Gallas family * Clam-Gallas family Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Production and identification of new, neutron-rich nuclei in the {sup 208}Pb region

    Energy Technology Data Exchange (ETDEWEB)

    Rykaczewski, K. [Oak Ridge National Lab., TN (United States). Physics Div.]|[ISOLDE-CERN, Geneva (Switzerland)]|[Univ. of Warsaw (Poland); Kurpeta, J.; Plochocki, A. [Univ. of Warsaw (Poland)] [and others

    1998-11-01

    The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic {sup 208}Pb are briefly described. An identification of new neutron-rich isotopes {sup 215}Pb and {sup 217}Bi, and new decay properties of {sup 216}Bi studied by means of a pulsed release element selective technique at PS Booster-ISOLDE are reported.

  9. Assessing the Impact of In-Service Training on Staff Performance at ...

    African Journals Online (AJOL)

    performance in terms of knowledge and skills gained. It was recommended that more research is undertaken on all UEW campuses to add to both literature and knowledge of INSET. Keywords: Staff Performance, In-Service Training, Staff Development International Journal of Educational Research Vol. 3 (2) 2007 pp. 217- ...

  10. 40 CFR 413.14 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... management plan approved by the control authority. (Secs. 301, 304, 306, 307, 308, and 501 of the Clean Water...) EFFLUENT GUIDELINES AND STANDARDS ELECTROPLATING POINT SOURCE CATEGORY Electroplating of Common Metals... by the Clean Water Act of 1977, Pub. L. 95-217)) [46 FR 9467, Jan. 28, 1981; 46 FR 30626, June 10...

  11. 40 CFR 413.24 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... management plan approved by the control authority. (Secs. 301, 304, 306, 307, 308, and 501 of the Clean Water...) EFFLUENT GUIDELINES AND STANDARDS ELECTROPLATING POINT SOURCE CATEGORY Electroplating of Precious Metals... by the Clean Water Act of 1977, Pub. L. 95-217)) [46 FR 9467, Jan. 28, 1981, as amended at 48 FR...

  12. Instrument platforms for nano liquid chromatography

    Czech Academy of Sciences Publication Activity Database

    Šesták, Jozef; Moravcová, Dana; Kahle, Vladislav

    2015-01-01

    Roč. 1421, NOV (2015), s. 2-17 ISSN 0021-9673 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : nano liquid chromatography * splitless gradient generation * nano LC platforms Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015 http://hdl.handle.net/11104/0250900

  13. 75 FR 28245 - Massachusetts Marine Sanitation Device Standard-Receipt of Petition

    Science.gov (United States)

    2010-05-20

    .... Environmental Protection Agency, pursuant to Section 312(f)(3) of Public Law 92-500 as amended by Public Law 95-217 and Public Law 100-4, that adequate facilities for the safe and sanitary removal and treatment of..., including 75 rare species. [[Page 28247

  14. Urinary excretion of 3-methylhistidine and creatinine by healthy Dutch children during day and night. The influence of age and sex

    NARCIS (Netherlands)

    Speek, A.J.; Thissen, J.T.N.M.; Schrijver, J.

    1986-01-01

    The urinary excretion of 3-methylhistidine and creatinine and the urinary 3-methylhistidine to creatinine excretion ratio during day and night were investigated in a group of 103 healthy, normally fed Dutch children (52 boys and 51 girls) aged 2-17 years. The 3-methylhistidine to creatinine ratio of

  15. Constitution, structure and magnetic properties of some rare-earth - cobalt-aluminium alloys

    International Nuclear Information System (INIS)

    Evans, J.; Harris, I.R.

    1982-01-01

    The constitution and structure of the alloys represented by the formulae Cesub(1-x)Alsub(x)Co 5 and Prsub(1-x)Alsub(x)Co 5 (where 0 = 5 produces a mixture of the 1:5 and 2:17 phases based on CeCo 5 and Ce 2 Co 17 ; there are two variations of the 2:17 phase which are isostructural with the hexagonal Th 2 Ni 17 -type and rhombohedral Th 2 Zn 17 -type phases. At the composition Cesub(0.76)Alsub(0.24)Co 5 (4 at % Al) the alloy consists only of the 2:17-type phases and metallographically the alloy is one phase in appearance. Further substitution of Al results in the precipitation of an fcc phase, based on the Co-Al solid solution, in the 2:17 matrix. The crystal structures of the Prsub(1-x)Alsub(x)Co 5 alloys are very similar to those of the equivalent cerium alloys. The metallographic structures of the Pr alloys in the composition range 1 to 3 at % Al show significant differences from the corresponding Ce alloys. Determination of the Curie temperatures of the Rsub(1-x)Alsub(x)Co 5 alloys (R = Ce and Pr) in the composition range 0 = 5 and PrCo 5 phases. (author)

  16. Predictors of Changes in Body Image Concerns of Chinese Adolescents

    Science.gov (United States)

    Chen, Hong; Jackson, Todd

    2009-01-01

    This nine-month prospective study tested the extent to which risk factors implicated in recent accounts of body dissatisfaction predicted changes in body image concerns of adolescent boys and girls in China. A sample of 593 Chinese adolescents (217 boys, 376 girls) completed measures of weight esteem, appearance esteem and physical stature concern…

  17. Cloning of chicken 11beta-hydroxysteroid dehydrogenase type 1 and its tissue distribution

    Czech Academy of Sciences Publication Activity Database

    Klusoňová, Petra; Kučka, Marek; Ergang, Peter; Mikšík, Ivan; Bryndová, Jana; Pácha, Jiří

    2008-01-01

    Roč. 111, 3-5 (2008), s. 217-224 ISSN 0960-0760 R&D Projects: GA AV ČR IAA6011201 Institutional research plan: CEZ:AV0Z50110509 Keywords : chicken * corticosterone * 11HSD1 Subject RIV: CE - Biochemistry Impact factor: 2.827, year: 2008

  18. Hazardous Waste Cleanup: IBM Corporation-TJ Watson Research Center in Yorktown Heights, New York

    Science.gov (United States)

    IBM Corporation -TJ Watson Research Center is located in southern Yorktown near the boundary separating the Town of Yorktown from the Town of New Castle. The site occupies an area of approximately 217 acres and adjoins land uses are predominantly residenti

  19. Examining the Clinical Correlates of Autism Spectrum Disorder in Youth by Ascertainment Source

    Science.gov (United States)

    Joshi, Gagan; Faraone, Stephen V.; Wozniak, Janet; Petty, Carter; Fried, Ronna; Galdo, Maribel; Furtak, Stephannie L.; McDermott, Katie; Epstien, Cecily; Walker, Rosemary; Caron, Ashley; Feinberg, Leah; Biederman, Joseph

    2014-01-01

    To examine whether presentation of autism spectrum disorder (ASD) and associated patterns of psychiatric comorbidity and dysfunction vary by referral source. ASD youth referred to a specialized ambulatory program for ASD (N = 143) were compared to ASD youth referred to a general child psychiatry clinic (N = 217). More ASD clinic youth met criteria…

  20. Journal of Clinical Monitoring and Computing 2015 end of year summary : tissue oxygenation and microcirculation

    NARCIS (Netherlands)

    Scheeren, T W L

    Last year we started this series of end of year summaries of papers published in the 2014 issues of the Journal Of Clinical Monitoring And Computing with a review on near infrared spectroscopy (Scheeren et al. in J Clin Monit Comput 29(2):217-220, 2015). This year we will broaden the scope and